F415010

General Info

Members Datasets Scaffolds Average Seq Length
342 215 684 139

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10375361|Ga0065704_103753612
Length 164
Sequence LPAWGRKGVACILAVQFGKMNAREPTTMKSYREELWFETKTRCAYLNITEQIEAAVKKSGVQEGLVLVNAMHITASVYINDDEPGLLKDYDRFLDALVPQNATYRHNETGEDNGDAHIKRQLMGREVVVAITEGRLDFGPWEQIFYGEFDGLRRKRVLVKVIGS

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 0.29
Rhizosphere 97.95
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10375361 3300005289 Bacteria 780
2 JGI24743J22301_10004610 3300001991 Bacteria 2256
3 JGI24033J26618_1000013 3300002155 Bacteria 29954
4 rootH2_10004745 3300003320 Bacteria 53021
5 rootL2_10257196 3300003322 Bacteria 3068
6 Ga0070690_100000107 3300005330 Bacteria 43179
7 Ga0070670_101055949 3300005331 Bacteria 740
8 Ga0070680_100998050 3300005336 Bacteria 723
9 Ga0068868_100543555 3300005338 Bacteria 1023
10 Ga0070660_100249881 3300005339 Bacteria 1446
11 Ga0070689_100000022 3300005340 Bacteria 127360
12 Ga0070691_10275451 3300005341 Bacteria 911
13 Ga0070687_100016081 3300005343 Bacteria 3402
14 Ga0070687_100267534 3300005343 Bacteria 1070
15 Ga0070692_10600928 3300005345 Bacteria 728
16 Ga0070675_100191561 3300005354 Bacteria 1772
17 Ga0070673_100907382 3300005364 Bacteria 817
18 Ga0070688_100001378 3300005365 Bacteria 12071
19 Ga0070701_10000175 3300005438 Bacteria 19804
20 Ga0070705_100027286 3300005440 Bacteria 3117
21 Ga0070705_100081194 3300005440 Bacteria 1992
22 Ga0070700_101718072 3300005441 Bacteria 539
23 Ga0070694_100020147 3300005444 Bacteria 4249
24 Ga0070694_100244781 3300005444 Bacteria 1354
25 Ga0070694_100414904 3300005444 Bacteria 1057
26 Ga0070708_100084670 3300005445 Bacteria 2876
27 Ga0070708_100717339 3300005445 Bacteria 941
28 Ga0070708_100767026 3300005445 Unclassified 907
29 Ga0070708_100815999 3300005445 Bacteria 877
30 Ga0070681_10004685 3300005458 Bacteria 13080
31 Ga0070681_10554083 3300005458 Bacteria 1063
32 Ga0068867_100002394 3300005459 Bacteria 13193
33 Ga0070685_10000110 3300005466 Bacteria 52202
34 Ga0070706_100007399 3300005467 Bacteria 10299
35 Ga0070706_100056142 3300005467 Bacteria 3634
36 Ga0070707_100000110 3300005468 Bacteria 75472
37 Ga0070707_100033769 3300005468 Bacteria 4878
38 Ga0070707_100052127 3300005468 Bacteria 3922
39 Ga0070707_100340225 3300005468 Bacteria 1457
40 Ga0070698_100040721 3300005471 Bacteria 4774
41 Ga0070698_100128240 3300005471 Bacteria 2493
42 Ga0070698_100312680 3300005471 Bacteria 1502
43 Ga0070698_100330508 3300005471 Bacteria 1455
44 Ga0070698_100452892 3300005471 Bacteria 1219
45 Ga0070699_100005174 3300005518 Bacteria 11477
46 Ga0070699_100015955 3300005518 Bacteria 6450
47 Ga0070699_100018815 3300005518 Bacteria 5933
48 Ga0070699_100239064 3300005518 Bacteria 1620
49 Ga0070679_100195938 3300005530 Bacteria 1988
50 Ga0070679_100238697 3300005530 Bacteria 1776
51 Ga0070697_100023334 3300005536 Bacteria 4919
52 Ga0070697_100028513 3300005536 Bacteria 4470
53 Ga0070697_100028836 3300005536 Bacteria 4447
54 Ga0070697_100036874 3300005536 Bacteria 3949
55 Ga0070686_100000025 3300005544 Bacteria 127360
56 Ga0070686_100003946 3300005544 Bacteria 8158
57 Ga0070686_100398935 3300005544 Bacteria 1045
58 Ga0070695_100117852 3300005545 Bacteria 1812
59 Ga0070696_100016571 3300005546 Bacteria 4966
60 Ga0070696_100730398 3300005546 Unclassified 809
61 Ga0070665_100159574 3300005548 Bacteria 2257
62 Ga0070704_100105152 3300005549 Bacteria 2137
63 Ga0070704_100222443 3300005549 Bacteria 1535
64 Ga0070704_100805705 3300005549 Bacteria 839
65 Ga0068855_100108873 3300005563 Bacteria 3182
66 Ga0070664_100528913 3300005564 Bacteria 1089
67 Ga0068857_100020829 3300005577 Bacteria 5768
68 Ga0068856_100193726 3300005614 Bacteria 2046
69 Ga0070702_100050017 3300005615 Bacteria 2386
70 Ga0068859_100000648 3300005617 Bacteria 34840
71 Ga0068859_100510672 3300005617 Bacteria 1297
72 Ga0068866_10378677 3300005718 Bacteria 907
73 Ga0068861_100195447 3300005719 Bacteria 1694
74 Ga0068863_100175957 3300005841 Bacteria 2054
75 Ga0068863_100488839 3300005841 Bacteria 1211
76 Ga0068858_100007935 3300005842 Bacteria 10228
77 Ga0068860_100433994 3300005843 Bacteria 1304
78 Ga0081539_10039633 3300005985 Bacteria 2776
79 Ga0081539_10130889 3300005985 Bacteria 1232
80 Ga0070715_10539615 3300006163 Bacteria 674
81 Ga0070716_100029194 3300006173 Bacteria 2979
82 Ga0070712_100406163 3300006175 Bacteria 1126
83 Ga0097621_100008183 3300006237 Bacteria 7521
84 Ga0097621_100055197 3300006237 Bacteria 3243
85 Ga0097621_100229357 3300006237 Bacteria 1621
86 Ga0068871_100003662 3300006358 Bacteria 10564
87 Ga0068871_100046456 3300006358 Bacteria 3497
88 Ga0068871_100465035 3300006358 Bacteria 1136
89 Ga0068871_100470556 3300006358 Bacteria 1129
90 Ga0075431_100464354 3300006847 Bacteria 1260
91 Ga0075433_10008945 3300006852 Bacteria 7995
92 Ga0075434_100093312 3300006871 Bacteria 3013
93 Ga0068865_100146979 3300006881 Bacteria 1784
94 Ga0068865_100148814 3300006881 Bacteria 1774
95 Ga0075436_100100674 3300006914 Bacteria 2012
96 Ga0097620_100000648 3300006931 Bacteria 34840
97 Ga0097620_100510620 3300006931 Bacteria 1297
98 Ga0075435_100031733 3300007076 Bacteria 4166
99 Ga0105240_10015831 3300009093 Bacteria 10231
100 Ga0105240_10062864 3300009093 Bacteria 4620
101 Ga0111539_10006836 3300009094 Bacteria 14657
102 Ga0105245_10761675 3300009098 Bacteria 1004
103 Ga0105247_10098212 3300009101 Bacteria 1869
104 Ga0114129_10158588 3300009147 Bacteria 3093
105 Ga0114129_12465795 3300009147 Bacteria 622
106 Ga0105243_10366781 3300009148 Bacteria 1327
107 Ga0105241_10044900 3300009174 Bacteria 3350
108 Ga0105241_10197065 3300009174 Bacteria 1680
109 Ga0105242_10017692 3300009176 Bacteria 5559
110 Ga0105242_10023822 3300009176 Bacteria 4829
111 Ga0105242_10087306 3300009176 Bacteria 2619
112 Ga0105242_10442581 3300009176 Bacteria 1223
113 Ga0105248_10002205 3300009177 Bacteria 21578
114 Ga0105248_10065784 3300009177 Bacteria 4070
115 Ga0105237_10064120 3300009545 Bacteria 3671
116 Ga0105238_10035599 3300009551 Bacteria 5061
117 Ga0105238_10218584 3300009551 Bacteria 1881
118 Ga0105238_10226839 3300009551 Bacteria 1845
119 Ga0105249_10601524 3300009553 Bacteria 1154
120 Ga0105249_11845422 3300009553 Bacteria 677
121 Ga0105239_10018426 3300010375 Bacteria 7712
122 Ga0157370_10155937 3300013104 Bacteria 2124
123 Ga0157369_10067790 3300013105 Bacteria 3835
124 Ga0157374_11020755 3300013296 Bacteria 846
125 Ga0157378_10473906 3300013297 Bacteria 1246
126 Ga0157378_12003508 3300013297 Bacteria 629
127 Ga0157378_12004597 3300013297 Bacteria 629
128 Ga0163162_12416842 3300013306 Bacteria 604
129 Ga0157372_12483216 3300013307 Bacteria 595
130 Ga0157375_10015505 3300013308 Bacteria 6823
131 Ga0163163_10044095 3300014325 Bacteria 4375
132 Ga0157380_10123958 3300014326 Bacteria 2193
133 Ga0182008_10017341 3300014497 Archaea 3737
134 Ga0157379_10047364 3300014968 Bacteria 3835
135 Ga0157376_10039130 3300014969 Bacteria 3864
136 Ga0207653_10156722 3300025885 Bacteria 841
137 Ga0207642_10296024 3300025899 Bacteria 936
138 Ga0207642_10365098 3300025899 Bacteria 855
139 Ga0207642_10598998 3300025899 Bacteria 686
140 Ga0207685_10022783 3300025905 Unclassified 2122
141 Ga0207684_10199444 3300025910 Bacteria 1726
142 Ga0207684_10848217 3300025910 Bacteria 770
143 Ga0207654_10331495 3300025911 Bacteria 1043
144 Ga0207654_10564384 3300025911 Bacteria 809
145 Ga0207707_10024625 3300025912 Bacteria 5268
146 Ga0207707_10026324 3300025912 Bacteria 5084
147 Ga0207707_10027137 3300025912 Bacteria 5007
148 Ga0207707_10028704 3300025912 Bacteria 4861
149 Ga0207695_10035889 3300025913 Bacteria 5367
150 Ga0207695_10102244 3300025913 Bacteria 2859
151 Ga0207671_10079512 3300025914 Bacteria 2457
152 Ga0207660_10557996 3300025917 Bacteria 932
153 Ga0207662_10047696 3300025918 Bacteria 2537
154 Ga0207662_10257588 3300025918 Bacteria 1147
155 Ga0207652_11670029 3300025921 Bacteria 541
156 Ga0207646_10000035 3300025922 Bacteria 209056
157 Ga0207646_10216475 3300025922 Bacteria 1730
158 Ga0207646_10240673 3300025922 Bacteria 1635
159 Ga0207646_10384772 3300025922 Bacteria 1267
160 Ga0207646_10688884 3300025922 Bacteria 914
161 Ga0207659_10066807 3300025926 Bacteria 2611
162 Ga0207659_11246526 3300025926 Bacteria 639
163 Ga0207687_10654157 3300025927 Bacteria 889
164 Ga0207686_10095095 3300025934 Bacteria 1976
165 Ga0207686_10271629 3300025934 Bacteria 1247
166 Ga0207686_10281745 3300025934 Bacteria 1227
167 Ga0207686_11211769 3300025934 Bacteria 618
168 Ga0207670_10000023 3300025936 Bacteria 145527
169 Ga0207670_10414207 3300025936 Bacteria 1080
170 Ga0207704_10178339 3300025938 Bacteria 1532
171 Ga0207665_10115277 3300025939 Bacteria 1893
172 Ga0207711_10002514 3300025941 Bacteria 16336
173 Ga0207711_10050652 3300025941 Bacteria 3555
174 Ga0207711_11560381 3300025941 Bacteria 603
175 Ga0207689_10916260 3300025942 Bacteria 739
176 Ga0207667_10234290 3300025949 Bacteria 1879
177 Ga0207712_10786672 3300025961 Bacteria 835
178 Ga0207640_10655297 3300025981 Bacteria 895
179 Ga0207703_10032489 3300026035 Bacteria 4131
180 Ga0207639_10074105 3300026041 Bacteria 2672
181 Ga0207708_10000228 3300026075 Bacteria 44336
182 Ga0207702_10618958 3300026078 Bacteria 1063
183 Ga0207641_10481076 3300026088 Bacteria 1203
184 Ga0207641_11032941 3300026088 Bacteria 819
185 Ga0207648_10003116 3300026089 Bacteria 17512
186 Ga0207674_10009486 3300026116 Bacteria 11113
187 Ga0207675_100227679 3300026118 Bacteria 1798
188 Ga0207683_10639767 3300026121 Bacteria 985
189 Ga0268266_10037241 3300028379 Bacteria 4145
190 Ga0268264_11540426 3300028381 Bacteria 675
191 Ga0265337_1009339 3300028556 Bacteria 3504
192 Ga0265337_1061801 3300028556 Bacteria 1037
193 Ga0265326_10015151 3300028558 Bacteria 2241
194 Ga0265319_1005501 3300028563 Bacteria 6059
195 Ga0265334_10035798 3300028573 Bacteria 1963
196 Ga0265334_10080255 3300028573 Bacteria 1202
197 Ga0265318_10015289 3300028577 Bacteria 3197
198 Ga0265323_10014078 3300028653 Bacteria 3177
199 Ga0265323_10015978 3300028653 Bacteria 2939
200 Ga0265323_10036165 3300028653 Bacteria 1817
201 Ga0265323_10239863 3300028653 Bacteria 565
202 Ga0265322_10050908 3300028654 Bacteria 1176
203 Ga0265338_10000101 3300028800 Bacteria 159323
204 Ga0265338_10005734 3300028800 Bacteria 16058
205 Ga0265338_10049566 3300028800 Bacteria 3805
206 Ga0265338_10108449 3300028800 Bacteria 2242
207 Ga0265338_10612476 3300028800 Bacteria 758
208 Ga0265324_10002412 3300029957 Bacteria 9620
209 Ga0265324_10009118 3300029957 Bacteria 3893
210 Ga0265332_10053809 3300031238 Bacteria 1727
211 Ga0265320_10033216 3300031240 Bacteria 2635
212 Ga0265320_10148165 3300031240 Bacteria 1060
213 Ga0265325_10006703 3300031241 Bacteria 6967
214 Ga0265325_10024801 3300031241 Bacteria 3258
215 Ga0265340_10192056 3300031247 Bacteria 920
216 Ga0265339_10004033 3300031249 Bacteria 10143
217 Ga0265331_10085343 3300031250 Bacteria 1463
218 Ga0265316_10008681 3300031344 Bacteria 9405
219 Ga0265316_10046383 3300031344 Bacteria 3443
220 Ga0265313_10000993 3300031595 Bacteria 27845
221 Ga0265313_10036890 3300031595 Bacteria 2451
222 Ga0265313_10241900 3300031595 Bacteria 738
223 Ga0265314_10011963 3300031711 Bacteria 7116
224 Ga0265314_10019808 3300031711 Bacteria 5202
225 Ga0265314_10196489 3300031711 Bacteria 1196
226 Ga0265342_10213454 3300031712 Bacteria 1042
227 Ga0316576_10310266 3300031727 Bacteria 1178
228 Ga0316578_10017945 3300031728 Bacteria 3865
229 Ga0316578_10591970 3300031728 Bacteria 650
230 Ga0316577_10283814 3300031733 Bacteria 937
231 Ga0316577_10478666 3300031733 Bacteria 708
232 Ga0307407_10828413 3300031903 Bacteria 706
233 Ga0373934_0218510 3300035086 Bacteria 786
234 Ga0373923_0541533 3300035111 Bacteria 570
235 Ga0373936_0450668 3300035113 Bacteria 595
236 Ga0373953_0073910 3300035117 Bacteria 1410
237 Ga0373954_0119292 3300035118 Bacteria 1280
238 Ga0373956_0530113 3300035119 Bacteria 562
239 Ga0373946_0084184 3300035171 Bacteria 1398
240 Ga0373946_0089462 3300035171 Bacteria 1362
241 Ga0373955_0328885 3300035172 Bacteria 924
242 Ga0373924_0067617 3300035410 Bacteria 1503
243 Ga0373931_0674050 3300035691 Bacteria 681
244 Ga0373931_0823083 3300035691 Bacteria 620
245 Ga0373935_0043798 3300035692 Bacteria 2818
246 Ga0373935_0085142 3300035692 Bacteria 2060
247 Ga0373935_0816080 3300035692 Bacteria 689
248 Ga0373927_0003751 3300035695 Bacteria 10788
249 Ga0373927_0017689 3300035695 Bacteria 4690
250 Ga0373933_0422082 3300035724 Bacteria 871
251 Ga0373947_0003794 3300035725 Bacteria 8910
252 Ga0373947_0176467 3300035725 Unclassified 1389
253 Ga0316582_0004470 3300036647 Bacteria 7079
254 Ga0316582_0039198 3300036647 Bacteria 2949
255 Ga0316582_0559559 3300036647 Bacteria 788
256 Ga0316584_0024699 3300036712 Bacteria 4400
257 Ga0316584_0598720 3300036712 Archaea 765
258 Ga0373925_0002956 3300037068 Bacteria 13418
259 Ga0373925_0121844 3300037068 Bacteria 2025
260 Ga0373925_0463226 3300037068 Bacteria 1039
261 Ga0395905_0037494 3300037471 Bacteria 4551
262 Ga0316581_0127970 3300037588 Bacteria 783
263 Ga0436363_1079450 3300039450 Bacteria 3349
264 Ga0436362_0468795 3300039453 Bacteria 1458
265 Ga0439433_0043445 3300041999 Bacteria 1049
266 Ga0439460_0151255 3300042461 Bacteria 774
267 Ga0451577_0000360 3300042876 Bacteria 84786
268 Ga0451577_0000476 3300042876 Bacteria 68574
269 Ga0451577_0081612 3300042876 Bacteria 2884
270 Ga0451577_0120791 3300042876 Bacteria 2347
271 Ga0451577_0969833 3300042876 Bacteria 764
272 Ga0451577_0989573 3300042876 Bacteria 755
273 Ga0451577_1751710 3300042876 Bacteria 546
274 Ga0453683_0148631 3300044673 Bacteria 1480
275 Ga0453683_0628300 3300044673 Bacteria 701
276 Ga0466965_0071582 3300044683 Bacteria 1744
277 Ga0466963_0071672 3300044694 Bacteria 2333
278 Ga0453684_0000197 3300044712 Bacteria 264445
279 Ga0453684_0000261 3300044712 Bacteria 226765
280 Ga0453684_0013423 3300044712 Bacteria 13304
281 Ga0453684_0092885 3300044712 Bacteria 3718
282 Ga0453684_0208858 3300044712 Bacteria 2271
283 Ga0453684_1100623 3300044712 Bacteria 839
284 Ga0453684_1186641 3300044712 Bacteria 802
285 Ga0466971_0000008 3300044719 Bacteria 108703
286 Ga0451576_0000354 3300045051 Bacteria 110089
287 Ga0451576_0005886 3300045051 Bacteria 15218
288 Ga0451576_0026939 3300045051 Bacteria 6176
289 Ga0451576_2203340 3300045051 Bacteria 566
290 Ga0451576_2717684 3300045051 Bacteria 504
291 Ga0466967_0047641 3300045976 Bacteria 3737
292 Ga0495592_0136678 3300046454 Bacteria 1709
293 Ga0495603_0391474 3300046455 Bacteria 797
294 Ga0495603_0463015 3300046455 Bacteria 726
295 Ga0495653_0786473 3300046463 Bacteria 573
296 Ga0495582_0144270 3300046473 Bacteria 1350
297 Ga0495594_0003035 3300046499 Bacteria 8703
298 Ga0495594_0004201 3300046499 Bacteria 7394
299 Ga0495594_0476230 3300046499 Bacteria 710
300 Ga0495618_0566389 3300046514 Bacteria 679
301 Ga0495630_0144500 3300046517 Bacteria 1809
302 Ga0495640_0420381 3300046533 Bacteria 819
303 Ga0495622_0132026 3300046557 Bacteria 1137
304 Ga0495635_0044250 3300046663 Bacteria 3072
305 Ga0495658_0575836 3300046683 Bacteria 721
306 Ga0495624_0456953 3300046690 Bacteria 765
307 Ga0495581_0006289 3300047315 Bacteria 6886
308 Ga0495636_0076760 3300047318 Bacteria 1433
309 Ga0495680_0180405 3300047322 Bacteria 1524
310 Ga0495614_0175018 3300048089 Bacteria 964
311 Ga0496115_0146837 3300048918 Bacteria 1946
312 Ga0501032_0018457 3300049569 Bacteria 4887
313 Ga0501032_0137924 3300049569 Bacteria 1607
314 Ga0501037_0000080 3300049573 Bacteria 87262
315 Ga0501038_0000240 3300049574 Bacteria 46263
316 Ga0501069_0228394 3300049585 Bacteria 1083
317 Ga0501071_1610951 3300049587 Bacteria 501
318 Ga0501073_0168796 3300049589 Bacteria 1515
319 Ga0501075_0379232 3300049591 Bacteria 1078
320 Ga0501075_1150284 3300049591 Bacteria 589
321 Ga0501044_0003710 3300049823 Bacteria 17153
322 Ga0501045_0768157 3300049824 Bacteria 710
323 nmdc:mga05p37_1745461_c1 3300050507 Bacteria 604
324 nmdc:mga0qj67_94552_c1 3300050509 Bacteria 2404
325 nmdc:mga06r32_18937_c1 3300050510 Bacteria 6312
326 nmdc:mga08y16_53280_c1 3300050511 Bacteria 4231
327 nmdc:mga0n895_687339_c1 3300050512 Bacteria 1020
328 nmdc:mga0rr50_1501809_c1 3300050513 Bacteria 570
329 nmdc:mga08x19_77535_c1 3300050514 Bacteria 2176
330 nmdc:mga0a205_110573_c1 3300050515 Bacteria 2646
331 nmdc:mga0a205_36782_c1 3300050515 Bacteria 4706
332 nmdc:mga0a205_692593_c1 3300050515 Bacteria 869
333 Ga0495601_0151456 3300053077 Bacteria 1514
334 Ga0495601_0341350 3300053077 Bacteria 974
335 Ga0495595_0060550 3300053084 Bacteria 1772
336 Ga0495619_0111095 3300053085 Bacteria 1873
337 Ga0495619_0990955 3300053085 Bacteria 562
338 Ga0500555_000004 3300053103 Bacteria 343705
339 Ga0500556_0056385 3300053104 Bacteria 1435
340 Ga0500645_081131 3300053730 Bacteria 926
341 Ga0466962_0000004 3300061719 Bacteria 179133
342 Ga0530510_0050599 3300061734 Bacteria 3001
343 Ga0065704_10375361
344 JGI24743J22301_10004610
345 JGI24033J26618_1000013
346 rootH2_10004745
347 rootL2_10257196
348 Ga0070690_100000107
349 Ga0070670_101055949
350 Ga0070680_100998050
351 Ga0068868_100543555
352 Ga0070660_100249881
353 Ga0070689_100000022
354 Ga0070691_10275451
355 Ga0070687_100016081
356 Ga0070687_100267534
357 Ga0070692_10600928
358 Ga0070675_100191561
359 Ga0070673_100907382
360 Ga0070688_100001378
361 Ga0070701_10000175
362 Ga0070705_100027286
363 Ga0070705_100081194
364 Ga0070700_101718072
365 Ga0070694_100020147
366 Ga0070694_100244781
367 Ga0070694_100414904
368 Ga0070708_100084670
369 Ga0070708_100717339
370 Ga0070708_100767026
371 Ga0070708_100815999
372 Ga0070681_10004685
373 Ga0070681_10554083
374 Ga0068867_100002394
375 Ga0070685_10000110
376 Ga0070706_100007399
377 Ga0070706_100056142
378 Ga0070707_100000110
379 Ga0070707_100033769
380 Ga0070707_100052127
381 Ga0070707_100340225
382 Ga0070698_100040721
383 Ga0070698_100128240
384 Ga0070698_100312680
385 Ga0070698_100330508
386 Ga0070698_100452892
387 Ga0070699_100005174
388 Ga0070699_100015955
389 Ga0070699_100018815
390 Ga0070699_100239064
391 Ga0070679_100195938
392 Ga0070679_100238697
393 Ga0070697_100023334
394 Ga0070697_100028513
395 Ga0070697_100028836
396 Ga0070697_100036874
397 Ga0070686_100000025
398 Ga0070686_100003946
399 Ga0070686_100398935
400 Ga0070695_100117852
401 Ga0070696_100016571
402 Ga0070696_100730398
403 Ga0070665_100159574
404 Ga0070704_100105152
405 Ga0070704_100222443
406 Ga0070704_100805705
407 Ga0068855_100108873
408 Ga0070664_100528913
409 Ga0068857_100020829
410 Ga0068856_100193726
411 Ga0070702_100050017
412 Ga0068859_100000648
413 Ga0068859_100510672
414 Ga0068866_10378677
415 Ga0068861_100195447
416 Ga0068863_100175957
417 Ga0068863_100488839
418 Ga0068858_100007935
419 Ga0068860_100433994
420 Ga0081539_10039633
421 Ga0081539_10130889
422 Ga0070715_10539615
423 Ga0070716_100029194
424 Ga0070712_100406163
425 Ga0097621_100008183
426 Ga0097621_100055197
427 Ga0097621_100229357
428 Ga0068871_100003662
429 Ga0068871_100046456
430 Ga0068871_100465035
431 Ga0068871_100470556
432 Ga0075431_100464354
433 Ga0075433_10008945
434 Ga0075434_100093312
435 Ga0068865_100146979
436 Ga0068865_100148814
437 Ga0075436_100100674
438 Ga0097620_100000648
439 Ga0097620_100510620
440 Ga0075435_100031733
441 Ga0105240_10015831
442 Ga0105240_10062864
443 Ga0111539_10006836
444 Ga0105245_10761675
445 Ga0105247_10098212
446 Ga0114129_10158588
447 Ga0114129_12465795
448 Ga0105243_10366781
449 Ga0105241_10044900
450 Ga0105241_10197065
451 Ga0105242_10017692
452 Ga0105242_10023822
453 Ga0105242_10087306
454 Ga0105242_10442581
455 Ga0105248_10002205
456 Ga0105248_10065784
457 Ga0105237_10064120
458 Ga0105238_10035599
459 Ga0105238_10218584
460 Ga0105238_10226839
461 Ga0105249_10601524
462 Ga0105249_11845422
463 Ga0105239_10018426
464 Ga0157370_10155937
465 Ga0157369_10067790
466 Ga0157374_11020755
467 Ga0157378_10473906
468 Ga0157378_12003508
469 Ga0157378_12004597
470 Ga0163162_12416842
471 Ga0157372_12483216
472 Ga0157375_10015505
473 Ga0163163_10044095
474 Ga0157380_10123958
475 Ga0182008_10017341
476 Ga0157379_10047364
477 Ga0157376_10039130
478 Ga0207653_10156722
479 Ga0207642_10296024
480 Ga0207642_10365098
481 Ga0207642_10598998
482 Ga0207685_10022783
483 Ga0207684_10199444
484 Ga0207684_10848217
485 Ga0207654_10331495
486 Ga0207654_10564384
487 Ga0207707_10024625
488 Ga0207707_10026324
489 Ga0207707_10027137
490 Ga0207707_10028704
491 Ga0207695_10035889
492 Ga0207695_10102244
493 Ga0207671_10079512
494 Ga0207660_10557996
495 Ga0207662_10047696
496 Ga0207662_10257588
497 Ga0207652_11670029
498 Ga0207646_10000035
499 Ga0207646_10216475
500 Ga0207646_10240673
501 Ga0207646_10384772
502 Ga0207646_10688884
503 Ga0207659_10066807
504 Ga0207659_11246526
505 Ga0207687_10654157
506 Ga0207686_10095095
507 Ga0207686_10271629
508 Ga0207686_10281745
509 Ga0207686_11211769
510 Ga0207670_10000023
511 Ga0207670_10414207
512 Ga0207704_10178339
513 Ga0207665_10115277
514 Ga0207711_10002514
515 Ga0207711_10050652
516 Ga0207711_11560381
517 Ga0207689_10916260
518 Ga0207667_10234290
519 Ga0207712_10786672
520 Ga0207640_10655297
521 Ga0207703_10032489
522 Ga0207639_10074105
523 Ga0207708_10000228
524 Ga0207702_10618958
525 Ga0207641_10481076
526 Ga0207641_11032941
527 Ga0207648_10003116
528 Ga0207674_10009486
529 Ga0207675_100227679
530 Ga0207683_10639767
531 Ga0268266_10037241
532 Ga0268264_11540426
533 Ga0265337_1009339
534 Ga0265337_1061801
535 Ga0265326_10015151
536 Ga0265319_1005501
537 Ga0265334_10035798
538 Ga0265334_10080255
539 Ga0265318_10015289
540 Ga0265323_10014078
541 Ga0265323_10015978
542 Ga0265323_10036165
543 Ga0265323_10239863
544 Ga0265322_10050908
545 Ga0265338_10000101
546 Ga0265338_10005734
547 Ga0265338_10049566
548 Ga0265338_10108449
549 Ga0265338_10612476
550 Ga0265324_10002412
551 Ga0265324_10009118
552 Ga0265332_10053809
553 Ga0265320_10033216
554 Ga0265320_10148165
555 Ga0265325_10006703
556 Ga0265325_10024801
557 Ga0265340_10192056
558 Ga0265339_10004033
559 Ga0265331_10085343
560 Ga0265316_10008681
561 Ga0265316_10046383
562 Ga0265313_10000993
563 Ga0265313_10036890
564 Ga0265313_10241900
565 Ga0265314_10011963
566 Ga0265314_10019808
567 Ga0265314_10196489
568 Ga0265342_10213454
569 Ga0316576_10310266
570 Ga0316578_10017945
571 Ga0316578_10591970
572 Ga0316577_10283814
573 Ga0316577_10478666
574 Ga0307407_10828413
575 Ga0373934_0218510
576 Ga0373923_0541533
577 Ga0373936_0450668
578 Ga0373953_0073910
579 Ga0373954_0119292
580 Ga0373956_0530113
581 Ga0373946_0084184
582 Ga0373946_0089462
583 Ga0373955_0328885
584 Ga0373924_0067617
585 Ga0373931_0674050
586 Ga0373931_0823083
587 Ga0373935_0043798
588 Ga0373935_0085142
589 Ga0373935_0816080
590 Ga0373927_0003751
591 Ga0373927_0017689
592 Ga0373933_0422082
593 Ga0373947_0003794
594 Ga0373947_0176467
595 Ga0316582_0004470
596 Ga0316582_0039198
597 Ga0316582_0559559
598 Ga0316584_0024699
599 Ga0316584_0598720
600 Ga0373925_0002956
601 Ga0373925_0121844
602 Ga0373925_0463226
603 Ga0395905_0037494
604 Ga0316581_0127970
605 Ga0436363_1079450
606 Ga0436362_0468795
607 Ga0439433_0043445
608 Ga0439460_0151255
609 Ga0451577_0000360
610 Ga0451577_0000476
611 Ga0451577_0081612
612 Ga0451577_0120791
613 Ga0451577_0969833
614 Ga0451577_0989573
615 Ga0451577_1751710
616 Ga0453683_0148631
617 Ga0453683_0628300
618 Ga0466965_0071582
619 Ga0466963_0071672
620 Ga0453684_0000197
621 Ga0453684_0000261
622 Ga0453684_0013423
623 Ga0453684_0092885
624 Ga0453684_0208858
625 Ga0453684_1100623
626 Ga0453684_1186641
627 Ga0466971_0000008
628 Ga0451576_0000354
629 Ga0451576_0005886
630 Ga0451576_0026939
631 Ga0451576_2203340
632 Ga0451576_2717684
633 Ga0466967_0047641
634 Ga0495592_0136678
635 Ga0495603_0391474
636 Ga0495603_0463015
637 Ga0495653_0786473
638 Ga0495582_0144270
639 Ga0495594_0003035
640 Ga0495594_0004201
641 Ga0495594_0476230
642 Ga0495618_0566389
643 Ga0495630_0144500
644 Ga0495640_0420381
645 Ga0495622_0132026
646 Ga0495635_0044250
647 Ga0495658_0575836
648 Ga0495624_0456953
649 Ga0495581_0006289
650 Ga0495636_0076760
651 Ga0495680_0180405
652 Ga0495614_0175018
653 Ga0496115_0146837
654 Ga0501032_0018457
655 Ga0501032_0137924
656 Ga0501037_0000080
657 Ga0501038_0000240
658 Ga0501069_0228394
659 Ga0501071_1610951
660 Ga0501073_0168796
661 Ga0501075_0379232
662 Ga0501075_1150284
663 Ga0501044_0003710
664 Ga0501045_0768157
665 nmdc:mga05p37_1745461_c1
666 nmdc:mga0qj67_94552_c1
667 nmdc:mga06r32_18937_c1
668 nmdc:mga08y16_53280_c1
669 nmdc:mga0n895_687339_c1
670 nmdc:mga0rr50_1501809_c1
671 nmdc:mga08x19_77535_c1
672 nmdc:mga0a205_110573_c1
673 nmdc:mga0a205_36782_c1
674 nmdc:mga0a205_692593_c1
675 Ga0495601_0151456
676 Ga0495601_0341350
677 Ga0495595_0060550
678 Ga0495619_0111095
679 Ga0495619_0990955
680 Ga0500555_000004
681 Ga0500556_0056385
682 Ga0500645_081131
683 Ga0466962_0000004
684 Ga0530510_0050599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

47

161

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9836 1 139
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.975 1 139
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9681 1 139
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9637 4 137
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9482 4 137
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9747 1 139 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9678 1 139 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9528 6 137 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9458 4 139 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9438 2 139 2.60.120.460
ID Description Score Start End GO Terms
AF-C8W673-F1-model_v4 Polynucleotide adenylyltransferase/metal dependent phosphohydrolase (EC 2.7.7.72) 0.9922 1 139 GO:0000049
GO:0000166
GO:0008033
GO:0016787
GO:0160016
AF-A7C3B4-F1-model_v4 deleted 0.9922 2 139
AF-A0A1V4XI05-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.992 2 139
AF-A0A2N5YRF0-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9917 1 139
AF-A0A821KC14-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9917 5 139

Map