F415085

General Info

Members Datasets Scaffolds Average Seq Length
342 148 342 129

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_102077543|Ga0068855_1020775431
Length 139
Sequence MEFTWLSRWQPQLLAILRIVAALLLLEHGLMKLFHFPAPQVPGPLPPMLLAAAIIELVTGVLMTIGLFTRLAAFIASGEMAVAYFIGHFPKSFWPGINMGDAAILFCFIFLYIAAAGPGAWSVHGALLRSRTRGLDRFR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
66 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
124 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
125 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
126 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
142 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
143 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
147 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0.29
Rhizoplane 0
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1004643 3300001915 Bacteria 3005
2 JGI24741J21665_1012194 3300001915 Bacteria 1483
3 JGI24740J21852_10014474 3300001979 Bacteria 2908
4 JGI24739J22299_10014021 3300001989 Bacteria 2919
5 JGI24739J22299_10064169 3300001989 Bacteria 1155
6 JGI24739J22299_10083551 3300001989 Bacteria 978
7 JGI24737J22298_10008374 3300001990 Bacteria 3465
8 JGI24737J22298_10011280 3300001990 Bacteria 2931
9 JGI24735J21928_10001836 3300002067 Bacteria 7447
10 JGI24735J21928_10010105 3300002067 Bacteria 3017
11 JGI24735J21928_10049053 3300002067 Bacteria 1220
12 JGI24735J21928_10081897 3300002067 Bacteria 924
13 Ga0058861_11546344 3300004800 Unclassified 670
14 Ga0070658_10038227 3300005327 Bacteria 3871
15 Ga0070658_10169415 3300005327 Bacteria 1834
16 Ga0070658_10383686 3300005327 Bacteria 1206
17 Ga0070658_10738306 3300005327 Bacteria 855
18 Ga0070658_11364006 3300005327 Bacteria 615
19 Ga0070683_100069424 3300005329 Bacteria 3285
20 Ga0070683_100273525 3300005329 Bacteria 1607
21 Ga0070670_101059219 3300005331 Bacteria 739
22 Ga0070677_10004554 3300005333 Bacteria 4528
23 Ga0070677_10178659 3300005333 Bacteria 1009
24 Ga0070680_100066334 3300005336 Bacteria 2959
25 Ga0070682_100009673 3300005337 Bacteria 5456
26 Ga0070682_100765169 3300005337 Bacteria 781
27 Ga0070682_101596843 3300005337 Bacteria 564
28 Ga0070660_100077229 3300005339 Bacteria 2609
29 Ga0070660_100129693 3300005339 Bacteria 2017
30 Ga0070660_100284702 3300005339 Bacteria 1353
31 Ga0070660_101226225 3300005339 Bacteria 636
32 Ga0070661_100028580 3300005344 Bacteria 4022
33 Ga0070661_100439048 3300005344 Bacteria 1037
34 Ga0070661_100979326 3300005344 Bacteria 701
35 Ga0070692_10016602 3300005345 Bacteria 3503
36 Ga0070668_100596601 3300005347 Bacteria 966
37 Ga0070674_100191125 3300005356 Bacteria 1575
38 Ga0070659_100002369 3300005366 Bacteria 13389
39 Ga0070659_100037622 3300005366 Bacteria 3773
40 Ga0070659_100154980 3300005366 Bacteria 1870
41 Ga0070659_100200449 3300005366 Bacteria 1643
42 Ga0070659_100904391 3300005366 Bacteria 771
43 Ga0070667_100861306 3300005367 Bacteria 843
44 Ga0070714_100087684 3300005435 Bacteria 2722
45 Ga0070713_100435690 3300005436 Bacteria 1229
46 Ga0070694_100024102 3300005444 Bacteria 3925
47 Ga0070663_100014759 3300005455 Bacteria 5022
48 Ga0070663_100659612 3300005455 Bacteria 886
49 Ga0070662_100117270 3300005457 Bacteria 2036
50 Ga0070662_100377351 3300005457 Bacteria 1166
51 Ga0070662_100937158 3300005457 Bacteria 740
52 Ga0070662_101064246 3300005457 Bacteria 693
53 Ga0070681_10128909 3300005458 Bacteria 2462
54 Ga0070679_100079458 3300005530 Bacteria 3269
55 Ga0070679_100121057 3300005530 Bacteria 2602
56 Ga0070679_101150718 3300005530 Bacteria 721
57 Ga0070684_100451997 3300005535 Bacteria 1187
58 Ga0070684_100599870 3300005535 Bacteria 1024
59 Ga0070684_100732810 3300005535 Bacteria 922
60 Ga0068853_100105844 3300005539 Bacteria 2492
61 Ga0068853_100123486 3300005539 Bacteria 2312
62 Ga0068853_100351616 3300005539 Bacteria 1371
63 Ga0068853_100902477 3300005539 Bacteria 849
64 Ga0070672_100252266 3300005543 Bacteria 1486
65 Ga0070695_100076416 3300005545 Bacteria 2205
66 Ga0070696_100024262 3300005546 Bacteria 4121
67 Ga0070693_100024924 3300005547 Bacteria 3214
68 Ga0070693_100033041 3300005547 Bacteria 2852
69 Ga0070665_100118831 3300005548 Bacteria 2646
70 Ga0068855_100099454 3300005563 Bacteria 3350
71 Ga0068855_100121684 3300005563 Bacteria 2987
72 Ga0068855_100212294 3300005563 Bacteria 2174
73 Ga0068855_101566354 3300005563 Bacteria 675
74 Ga0068855_101936010 3300005563 Bacteria 596
75 Ga0068855_102077543 3300005563 Bacteria 572
76 Ga0070664_100064408 3300005564 Bacteria 3126
77 Ga0070664_100068443 3300005564 Bacteria 3035
78 Ga0070664_100293071 3300005564 Bacteria 1469
79 Ga0070664_100611923 3300005564 Bacteria 1011
80 Ga0068857_100120545 3300005577 Bacteria 2361
81 Ga0068854_100091910 3300005578 Bacteria 2259
82 Ga0068854_100107174 3300005578 Bacteria 2103
83 Ga0068854_100126590 3300005578 Bacteria 1946
84 Ga0068854_100384424 3300005578 Bacteria 1157
85 Ga0068854_100865224 3300005578 Bacteria 792
86 Ga0068854_101988276 3300005578 Bacteria 535
87 Ga0068856_100160593 3300005614 Bacteria 2258
88 Ga0068856_100309374 3300005614 Bacteria 1598
89 Ga0068852_100138266 3300005616 Bacteria 2251
90 Ga0068852_100197393 3300005616 Bacteria 1902
91 Ga0068852_100655259 3300005616 Bacteria 1058
92 Ga0068852_100839820 3300005616 Bacteria 934
93 Ga0068859_102495748 3300005617 Bacteria 569
94 Ga0068864_100002429 3300005618 Bacteria 15405
95 Ga0068861_100586179 3300005719 Bacteria 1021
96 Ga0068851_10019298 3300005834 Bacteria 3293
97 Ga0068863_100808491 3300005841 Bacteria 935
98 Ga0068858_100000022 3300005842 Bacteria 169718
99 Ga0097620_102495479 3300006931 Bacteria 569
100 Ga0105240_12264117 3300009093 Bacteria 563
101 Ga0105241_10343744 3300009174 Bacteria 1293
102 Ga0105237_10294126 3300009545 Bacteria 1627
103 Ga0105238_12430006 3300009551 Bacteria 560
104 Ga0105249_10229030 3300009553 Bacteria 1832
105 Ga0105239_10965439 3300010375 Bacteria 979
106 Ga0105239_11742038 3300010375 Bacteria 721
107 Ga0157373_10058176 3300013100 Bacteria 2741
108 Ga0157373_10134035 3300013100 Bacteria 1741
109 Ga0157373_10826875 3300013100 Bacteria 684
110 Ga0157373_10970660 3300013100 Bacteria 633
111 Ga0157371_10155582 3300013102 Bacteria 1631
112 Ga0157371_10198871 3300013102 Bacteria 1436
113 Ga0157371_10304167 3300013102 Bacteria 1155
114 Ga0157370_10075533 3300013104 Bacteria 3176
115 Ga0157370_10229110 3300013104 Bacteria 1720
116 Ga0157370_10343345 3300013104 Bacteria 1376
117 Ga0157370_10930000 3300013104 Bacteria 788
118 Ga0157370_11367562 3300013104 Bacteria 637
119 Ga0157369_10158745 3300013105 Bacteria 2388
120 Ga0157369_10232983 3300013105 Bacteria 1925
121 Ga0157369_10403765 3300013105 Bacteria 1418
122 Ga0157374_11528025 3300013296 Bacteria 691
123 Ga0163162_10001764 3300013306 Bacteria 20274
124 Ga0157372_10110039 3300013307 Bacteria 3155
125 Ga0157372_10491105 3300013307 Bacteria 1432
126 Ga0157372_10593620 3300013307 Bacteria 1291
127 Ga0157372_10913363 3300013307 Bacteria 1018
128 Ga0157372_11520360 3300013307 Bacteria 771
129 Ga0163163_10598783 3300014325 Bacteria 1165
130 Ga0182008_10032946 3300014497 Bacteria 2601
131 Ga0163161_10705304 3300017792 Bacteria 840
132 Ga0197907_10176170 3300020069 Bacteria 835
133 Ga0206353_11225564 3300020082 Bacteria 1257
134 Ga0214544_1005350 3300021320 Bacteria 24925
135 Ga0207697_10036370 3300025315 Bacteria 2016
136 Ga0207656_10019714 3300025321 Bacteria 2670
137 Ga0207682_10302490 3300025893 Bacteria 750
138 Ga0207680_10149173 3300025903 Bacteria 1558
139 Ga0207647_10078338 3300025904 Bacteria 1985
140 Ga0207647_10515325 3300025904 Bacteria 666
141 Ga0207647_10609826 3300025904 Bacteria 601
142 Ga0207705_10037717 3300025909 Bacteria 3458
143 Ga0207705_10044303 3300025909 Bacteria 3197
144 Ga0207705_10155294 3300025909 Bacteria 1716
145 Ga0207705_10163676 3300025909 Bacteria 1672
146 Ga0207705_11270093 3300025909 Bacteria 563
147 Ga0207707_10037790 3300025912 Bacteria 4218
148 Ga0207695_11283372 3300025913 Unclassified 613
149 Ga0207660_10174869 3300025917 Bacteria 1664
150 Ga0207660_11039002 3300025917 Bacteria 668
151 Ga0207657_10009468 3300025919 Bacteria 9786
152 Ga0207657_10038591 3300025919 Bacteria 4250
153 Ga0207657_10059194 3300025919 Bacteria 3294
154 Ga0207657_10149820 3300025919 Bacteria 1901
155 Ga0207657_10218877 3300025919 Bacteria 1526
156 Ga0207657_10244585 3300025919 Bacteria 1431
157 Ga0207657_10349106 3300025919 Bacteria 1167
158 Ga0207649_10023939 3300025920 Bacteria 3542
159 Ga0207649_10269937 3300025920 Bacteria 1232
160 Ga0207652_10096961 3300025921 Bacteria 2598
161 Ga0207652_10124072 3300025921 Bacteria 2300
162 Ga0207650_10462889 3300025925 Bacteria 1056
163 Ga0207700_10053304 3300025928 Bacteria 3030
164 Ga0207700_10283397 3300025928 Bacteria 1426
165 Ga0207664_10030390 3300025929 Bacteria 4125
166 Ga0207664_10052766 3300025929 Bacteria 3216
167 Ga0207664_11922338 3300025929 Unclassified 514
168 Ga0207690_10001436 3300025932 Bacteria 14907
169 Ga0207690_10011810 3300025932 Bacteria 5224
170 Ga0207690_10237637 3300025932 Bacteria 1402
171 Ga0207690_10307519 3300025932 Bacteria 1242
172 Ga0207690_10645998 3300025932 Bacteria 867
173 Ga0207706_10007350 3300025933 Bacteria 10184
174 Ga0207706_10235289 3300025933 Bacteria 1601
175 Ga0207706_10422642 3300025933 Bacteria 1154
176 Ga0207669_10677706 3300025937 Bacteria 845
177 Ga0207691_10135883 3300025940 Bacteria 2168
178 Ga0207661_10056192 3300025944 Bacteria 3159
179 Ga0207661_10400442 3300025944 Bacteria 1245
180 Ga0207661_10853743 3300025944 Bacteria 838
181 Ga0207679_10036705 3300025945 Bacteria 3477
182 Ga0207679_10889674 3300025945 Bacteria 814
183 Ga0207679_11156541 3300025945 Bacteria 710
184 Ga0207667_10138370 3300025949 Bacteria 2507
185 Ga0207667_10210713 3300025949 Bacteria 1992
186 Ga0207667_10284017 3300025949 Bacteria 1691
187 Ga0207667_10345726 3300025949 Bacteria 1517
188 Ga0207712_10222610 3300025961 Bacteria 1509
189 Ga0207640_10041338 3300025981 Bacteria 2932
190 Ga0207640_10153537 3300025981 Bacteria 1694
191 Ga0207640_10704332 3300025981 Bacteria 866
192 Ga0207658_11636810 3300025986 Unclassified 588
193 Ga0207677_10734439 3300026023 Bacteria 879
194 Ga0207703_10000048 3300026035 Bacteria 151143
195 Ga0207639_10201502 3300026041 Bacteria 1707
196 Ga0207639_10365157 3300026041 Bacteria 1293
197 Ga0207639_10506160 3300026041 Bacteria 1104
198 Ga0207639_10732381 3300026041 Bacteria 919
199 Ga0207678_10011830 3300026067 Bacteria 7662
200 Ga0207678_10051658 3300026067 Bacteria 3548
201 Ga0207678_10093085 3300026067 Bacteria 2576
202 Ga0207702_10597870 3300026078 Bacteria 1082
203 Ga0207702_10771493 3300026078 Bacteria 950
204 Ga0207676_10000147 3300026095 Bacteria 61708
205 Ga0207674_10017810 3300026116 Bacteria 7744
206 Ga0207674_10039756 3300026116 Bacteria 4874
207 Ga0207674_10978376 3300026116 Bacteria 815
208 Ga0207675_100562514 3300026118 Bacteria 1140
209 Ga0207698_10032261 3300026142 Bacteria 3792
210 Ga0207698_10082938 3300026142 Bacteria 2593
211 Ga0207698_10382357 3300026142 Bacteria 1340
212 Ga0207698_10443031 3300026142 Bacteria 1252
213 Ga0207698_11515271 3300026142 Bacteria 686
214 Ga0268266_10377193 3300028379 Bacteria 1337
215 Ga0307408_100383075 3300031548 Bacteria 1203
216 Ga0307405_10008576 3300031731 Bacteria 5192
217 Ga0307413_10221079 3300031824 Bacteria 1383
218 Ga0307410_10004260 3300031852 Bacteria 7363
219 Ga0307410_10052225 3300031852 Bacteria 2759
220 Ga0307406_10052478 3300031901 Bacteria 2593
221 Ga0307407_10102232 3300031903 Bacteria 1781
222 Ga0307407_10945223 3300031903 Unclassified 663
223 Ga0307412_10010538 3300031911 Bacteria 5324
224 Ga0307412_10906720 3300031911 Archaea 773
225 Ga0307409_100002876 3300031995 Bacteria 9129
226 Ga0307409_100168748 3300031995 Bacteria 1923
227 Ga0307409_100634629 3300031995 Bacteria 1060
228 Ga0307416_100004402 3300032002 Bacteria 8485
229 Ga0307416_102457418 3300032002 Unclassified 620
230 Ga0307414_10538830 3300032004 Bacteria 1039
231 Ga0307411_10004420 3300032005 Bacteria 6729
232 Ga0307415_100005329 3300032126 Bacteria 6813
233 Ga0307415_100063012 3300032126 Bacteria 2574
234 Ga0373960_0077709 3300035121 Bacteria 1039
235 Ga0373943_0336747 3300035170 Bacteria 862
236 Ga0373935_0001587 3300035692 Bacteria 12668
237 Ga0395899_0002312 3300037312 Bacteria 15534
238 Ga0395899_0189080 3300037312 Bacteria 1441
239 Ga0395899_0245186 3300037312 Bacteria 1231
240 Ga0395899_0299444 3300037312 Bacteria 1089
241 Ga0395899_0427404 3300037312 Bacteria 872
242 Ga0395899_0711790 3300037312 Bacteria 629
243 Ga0395899_0747110 3300037312 Bacteria 609
244 Ga0395900_0003562 3300037418 Bacteria 16749
245 Ga0395900_0004612 3300037418 Bacteria 14542
246 Ga0395900_0064523 3300037418 Bacteria 3763
247 Ga0395900_0075050 3300037418 Bacteria 3476
248 Ga0395900_0090839 3300037418 Bacteria 3138
249 Ga0395900_0106698 3300037418 Bacteria 2877
250 Ga0395900_0147829 3300037418 Bacteria 2402
251 Ga0395900_0466675 3300037418 Bacteria 1216
252 Ga0395900_0917489 3300037418 Unclassified 799
253 Ga0395900_1061232 3300037418 Bacteria 728
254 Ga0395900_1932829 3300037418 Bacteria 500
255 Ga0395898_0001747 3300037466 Bacteria 28657
256 Ga0395898_0106503 3300037466 Bacteria 2689
257 Ga0395898_0126026 3300037466 Bacteria 2453
258 Ga0395898_0144937 3300037466 Bacteria 2273
259 Ga0395898_0410766 3300037466 Bacteria 1290
260 Ga0395898_0439706 3300037466 Bacteria 1242
261 Ga0395898_0530850 3300037466 Bacteria 1118
262 Ga0395898_0982403 3300037466 Bacteria 780
263 Ga0395905_0002321 3300037471 Bacteria 21296
264 Ga0395905_0003161 3300037471 Bacteria 17741
265 Ga0395905_0007786 3300037471 Bacteria 10623
266 Ga0395905_0013402 3300037471 Bacteria 7855
267 Ga0395905_0025874 3300037471 Bacteria 5530
268 Ga0395905_0028761 3300037471 Bacteria 5237
269 Ga0395905_0044581 3300037471 Bacteria 4162
270 Ga0395905_0046250 3300037471 Bacteria 4080
271 Ga0395905_0132468 3300037471 Bacteria 2344
272 Ga0395905_0138016 3300037471 Bacteria 2294
273 Ga0395905_0141473 3300037471 Bacteria 2263
274 Ga0395905_0156235 3300037471 Bacteria 2145
275 Ga0395905_0199245 3300037471 Bacteria 1877
276 Ga0395905_0429944 3300037471 Bacteria 1217
277 Ga0395905_0524041 3300037471 Bacteria 1085
278 Ga0395905_0797198 3300037471 Unclassified 847
279 Ga0395905_0876681 3300037471 Bacteria 800
280 Ga0395905_1102049 3300037471 Bacteria 697
281 Ga0395905_1362076 3300037471 Bacteria 613
282 Ga0395901_0002015 3300038443 Bacteria 20901
283 Ga0395901_0018652 3300038443 Bacteria 7085
284 Ga0395901_0022721 3300038443 Bacteria 6431
285 Ga0395901_0030962 3300038443 Bacteria 5515
286 Ga0395901_0067544 3300038443 Bacteria 3723
287 Ga0395901_0179503 3300038443 Bacteria 2220
288 Ga0395901_0203944 3300038443 Bacteria 2072
289 Ga0395901_0251401 3300038443 Bacteria 1841
290 Ga0395901_0273243 3300038443 Bacteria 1757
291 Ga0395901_0461677 3300038443 Bacteria 1297
292 Ga0395901_0632694 3300038443 Bacteria 1075
293 Ga0395901_0809065 3300038443 Unclassified 925
294 Ga0395901_1404422 3300038443 Bacteria 656
295 Ga0395901_1488558 3300038443 Bacteria 633
296 Ga0395901_1513857 3300038443 Bacteria 626
297 Ga0395901_1698934 3300038443 Bacteria 582
298 Ga0395901_1891070 3300038443 Bacteria 544
299 Ga0436363_0720075 3300039450 Bacteria 627
300 Ga0439455_0054834 3300042012 Bacteria 1047
301 Ga0450917_003577 3300042120 Bacteria 1127
302 Ga0450890_006239 3300042127 Bacteria 1527
303 Ga0450905_008121 3300042142 Bacteria 1434
304 Ga0450889_001528 3300042144 Bacteria 2376
305 Ga0439458_0000519 3300042157 Bacteria 9907
306 Ga0466972_0106076 3300044658 Bacteria 1329
307 Ga0466965_0093926 3300044683 Bacteria 1528
308 Ga0466966_0203268 3300044684 Bacteria 1198
309 Ga0466966_0277672 3300044684 Bacteria 1008
310 Ga0466966_0496841 3300044684 Bacteria 734
311 Ga0466961_0121355 3300044693 Bacteria 1641
312 Ga0466963_0061712 3300044694 Bacteria 2506
313 Ga0466963_0640164 3300044694 Bacteria 750
314 Ga0466964_0030420 3300044706 Bacteria 2137
315 Ga0466964_0174747 3300044706 Bacteria 1014
316 Ga0466971_0089085 3300044719 Bacteria 1412
317 Ga0466970_0020415 3300044765 Bacteria 3442
318 Ga0466970_0136026 3300044765 Bacteria 1352
319 Ga0466970_0543677 3300044765 Unclassified 671
320 Ga0466957_0067359 3300044842 Bacteria 2208
321 Ga0466959_0199803 3300045049 Bacteria 1392
322 Ga0466959_0417533 3300045049 Bacteria 911
323 Ga0466958_0008276 3300045836 Bacteria 5759
324 Ga0466958_0972354 3300045836 Bacteria 554
325 Ga0466967_0063083 3300045976 Bacteria 3291
326 Ga0466967_0114961 3300045976 Bacteria 2477
327 Ga0466967_0236669 3300045976 Bacteria 1740
328 Ga0466967_0326887 3300045976 Bacteria 1480
329 Ga0466967_0435943 3300045976 Bacteria 1279
330 Ga0466967_0783689 3300045976 Bacteria 946
331 Ga0466967_1689680 3300045976 Bacteria 630
332 Ga0466967_1885937 3300045976 Bacteria 594
333 Ga0466967_2061728 3300045976 Bacteria 567
334 Ga0495663_0403252 3300046525 Bacteria 503
335 Ga0501206_023781 3300049653 Bacteria 885
336 Ga0501258_062808 3300049687 Bacteria 539
337 Ga0501229_010622 3300049706 Bacteria 1165
338 Ga0501035_0201204 3300049822 Bacteria 1708
339 nmdc:mga0k408_630699_c1 3300050493 Bacteria 631
340 Ga0500643_041450 3300053087 Bacteria 1352
341 Ga0500568_0054812 3300053139 Bacteria 1558
342 Ga0466962_0130090 3300061719 Bacteria 1216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10083551 JGI24739J22299_100835512 112
2 3300001990 JGI24737J22298_10008374 JGI24737J22298_100083742 112
3 3300005339 Ga0070660_100284702 Ga0070660_1002847022 112
4 3300005366 Ga0070659_100002369 Ga0070659_10000236910 112
5 3300005539 Ga0068853_100351616 Ga0068853_1003516162 112
6 3300013307 Ga0157372_10593620 Ga0157372_105936202 112
7 3300025919 Ga0207657_10218877 Ga0207657_102188772 112
8 3300025932 Ga0207690_10001436 Ga0207690_1000143613 112
9 3300026041 Ga0207639_10732381 Ga0207639_107323812 112
10 3300005457 Ga0070662_101064246 Ga0070662_1010642462 113
11 3300025933 Ga0207706_10422642 Ga0207706_104226422 113
12 3300037312 Ga0395899_0427404 Ga0395899_0427404_243_650 113
13 3300037418 Ga0395900_0147829 Ga0395900_0147829_841_1248 113
14 3300037418 Ga0395900_1061232 Ga0395900_1061232_108_515 113
15 3300037466 Ga0395898_0530850 Ga0395898_0530850_344_751 113
16 3300037471 Ga0395905_0132468 Ga0395905_0132468_736_1143 113
17 3300037471 Ga0395905_0156235 Ga0395905_0156235_795_1202 113
18 3300037471 Ga0395905_0429944 Ga0395905_0429944_539_952 113
19 3300037471 Ga0395905_1102049 Ga0395905_1102049_40_447 113
20 3300038443 Ga0395901_0203944 Ga0395901_0203944_1202_1609 113
21 3300038443 Ga0395901_1488558 Ga0395901_1488558_16_423 113
22 3300042012 Ga0439455_0054834 Ga0439455_0054834_318_725 113
23 3300042157 Ga0439458_0000519 Ga0439458_0000519_9198_9605 113
24 3300050493 nmdc:mga0k408_630699_c1 nmdc:mga0k408_630699_c1_175_582 113
25 3300005339 Ga0070660_100129693 Ga0070660_1001296932 114
26 3300005347 Ga0070668_100596601 Ga0070668_1005966012 114
27 3300005366 Ga0070659_100200449 Ga0070659_1002004492 114
28 3300005444 Ga0070694_100024102 Ga0070694_1000241023 114
29 3300005539 Ga0068853_100123486 Ga0068853_1001234863 114
30 3300005545 Ga0070695_100076416 Ga0070695_1000764161 114
31 3300005546 Ga0070696_100024262 Ga0070696_1000242624 114
32 3300005547 Ga0070693_100024924 Ga0070693_1000249242 114
33 3300005563 Ga0068855_101936010 Ga0068855_1019360101 114
34 3300005578 Ga0068854_100107174 Ga0068854_1001071742 114
35 3300005617 Ga0068859_102495748 Ga0068859_1024957481 114
36 3300005618 Ga0068864_100002429 Ga0068864_10000242912 114
37 3300005719 Ga0068861_100586179 Ga0068861_1005861792 114
38 3300005842 Ga0068858_100000022 Ga0068858_10000002270 114
39 3300006931 Ga0097620_102495479 Ga0097620_1024954791 114
40 3300009553 Ga0105249_10229030 Ga0105249_102290302 114
41 3300013306 Ga0163162_10001764 Ga0163162_1000176418 114
42 3300014325 Ga0163163_10598783 Ga0163163_105987831 114
43 3300017792 Ga0163161_10705304 Ga0163161_107053042 114
44 3300025315 Ga0207697_10036370 Ga0207697_100363705 114
45 3300025919 Ga0207657_10149820 Ga0207657_101498202 114
46 3300025932 Ga0207690_10307519 Ga0207690_103075192 114
47 3300025961 Ga0207712_10222610 Ga0207712_102226102 114
48 3300025981 Ga0207640_10041338 Ga0207640_100413383 114
49 3300026035 Ga0207703_10000048 Ga0207703_10000048140 114
50 3300026041 Ga0207639_10365157 Ga0207639_103651572 114
51 3300026095 Ga0207676_10000147 Ga0207676_1000014714 114
52 3300026118 Ga0207675_100562514 Ga0207675_1005625142 114
53 3300037471 Ga0395905_0003161 Ga0395905_0003161_15117_15524 114
54 3300038443 Ga0395901_0273243 Ga0395901_0273243_849_1256 114
55 3300042120 Ga0450917_003577 Ga0450917_003577_280_678 114
56 3300042127 Ga0450890_006239 Ga0450890_006239_14_412 114
57 3300042142 Ga0450905_008121 Ga0450905_008121_907_1305 114
58 3300042144 Ga0450889_001528 Ga0450889_001528_337_735 114
59 3300005333 Ga0070677_10004554 Ga0070677_100045544 115
60 3300005356 Ga0070674_100191125 Ga0070674_1001911252 115
61 3300005457 Ga0070662_100117270 Ga0070662_1001172702 115
62 3300005543 Ga0070672_100252266 Ga0070672_1002522662 115
63 3300025903 Ga0207680_10149173 Ga0207680_101491731 115
64 3300025933 Ga0207706_10235289 Ga0207706_102352892 115
65 3300025937 Ga0207669_10677706 Ga0207669_106777062 115
66 3300025940 Ga0207691_10135883 Ga0207691_101358833 115
67 3300032002 Ga0307416_102457418 Ga0307416_1024574181 115
68 3300049822 Ga0501035_0201204 Ga0501035_0201204_835_1236 116
69 3300053139 Ga0500568_0054812 Ga0500568_0054812_1036_1437 116
70 3300009551 Ga0105238_12430006 Ga0105238_124300061 117
71 3300013104 Ga0157370_10229110 Ga0157370_102291102 117
72 3300026142 Ga0207698_11515271 Ga0207698_115152712 117
73 3300037312 Ga0395899_0711790 Ga0395899_0711790_188_592 117
74 3300044683 Ga0466965_0093926 Ga0466965_0093926_899_1303 117
75 3300045976 Ga0466967_1689680 Ga0466967_1689680_32_439 117
76 3300020082 Ga0206353_11225564 Ga0206353_112255642 118
77 3300025909 Ga0207705_10155294 Ga0207705_101552942 118
78 3300025919 Ga0207657_10038591 Ga0207657_100385914 118
79 3300025919 Ga0207657_10349106 Ga0207657_103491062 118
80 3300025929 Ga0207664_11922338 Ga0207664_119223381 118
81 3300025932 Ga0207690_10645998 Ga0207690_106459982 118
82 3300025944 Ga0207661_10853743 Ga0207661_108537432 118
83 3300025945 Ga0207679_11156541 Ga0207679_111565412 118
84 3300025949 Ga0207667_10210713 Ga0207667_102107132 118
85 3300026067 Ga0207678_10051658 Ga0207678_100516584 118
86 3300026078 Ga0207702_10771493 Ga0207702_107714931 118
87 3300026116 Ga0207674_10978376 Ga0207674_109783762 118
88 3300026142 Ga0207698_10082938 Ga0207698_100829381 118
89 3300037312 Ga0395899_0189080 Ga0395899_0189080_257_661 118
90 3300037418 Ga0395900_0106698 Ga0395900_0106698_1812_2216 118
91 3300037466 Ga0395898_0106503 Ga0395898_0106503_944_1348 118
92 3300037466 Ga0395898_0439706 Ga0395898_0439706_323_727 118
93 3300037471 Ga0395905_0046250 Ga0395905_0046250_3608_4012 118
94 3300038443 Ga0395901_0022721 Ga0395901_0022721_2022_2426 118
95 3300038443 Ga0395901_0461677 Ga0395901_0461677_833_1237 118
96 3300038443 Ga0395901_1404422 Ga0395901_1404422_59_463 118
97 3300044706 Ga0466964_0174747 Ga0466964_0174747_391_795 118
98 3300045976 Ga0466967_0326887 Ga0466967_0326887_300_704 118
99 3300005331 Ga0070670_101059219 Ga0070670_1010592192 119
100 3300035170 Ga0373943_0336747 Ga0373943_0336747_386_790 119
101 3300035692 Ga0373935_0001587 Ga0373935_0001587_3656_4060 119
102 3300044684 Ga0466966_0277672 Ga0466966_0277672_305_709 119
103 3300044765 Ga0466970_0136026 Ga0466970_0136026_309_713 119
104 3300045049 Ga0466959_0417533 Ga0466959_0417533_396_800 119
105 3300005436 Ga0070713_100435690 Ga0070713_1004356902 120
106 3300025904 Ga0207647_10609826 Ga0207647_106098262 120
107 3300025928 Ga0207700_10283397 Ga0207700_102833972 120
108 3300037418 Ga0395900_0064523 Ga0395900_0064523_974_1378 120
109 3300044684 Ga0466966_0203268 Ga0466966_0203268_484_888 120
110 3300045976 Ga0466967_0435943 Ga0466967_0435943_621_1028 120
111 3300005616 Ga0068852_100197393 Ga0068852_1001973931 122
112 3300031548 Ga0307408_100383075 Ga0307408_1003830752 122
113 3300031731 Ga0307405_10008576 Ga0307405_100085763 122
114 3300031824 Ga0307413_10221079 Ga0307413_102210792 122
115 3300031852 Ga0307410_10052225 Ga0307410_100522253 122
116 3300031901 Ga0307406_10052478 Ga0307406_100524783 122
117 3300031903 Ga0307407_10102232 Ga0307407_101022322 122
118 3300031911 Ga0307412_10010538 Ga0307412_100105384 122
119 3300031995 Ga0307409_100168748 Ga0307409_1001687482 122
120 3300032002 Ga0307416_100004402 Ga0307416_1000044022 122
121 3300032004 Ga0307414_10538830 Ga0307414_105388302 122
122 3300032126 Ga0307415_100063012 Ga0307415_1000630123 122
123 3300044765 Ga0466970_0543677 Ga0466970_0543677_229_633 122
124 3300049653 Ga0501206_023781 Ga0501206_023781_253_663 122
125 3300049687 Ga0501258_062808 Ga0501258_062808_80_490 122
126 3300049706 Ga0501229_010622 Ga0501229_010622_215_625 122
127 3300005435 Ga0070714_100087684 Ga0070714_1000876844 123
128 3300025928 Ga0207700_10053304 Ga0207700_100533044 123
129 3300025929 Ga0207664_10030390 Ga0207664_100303902 123
130 3300039450 Ga0436363_0720075 Ga0436363_0720075_171_584 124
131 3300037418 Ga0395900_0917489 Ga0395900_0917489_145_546 125
132 3300031995 Ga0307409_100002876 Ga0307409_1000028768 126
133 3300037418 Ga0395900_0003562 Ga0395900_0003562_135_542 127
134 3300037466 Ga0395898_0410766 Ga0395898_0410766_676_1083 127
135 3300037471 Ga0395905_0007786 Ga0395905_0007786_3339_3746 127
136 3300038443 Ga0395901_0067544 Ga0395901_0067544_21_428 127
137 3300038443 Ga0395901_0251401 Ga0395901_0251401_762_1169 127
138 3300021320 Ga0214544_1005350 Ga0214544_100535027 129
139 3300026142 Ga0207698_10443031 Ga0207698_104430312 129
140 3300037312 Ga0395899_0747110 Ga0395899_0747110_24_428 129
141 3300053087 Ga0500643_041450 Ga0500643_041450_877_1278 130
142 3300002067 JGI24735J21928_10001836 JGI24735J21928_100018364 131
143 3300005327 Ga0070658_10038227 Ga0070658_100382273 131
144 3300005578 Ga0068854_100384424 Ga0068854_1003844242 131
145 3300014497 Ga0182008_10032946 Ga0182008_100329462 131
146 3300020069 Ga0197907_10176170 Ga0197907_101761702 131
147 3300025909 Ga0207705_10037717 Ga0207705_100377174 131
148 3300025925 Ga0207650_10462889 Ga0207650_104628892 131
149 3300025981 Ga0207640_10704332 Ga0207640_107043321 131
150 3300026041 Ga0207639_10506160 Ga0207639_105061603 131
151 3300031852 Ga0307410_10004260 Ga0307410_100042605 131
152 3300031903 Ga0307407_10945223 Ga0307407_109452232 131
153 3300031911 Ga0307412_10906720 Ga0307412_109067202 131
154 3300031995 Ga0307409_100634629 Ga0307409_1006346292 131
155 3300032005 Ga0307411_10004420 Ga0307411_100044203 131
156 3300032126 Ga0307415_100005329 Ga0307415_1000053294 131
157 3300037471 Ga0395905_0141473 Ga0395905_0141473_719_1228 131
158 3300046525 Ga0495663_0403252 Ga0495663_0403252_78_488 131
159 3300005327 Ga0070658_10738306 Ga0070658_107383062 133
160 3300005344 Ga0070661_100979326 Ga0070661_1009793262 133
161 3300005564 Ga0070664_100293071 Ga0070664_1002930712 133
162 3300001915 JGI24741J21665_1004643 JGI24741J21665_10046432 134
163 3300001915 JGI24741J21665_1012194 JGI24741J21665_10121942 134
164 3300001979 JGI24740J21852_10014474 JGI24740J21852_100144742 134
165 3300001989 JGI24739J22299_10014021 JGI24739J22299_100140212 134
166 3300001989 JGI24739J22299_10064169 JGI24739J22299_100641692 134
167 3300001990 JGI24737J22298_10011280 JGI24737J22298_100112802 134
168 3300002067 JGI24735J21928_10010105 JGI24735J21928_100101053 134
169 3300002067 JGI24735J21928_10049053 JGI24735J21928_100490532 134
170 3300002067 JGI24735J21928_10081897 JGI24735J21928_100818972 134
171 3300004800 Ga0058861_11546344 Ga0058861_115463441 134
172 3300005327 Ga0070658_10169415 Ga0070658_101694152 134
173 3300005327 Ga0070658_10383686 Ga0070658_103836862 134
174 3300005327 Ga0070658_11364006 Ga0070658_113640061 134
175 3300005329 Ga0070683_100069424 Ga0070683_1000694242 134
176 3300005329 Ga0070683_100273525 Ga0070683_1002735252 134
177 3300005333 Ga0070677_10178659 Ga0070677_101786592 134
178 3300005336 Ga0070680_100066334 Ga0070680_1000663343 134
179 3300005337 Ga0070682_100009673 Ga0070682_1000096734 134
180 3300005337 Ga0070682_100765169 Ga0070682_1007651691 134
181 3300005337 Ga0070682_101596843 Ga0070682_1015968431 134
182 3300005339 Ga0070660_100077229 Ga0070660_1000772292 134
183 3300005339 Ga0070660_101226225 Ga0070660_1012262252 134
184 3300005344 Ga0070661_100028580 Ga0070661_1000285803 134
185 3300005344 Ga0070661_100439048 Ga0070661_1004390482 134
186 3300005345 Ga0070692_10016602 Ga0070692_100166023 134
187 3300005366 Ga0070659_100037622 Ga0070659_1000376226 134
188 3300005366 Ga0070659_100154980 Ga0070659_1001549801 134
189 3300005366 Ga0070659_100904391 Ga0070659_1009043912 134
190 3300005367 Ga0070667_100861306 Ga0070667_1008613062 134
191 3300005455 Ga0070663_100014759 Ga0070663_1000147595 134
192 3300005455 Ga0070663_100659612 Ga0070663_1006596122 134
193 3300005457 Ga0070662_100377351 Ga0070662_1003773511 134
194 3300005457 Ga0070662_100937158 Ga0070662_1009371582 134
195 3300005458 Ga0070681_10128909 Ga0070681_101289093 134
196 3300005530 Ga0070679_100079458 Ga0070679_1000794583 134
197 3300005530 Ga0070679_100121057 Ga0070679_1001210573 134
198 3300005530 Ga0070679_101150718 Ga0070679_1011507182 134
199 3300005535 Ga0070684_100451997 Ga0070684_1004519972 134
200 3300005535 Ga0070684_100599870 Ga0070684_1005998702 134
201 3300005535 Ga0070684_100732810 Ga0070684_1007328101 134
202 3300005539 Ga0068853_100105844 Ga0068853_1001058442 134
203 3300005539 Ga0068853_100902477 Ga0068853_1009024772 134
204 3300005547 Ga0070693_100033041 Ga0070693_1000330412 134
205 3300005548 Ga0070665_100118831 Ga0070665_1001188312 134
206 3300005563 Ga0068855_100099454 Ga0068855_1000994543 134
207 3300005563 Ga0068855_100121684 Ga0068855_1001216842 134
208 3300005563 Ga0068855_100212294 Ga0068855_1002122944 134
209 3300005563 Ga0068855_101566354 Ga0068855_1015663541 134
210 3300005563 Ga0068855_102077543 Ga0068855_1020775431 134
211 3300005564 Ga0070664_100064408 Ga0070664_1000644083 134
212 3300005564 Ga0070664_100068443 Ga0070664_1000684432 134
213 3300005564 Ga0070664_100611923 Ga0070664_1006119232 134
214 3300005577 Ga0068857_100120545 Ga0068857_1001205453 134
215 3300005578 Ga0068854_100091910 Ga0068854_1000919102 134
216 3300005578 Ga0068854_100126590 Ga0068854_1001265903 134
217 3300005578 Ga0068854_100865224 Ga0068854_1008652242 134
218 3300005578 Ga0068854_101988276 Ga0068854_1019882761 134
219 3300005614 Ga0068856_100160593 Ga0068856_1001605932 134
220 3300005614 Ga0068856_100309374 Ga0068856_1003093742 134
221 3300005616 Ga0068852_100138266 Ga0068852_1001382662 134
222 3300005616 Ga0068852_100655259 Ga0068852_1006552592 134
223 3300005616 Ga0068852_100839820 Ga0068852_1008398202 134
224 3300005834 Ga0068851_10019298 Ga0068851_100192984 134
225 3300005841 Ga0068863_100808491 Ga0068863_1008084912 134
226 3300009093 Ga0105240_12264117 Ga0105240_122641171 134
227 3300009174 Ga0105241_10343744 Ga0105241_103437442 134
228 3300009545 Ga0105237_10294126 Ga0105237_102941261 134
229 3300010375 Ga0105239_10965439 Ga0105239_109654392 134
230 3300010375 Ga0105239_11742038 Ga0105239_117420381 134
231 3300013100 Ga0157373_10058176 Ga0157373_100581762 134
232 3300013100 Ga0157373_10134035 Ga0157373_101340352 134
233 3300013100 Ga0157373_10826875 Ga0157373_108268752 134
234 3300013100 Ga0157373_10970660 Ga0157373_109706602 134
235 3300013102 Ga0157371_10155582 Ga0157371_101555822 134
236 3300013102 Ga0157371_10198871 Ga0157371_101988712 134
237 3300013102 Ga0157371_10304167 Ga0157371_103041672 134
238 3300013104 Ga0157370_10075533 Ga0157370_100755335 134
239 3300013104 Ga0157370_10343345 Ga0157370_103433451 134
240 3300013104 Ga0157370_10930000 Ga0157370_109300002 134
241 3300013104 Ga0157370_11367562 Ga0157370_113675622 134
242 3300013105 Ga0157369_10158745 Ga0157369_101587451 134
243 3300013105 Ga0157369_10232983 Ga0157369_102329833 134
244 3300013105 Ga0157369_10403765 Ga0157369_104037652 134
245 3300013296 Ga0157374_11528025 Ga0157374_115280251 134
246 3300013307 Ga0157372_10110039 Ga0157372_101100393 134
247 3300013307 Ga0157372_10491105 Ga0157372_104911051 134
248 3300013307 Ga0157372_10913363 Ga0157372_109133632 134
249 3300013307 Ga0157372_11520360 Ga0157372_115203601 134
250 3300025321 Ga0207656_10019714 Ga0207656_100197142 134
251 3300025893 Ga0207682_10302490 Ga0207682_103024901 134
252 3300025904 Ga0207647_10078338 Ga0207647_100783382 134
253 3300025904 Ga0207647_10515325 Ga0207647_105153252 134
254 3300025909 Ga0207705_10044303 Ga0207705_100443032 134
255 3300025909 Ga0207705_10163676 Ga0207705_101636762 134
256 3300025909 Ga0207705_11270093 Ga0207705_112700931 134
257 3300025912 Ga0207707_10037790 Ga0207707_100377903 134
258 3300025913 Ga0207695_11283372 Ga0207695_112833722 134
259 3300025917 Ga0207660_10174869 Ga0207660_101748692 134
260 3300025917 Ga0207660_11039002 Ga0207660_110390022 134
261 3300025919 Ga0207657_10009468 Ga0207657_100094687 134
262 3300025919 Ga0207657_10059194 Ga0207657_100591941 134
263 3300025919 Ga0207657_10244585 Ga0207657_102445853 134
264 3300025920 Ga0207649_10023939 Ga0207649_100239392 134
265 3300025920 Ga0207649_10269937 Ga0207649_102699372 134
266 3300025921 Ga0207652_10096961 Ga0207652_100969613 134
267 3300025921 Ga0207652_10124072 Ga0207652_101240721 134
268 3300025929 Ga0207664_10052766 Ga0207664_100527662 134
269 3300025932 Ga0207690_10011810 Ga0207690_100118105 134
270 3300025932 Ga0207690_10237637 Ga0207690_102376372 134
271 3300025933 Ga0207706_10007350 Ga0207706_100073508 134
272 3300025944 Ga0207661_10056192 Ga0207661_100561923 134
273 3300025944 Ga0207661_10400442 Ga0207661_104004422 134
274 3300025945 Ga0207679_10036705 Ga0207679_100367053 134
275 3300025945 Ga0207679_10889674 Ga0207679_108896741 134
276 3300025949 Ga0207667_10138370 Ga0207667_101383703 134
277 3300025949 Ga0207667_10284017 Ga0207667_102840173 134
278 3300025949 Ga0207667_10345726 Ga0207667_103457262 134
279 3300025981 Ga0207640_10153537 Ga0207640_101535372 134
280 3300025986 Ga0207658_11636810 Ga0207658_116368101 134
281 3300026023 Ga0207677_10734439 Ga0207677_107344391 134
282 3300026041 Ga0207639_10201502 Ga0207639_102015022 134
283 3300026067 Ga0207678_10011830 Ga0207678_100118303 134
284 3300026067 Ga0207678_10093085 Ga0207678_100930853 134
285 3300026078 Ga0207702_10597870 Ga0207702_105978702 134
286 3300026116 Ga0207674_10017810 Ga0207674_100178104 134
287 3300026116 Ga0207674_10039756 Ga0207674_100397563 134
288 3300026142 Ga0207698_10032261 Ga0207698_100322611 134
289 3300026142 Ga0207698_10382357 Ga0207698_103823572 134
290 3300028379 Ga0268266_10377193 Ga0268266_103771932 134
291 3300035121 Ga0373960_0077709 Ga0373960_0077709_62_466 134
292 3300037312 Ga0395899_0002312 Ga0395899_0002312_11682_12086 134
293 3300037312 Ga0395899_0245186 Ga0395899_0245186_57_461 134
294 3300037312 Ga0395899_0299444 Ga0395899_0299444_630_1040 134
295 3300037418 Ga0395900_0004612 Ga0395900_0004612_6013_6417 134
296 3300037418 Ga0395900_0075050 Ga0395900_0075050_1562_1972 134
297 3300037418 Ga0395900_0090839 Ga0395900_0090839_1651_2055 134
298 3300037418 Ga0395900_0466675 Ga0395900_0466675_636_1040 134
299 3300037418 Ga0395900_1932829 Ga0395900_1932829_27_446 134
300 3300037466 Ga0395898_0001747 Ga0395898_0001747_6160_6564 134
301 3300037466 Ga0395898_0126026 Ga0395898_0126026_2001_2420 134
302 3300037466 Ga0395898_0144937 Ga0395898_0144937_1813_2217 134
303 3300037466 Ga0395898_0982403 Ga0395898_0982403_206_625 134
304 3300037471 Ga0395905_0002321 Ga0395905_0002321_2998_3408 134
305 3300037471 Ga0395905_0013402 Ga0395905_0013402_2275_2679 134
306 3300037471 Ga0395905_0025874 Ga0395905_0025874_5078_5488 134
307 3300037471 Ga0395905_0028761 Ga0395905_0028761_2981_3391 134
308 3300037471 Ga0395905_0044581 Ga0395905_0044581_1125_1541 134
309 3300037471 Ga0395905_0138016 Ga0395905_0138016_158_562 134
310 3300037471 Ga0395905_0199245 Ga0395905_0199245_1233_1649 134
311 3300037471 Ga0395905_0524041 Ga0395905_0524041_520_924 134
312 3300037471 Ga0395905_0797198 Ga0395905_0797198_196_615 134
313 3300037471 Ga0395905_0876681 Ga0395905_0876681_52_471 134
314 3300037471 Ga0395905_1362076 Ga0395905_1362076_192_596 134
315 3300038443 Ga0395901_0002015 Ga0395901_0002015_6869_7279 134
316 3300038443 Ga0395901_0018652 Ga0395901_0018652_1893_2297 134
317 3300038443 Ga0395901_0030962 Ga0395901_0030962_5063_5473 134
318 3300038443 Ga0395901_0179503 Ga0395901_0179503_1760_2164 134
319 3300038443 Ga0395901_0632694 Ga0395901_0632694_178_582 134
320 3300038443 Ga0395901_0809065 Ga0395901_0809065_40_459 134
321 3300038443 Ga0395901_1513857 Ga0395901_1513857_57_461 134
322 3300038443 Ga0395901_1698934 Ga0395901_1698934_124_543 134
323 3300038443 Ga0395901_1891070 Ga0395901_1891070_73_492 134
324 3300044658 Ga0466972_0106076 Ga0466972_0106076_443_847 134
325 3300044684 Ga0466966_0496841 Ga0466966_0496841_121_525 134
326 3300044693 Ga0466961_0121355 Ga0466961_0121355_467_871 134
327 3300044694 Ga0466963_0061712 Ga0466963_0061712_204_611 134
328 3300044694 Ga0466963_0640164 Ga0466963_0640164_140_547 134
329 3300044706 Ga0466964_0030420 Ga0466964_0030420_785_1189 134
330 3300044719 Ga0466971_0089085 Ga0466971_0089085_898_1302 134
331 3300044765 Ga0466970_0020415 Ga0466970_0020415_897_1301 134
332 3300044842 Ga0466957_0067359 Ga0466957_0067359_426_833 134
333 3300045049 Ga0466959_0199803 Ga0466959_0199803_329_733 134
334 3300045836 Ga0466958_0008276 Ga0466958_0008276_3544_3951 134
335 3300045836 Ga0466958_0972354 Ga0466958_0972354_104_511 134
336 3300045976 Ga0466967_0063083 Ga0466967_0063083_1567_1974 134
337 3300045976 Ga0466967_0114961 Ga0466967_0114961_494_898 134
338 3300045976 Ga0466967_0236669 Ga0466967_0236669_1271_1678 134
339 3300045976 Ga0466967_0783689 Ga0466967_0783689_172_576 134
340 3300045976 Ga0466967_1885937 Ga0466967_1885937_63_467 134
341 3300045976 Ga0466967_2061728 Ga0466967_2061728_91_498 134
342 3300061719 Ga0466962_0130090 Ga0466962_0130090_559_966 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

13

89

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zsz-assembly1.cif.gz_A structure of a fusion protein with a helix linker, 2arh-3-3kaw-3.0 0.5574 7 112
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.5445 11 114
5fig-assembly2.cif.gz_F-2 apo-csp3 (copper storage protein 3) from bacillus subtilis 0.5337 18 114
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.5164 11 114
5fig-assembly2.cif.gz_F-2 apo-csp3 (copper storage protein 3) from bacillus subtilis 0.4975 18 114
ID Description Score Start End Superfamily
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7124 17 110 1.20.120.550
af_Q2FWC2_1_116_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6578 15 112 1.20.120.550
af_Q54UK5_2_117_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.617 13 113 1.20.120.550
af_Q96MX0_36_149_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6102 13 115 1.20.140.150
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6073 16 116 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A4V2V8C9-F1-model_v4 deleted 0.9881 7 130
AF-A0A4Q3LDT2-F1-model_v4 deleted 0.9866 9 131
AF-A0A418SNR4-F1-model_v4 DoxX family protein 0.9858 6 125 GO:0005886
AF-A0A318SZY6-F1-model_v4 Putative oxidoreductase 0.9824 6 130 GO:0005886
AF-A0A7Y6V3W6-F1-model_v4 deleted 0.9797 3 130

Feature Viewer

pLDDT pTM Quality
93.67 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map