F415087

General Info

Members Datasets Scaffolds Average Seq Length
342 207 684 105

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101779192|Ga0070664_1017791922
Length 114
Sequence MTGADKWTRVAATREVEEGEVIGRGVGGRDLAICRVLGTVYATDNICTHARARLSDGAFIDGYELECPLHGGKFDVRTGKGLCEPINQDLRTYPVRIVGDEVQVFLGGEVGGSN

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
97 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
130 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
131 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
134 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
177 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
178 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
179 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
197 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
198 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
199 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
204 2643221609 Acidovorax sp. Root217 Isolate Unclassified
205 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
206 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
207 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 0
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.39
Nodule 0
Rhizoplane 2.05
Rhizosphere 59.94
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_101779192 3300005564 Unclassified 584
2 rootH1_10019512 3300003316 Bacteria 4497
3 rootL2_10161818 3300003322 Bacteria 1726
4 Ga0070658_10002804 3300005327 Bacteria 14479
5 Ga0070676_10016341 3300005328 Bacteria 4102
6 Ga0070683_101460056 3300005329 Unclassified 657
7 Ga0068869_100118296 3300005334 Bacteria 2023
8 Ga0068869_100322628 3300005334 Bacteria 1253
9 Ga0070666_10906978 3300005335 Bacteria 652
10 Ga0070675_100224640 3300005354 Bacteria 1636
11 Ga0070675_102141363 3300005354 Unclassified 515
12 Ga0070671_100034118 3300005355 Bacteria 4212
13 Ga0070671_100127377 3300005355 Bacteria 2144
14 Ga0070673_100086947 3300005364 Bacteria 2547
15 Ga0070688_101546747 3300005365 Bacteria 541
16 Ga0070667_100064974 3300005367 Bacteria 3097
17 Ga0070667_102231629 3300005367 Bacteria 516
18 Ga0070708_101231187 3300005445 Bacteria 700
19 Ga0070678_100283583 3300005456 Bacteria 1402
20 Ga0070678_101409203 3300005456 Bacteria 651
21 Ga0070685_10120501 3300005466 Bacteria 1629
22 Ga0070672_100010739 3300005543 Bacteria 6363
23 Ga0070665_100278353 3300005548 Bacteria 1675
24 Ga0070665_100668795 3300005548 Bacteria 1051
25 Ga0068855_100136672 3300005563 Bacteria 2796
26 Ga0068857_100162697 3300005577 Bacteria 2025
27 Ga0068854_100356131 3300005578 Bacteria 1199
28 Ga0068852_100913899 3300005616 Bacteria 895
29 Ga0068859_100306399 3300005617 Bacteria 1682
30 Ga0068864_100014664 3300005618 Bacteria 6508
31 Ga0068870_10115031 3300005840 Bacteria 1541
32 Ga0068860_100372691 3300005843 Bacteria 1408
33 Ga0068860_101446200 3300005843 Bacteria 709
34 Ga0081455_10052821 3300005937 Bacteria 3476
35 Ga0075365_10025577 3300006038 Bacteria 3738
36 Ga0075368_10099559 3300006042 Bacteria 1193
37 Ga0075368_10209250 3300006042 Bacteria 827
38 Ga0075363_100024058 3300006048 Bacteria 3093
39 Ga0075363_100098285 3300006048 Bacteria 1618
40 Ga0075364_10032521 3300006051 Bacteria 3354
41 Ga0075362_10012721 3300006177 Bacteria 3349
42 Ga0075362_10027795 3300006177 Bacteria 2424
43 Ga0075362_10061757 3300006177 Bacteria 1696
44 Ga0075362_10075832 3300006177 Bacteria 1543
45 Ga0075362_10078719 3300006177 Bacteria 1517
46 Ga0075367_10003489 3300006178 Bacteria 7504
47 Ga0075367_10061035 3300006178 Bacteria 2249
48 Ga0075369_10337016 3300006186 Bacteria 707
49 Ga0075369_10401783 3300006186 Bacteria 646
50 Ga0075366_10004367 3300006195 Bacteria 7582
51 Ga0075366_10005063 3300006195 Bacteria 7126
52 Ga0075366_10062816 3300006195 Bacteria 2207
53 Ga0075366_10103288 3300006195 Bacteria 1711
54 Ga0075366_10108492 3300006195 Bacteria 1669
55 Ga0075366_10151140 3300006195 Bacteria 1406
56 Ga0075366_10184553 3300006195 Bacteria 1267
57 Ga0075366_10310856 3300006195 Bacteria 965
58 Ga0075366_10327738 3300006195 Bacteria 938
59 Ga0075366_10425962 3300006195 Bacteria 818
60 Ga0075366_10705571 3300006195 Bacteria 626
61 Ga0097621_100321941 3300006237 Bacteria 1370
62 Ga0097621_100455426 3300006237 Bacteria 1153
63 Ga0075370_10011977 3300006353 Bacteria 4570
64 Ga0075370_10025251 3300006353 Bacteria 3285
65 Ga0075370_10067824 3300006353 Bacteria 2037
66 Ga0075370_10079534 3300006353 Bacteria 1883
67 Ga0075370_10178901 3300006353 Bacteria 1248
68 Ga0075370_10221285 3300006353 Bacteria 1119
69 Ga0075370_10415758 3300006353 Bacteria 808
70 Ga0075434_100139155 3300006871 Bacteria 2447
71 Ga0068865_100211493 3300006881 Bacteria 1512
72 Ga0097620_100306401 3300006931 Bacteria 1682
73 Ga0105240_10873097 3300009093 Bacteria 969
74 Ga0105245_10011498 3300009098 Bacteria 7709
75 Ga0105245_10147538 3300009098 Bacteria 2220
76 Ga0105241_11626778 3300009174 Bacteria 625
77 Ga0105248_11070018 3300009177 Bacteria 911
78 Ga0105237_10123442 3300009545 Bacteria 2584
79 Ga0105237_10210367 3300009545 Bacteria 1945
80 Ga0105237_10211438 3300009545 Bacteria 1940
81 Ga0105238_10648551 3300009551 Bacteria 1066
82 Ga0105246_10116212 3300011119 Bacteria 1974
83 Ga0105246_11085690 3300011119 Bacteria 730
84 Ga0157370_10018176 3300013104 Bacteria 7076
85 Ga0157374_10237908 3300013296 Bacteria 1790
86 Ga0157378_10382884 3300013297 Bacteria 1382
87 Ga0157372_11839303 3300013307 Bacteria 696
88 Ga0157375_10277498 3300013308 Bacteria 1839
89 Ga0157375_10448228 3300013308 Bacteria 1456
90 Ga0163163_10574875 3300014325 Bacteria 1190
91 Ga0157379_10344909 3300014968 Bacteria 1363
92 Ga0157379_10679915 3300014968 Bacteria 965
93 Ga0157379_11623683 3300014968 Bacteria 632
94 Ga0157376_11158350 3300014969 Bacteria 800
95 Ga0209646_1000023 3300025246 Bacteria 441100
96 Ga0209026_1013794 3300025250 Bacteria 1365
97 Ga0207688_11011810 3300025901 Bacteria 525
98 Ga0207680_11026067 3300025903 Bacteria 590
99 Ga0207645_10004614 3300025907 Bacteria 10153
100 Ga0207645_10013156 3300025907 Bacteria 5586
101 Ga0207643_10009830 3300025908 Bacteria 5138
102 Ga0207705_10002003 3300025909 Bacteria 15840
103 Ga0207654_10646166 3300025911 Bacteria 757
104 Ga0207695_11035450 3300025913 Bacteria 700
105 Ga0207671_10100261 3300025914 Bacteria 2192
106 Ga0207649_10527986 3300025920 Bacteria 901
107 Ga0207694_10757298 3300025924 Bacteria 820
108 Ga0207659_11033483 3300025926 Bacteria 707
109 Ga0207687_10056676 3300025927 Bacteria 2749
110 Ga0207687_10078852 3300025927 Bacteria 2372
111 Ga0207687_10211834 3300025927 Bacteria 1521
112 Ga0207687_10392238 3300025927 Bacteria 1140
113 Ga0207644_10065196 3300025931 Bacteria 2648
114 Ga0207644_10070563 3300025931 Bacteria 2554
115 Ga0207644_10382331 3300025931 Bacteria 1148
116 Ga0207686_10769056 3300025934 Bacteria 770
117 Ga0207704_10382054 3300025938 Bacteria 1106
118 Ga0207691_10153924 3300025940 Bacteria 2020
119 Ga0207691_11425814 3300025940 Bacteria 568
120 Ga0207689_10120756 3300025942 Bacteria 2156
121 Ga0207689_10180386 3300025942 Bacteria 1741
122 Ga0207689_10269083 3300025942 Bacteria 1411
123 Ga0207689_10923446 3300025942 Bacteria 736
124 Ga0207667_10004476 3300025949 Bacteria 17111
125 Ga0207651_10128082 3300025960 Bacteria 1938
126 Ga0207651_11743862 3300025960 Bacteria 561
127 Ga0207640_10286300 3300025981 Bacteria 1297
128 Ga0207640_10427674 3300025981 Bacteria 1085
129 Ga0207640_11697448 3300025981 Bacteria 570
130 Ga0207658_10017295 3300025986 Bacteria 4967
131 Ga0207658_10772969 3300025986 Bacteria 871
132 Ga0207658_12164338 3300025986 Bacteria 505
133 Ga0207677_10117791 3300026023 Bacteria 1991
134 Ga0207677_10426178 3300026023 Bacteria 1131
135 Ga0207677_12093283 3300026023 Bacteria 526
136 Ga0207703_11550812 3300026035 Bacteria 637
137 Ga0207678_10742731 3300026067 Bacteria 865
138 Ga0207648_10017873 3300026089 Bacteria 6435
139 Ga0207648_10019036 3300026089 Bacteria 6200
140 Ga0207676_10194516 3300026095 Bacteria 1787
141 Ga0207674_10219577 3300026116 Bacteria 1849
142 Ga0207674_10604400 3300026116 Bacteria 1059
143 Ga0207683_10237209 3300026121 Bacteria 1663
144 Ga0209996_1001867 3300027395 Bacteria 2584
145 Ga0209968_1000702 3300027526 Bacteria 5159
146 Ga0209966_1000040 3300027695 Bacteria 54404
147 Ga0209813_10116668 3300027866 Bacteria 925
148 Ga0209974_10006173 3300027876 Bacteria 4198
149 Ga0268266_10010170 3300028379 Bacteria 8244
150 Ga0268266_10455050 3300028379 Bacteria 1217
151 Ga0268265_10087552 3300028380 Bacteria 2478
152 Ga0268264_10180300 3300028381 Bacteria 1917
153 Ga0268264_10275052 3300028381 Bacteria 1575
154 Ga0268264_11259302 3300028381 Bacteria 750
155 Ga0307517_10000160 3300028786 Bacteria 108370
156 Ga0307517_10000395 3300028786 Bacteria 74663
157 Ga0307517_10589362 3300028786 Bacteria 549
158 Ga0307515_10000006 3300028794 Bacteria 725810
159 Ga0307515_10000332 3300028794 Bacteria 116126
160 Ga0307515_10060601 3300028794 Bacteria 5392
161 Ga0307515_10206740 3300028794 Bacteria 1820
162 Ga0307511_10013142 3300030521 Bacteria 8095
163 Ga0307512_10041345 3300030522 Bacteria 3833
164 Ga0307512_10130900 3300030522 Bacteria 1574
165 Ga0307512_10139063 3300030522 Bacteria 1492
166 Ga0307513_10020560 3300031456 Bacteria 7826
167 Ga0307513_10801884 3300031456 Bacteria 647
168 Ga0307509_10000212 3300031507 Bacteria 92922
169 Ga0307509_10001515 3300031507 Bacteria 39177
170 Ga0307509_10161551 3300031507 Bacteria 2136
171 Ga0307509_10250752 3300031507 Bacteria 1554
172 Ga0307509_10330913 3300031507 Bacteria 1255
173 Ga0307509_10548735 3300031507 Bacteria 834
174 Ga0307509_10552386 3300031507 Bacteria 829
175 Ga0307408_100000196 3300031548 Bacteria 65663
176 Ga0307408_101484153 3300031548 Bacteria 641
177 Ga0307508_10000332 3300031616 Bacteria 57039
178 Ga0307508_10001697 3300031616 Bacteria 24440
179 Ga0307508_10006375 3300031616 Bacteria 11096
180 Ga0307508_10041135 3300031616 Bacteria 4149
181 Ga0307514_10066783 3300031649 Bacteria 2718
182 Ga0307514_10176693 3300031649 Bacteria 1384
183 Ga0307516_10063251 3300031730 Bacteria 3583
184 Ga0307516_10236422 3300031730 Bacteria 1528
185 Ga0307516_10257903 3300031730 Bacteria 1435
186 Ga0307516_10291613 3300031730 Bacteria 1310
187 Ga0307516_10362311 3300031730 Bacteria 1114
188 Ga0307405_10583186 3300031731 Bacteria 910
189 Ga0307405_10859803 3300031731 Bacteria 764
190 Ga0307405_11761347 3300031731 Bacteria 550
191 Ga0307410_11094406 3300031852 Bacteria 691
192 Ga0307406_10067497 3300031901 Bacteria 2332
193 Ga0307406_11343612 3300031901 Bacteria 625
194 Ga0307407_11518503 3300031903 Bacteria 530
195 Ga0307412_10647465 3300031911 Bacteria 901
196 Ga0307416_102171744 3300032002 Bacteria 657
197 Ga0307507_10003609 3300033179 Bacteria 29424
198 Ga0307507_10084452 3300033179 Bacteria 2767
199 Ga0307510_10286704 3300033180 Bacteria 1114
200 Ga0373930_0047804 3300034816 Bacteria 927
201 Ga0373932_0020198 3300035112 Bacteria 1744
202 Ga0373946_0292386 3300035171 Bacteria 804
203 Ga0373924_0001472 3300035410 Bacteria 7658
204 Ga0373931_0010336 3300035691 Bacteria 4485
205 Ga0373931_0410910 3300035691 Bacteria 859
206 Ga0373927_0949771 3300035695 Bacteria 567
207 Ga0373925_0057822 3300037068 Bacteria 2906
208 Ga0395900_0058554 3300037418 Bacteria 3966
209 Ga0395898_0031332 3300037466 Bacteria 5315
210 Ga0395905_0003396 3300037471 Bacteria 17047
211 Ga0395905_0115052 3300037471 Bacteria 2527
212 Ga0395905_0154779 3300037471 Bacteria 2156
213 Ga0395901_0000012 3300038443 Bacteria 381361
214 Ga0436360_0650797 3300039438 Bacteria 1648
215 Ga0436360_1132277 3300039438 Bacteria 2286
216 Ga0436361_0207225 3300039447 Bacteria 861
217 Ga0436363_0750708 3300039450 Bacteria 662
218 Ga0439453_0117999 3300041408 Bacteria 606
219 Ga0451789_1314594 3300041443 Bacteria 546
220 Ga0451841_0288774 3300041498 Bacteria 598
221 Ga0451849_1178856 3300041505 Bacteria 614
222 Ga0451855_1378282 3300041511 Bacteria 565
223 Ga0439433_0013375 3300041999 Bacteria 1802
224 Ga0439455_0003947 3300042012 Bacteria 2893
225 Ga0450894_025442 3300042131 Bacteria 810
226 Ga0450905_054341 3300042142 Bacteria 659
227 Ga0451577_0012109 3300042876 Bacteria 8113
228 Ga0451577_0680706 3300042876 Bacteria 932
229 Ga0466977_0008340 3300044666 Bacteria 5741
230 Ga0466963_0105424 3300044694 Bacteria 1932
231 Ga0495592_0000175 3300046454 Bacteria 56416
232 Ga0495592_0003711 3300046454 Bacteria 11010
233 Ga0495590_0000001 3300046457 Bacteria 762984
234 Ga0495590_0290648 3300046457 Bacteria 613
235 Ga0495638_0105756 3300046460 Bacteria 1677
236 Ga0495638_0365313 3300046460 Bacteria 758
237 Ga0495638_0381748 3300046460 Bacteria 736
238 Ga0495650_0113324 3300046471 Bacteria 1005
239 Ga0495585_0626440 3300046492 Bacteria 505
240 Ga0495606_0530436 3300046507 Bacteria 589
241 Ga0495610_0276498 3300046512 Bacteria 656
242 Ga0495610_0293728 3300046512 Bacteria 629
243 Ga0495618_0554303 3300046514 Unclassified 688
244 Ga0495630_0194883 3300046517 Bacteria 1546
245 Ga0495630_0288158 3300046517 Bacteria 1255
246 Ga0495632_0008164 3300046519 Bacteria 6468
247 Ga0495643_0000044 3300046522 Bacteria 226211
248 Ga0495648_0000001 3300046524 Bacteria 696872
249 Ga0495648_0023383 3300046524 Bacteria 4233
250 Ga0495648_0115262 3300046524 Bacteria 1454
251 Ga0495648_0193289 3300046524 Bacteria 1025
252 Ga0495648_0194533 3300046524 Bacteria 1020
253 Ga0495648_0402425 3300046524 Bacteria 611
254 Ga0495642_0000401 3300046528 Bacteria 23277
255 Ga0495642_0099496 3300046528 Bacteria 1237
256 Ga0495597_0000115 3300046542 Bacteria 72325
257 Ga0495597_0084653 3300046542 Bacteria 1352
258 Ga0495668_0000045 3300046616 Bacteria 225145
259 Ga0495668_0051691 3300046616 Bacteria 2275
260 Ga0495625_0000065 3300046660 Bacteria 173230
261 Ga0495625_0147503 3300046660 Bacteria 1583
262 Ga0495646_0005993 3300046680 Bacteria 7705
263 Ga0495669_0193509 3300046684 Bacteria 971
264 Ga0495624_0215218 3300046690 Bacteria 1165
265 Ga0495649_0007850 3300046694 Bacteria 6459
266 Ga0495660_0202517 3300046810 Bacteria 947
267 Ga0495676_0144215 3300047321 Bacteria 1703
268 Ga0495687_001099 3300047443 Bacteria 26415
269 Ga0495687_001273 3300047443 Bacteria 23729
270 Ga0495687_013163 3300047443 Bacteria 4330
271 Ga0495687_031321 3300047443 Bacteria 2440
272 Ga0495686_0001324 3300047472 Bacteria 27731
273 Ga0495686_0668610 3300047472 Bacteria 532
274 Ga0495614_0367677 3300048089 Bacteria 672
275 Ga0495626_0146678 3300048091 Bacteria 997
276 Ga0496101_0561846 3300048904 Bacteria 902
277 Ga0496102_0335806 3300048905 Bacteria 1423
278 Ga0496105_0335281 3300048908 Bacteria 1210
279 Ga0496106_0933359 3300048909 Bacteria 684
280 Ga0496113_0133633 3300048916 Bacteria 1949
281 Ga0496114_0314115 3300048917 Bacteria 1384
282 Ga0496116_0001220 3300048919 Bacteria 29937
283 Ga0496121_0089403 3300048924 Bacteria 2411
284 Ga0496125_0622828 3300048928 Bacteria 585
285 Ga0495678_033503 3300049459 Bacteria 2119
286 Ga0495682_0068522 3300049460 Bacteria 1278
287 Ga0501043_0365601 3300049579 Bacteria 1094
288 Ga0501206_015062 3300049653 Bacteria 1068
289 Ga0501229_049893 3300049706 Bacteria 616
290 Ga0501272_071595 3300049769 Bacteria 508
291 Ga0501279_001704 3300049775 Bacteria 2891
292 nmdc:mga03683_100415_c1 3300050489 Bacteria 1271
293 nmdc:mga03683_28002_c1 3300050489 Bacteria 2237
294 nmdc:mga03683_304346_c1 3300050489 Bacteria 748
295 nmdc:mga03683_9830_c1 3300050489 Bacteria 3415
296 nmdc:mga03n38_132691_c1 3300050490 Bacteria 1236
297 nmdc:mga03n38_165911_c1 3300050490 Bacteria 1121
298 nmdc:mga03n38_44662_c1 3300050490 Bacteria 1948
299 nmdc:mga00v17_22087_c1 3300050491 Bacteria 3667
300 nmdc:mga0yw44_32210_c1 3300050492 Bacteria 3053
301 nmdc:mga0k408_12545_c1 3300050493 Bacteria 4635
302 nmdc:mga0k408_133_c1 3300050493 Bacteria 36991
303 nmdc:mga0k408_136604_c1 3300050493 Bacteria 1457
304 nmdc:mga0k408_143867_c1 3300050493 Bacteria 1419
305 nmdc:mga0k408_244486_c1 3300050493 Bacteria 1072
306 nmdc:mga0k408_359923_c1 3300050493 Bacteria 867
307 nmdc:mga0k408_41756_c1 3300050493 Bacteria 2641
308 nmdc:mga0k408_509237_c1 3300050493 Bacteria 713
309 nmdc:mga0k408_749567_c1 3300050493 Bacteria 570
310 nmdc:mga0k408_79993_c1 3300050493 Bacteria 1913
311 nmdc:mga0k408_83142_c1 3300050493 Bacteria 1877
312 nmdc:mga06z11_3475_c1 3300050494 Bacteria 6102
313 nmdc:mga06z11_365783_c1 3300050494 Bacteria 865
314 nmdc:mga04h51_180803_c1 3300050495 Bacteria 821
315 nmdc:mga07m45_10967_c1 3300050496 Bacteria 4749
316 nmdc:mga07m45_117139_c1 3300050496 Bacteria 1537
317 nmdc:mga07m45_127_c1 3300050496 Bacteria 30414
318 nmdc:mga07m45_247529_c1 3300050496 Bacteria 1037
319 nmdc:mga07m45_257119_c1 3300050496 Bacteria 1016
320 nmdc:mga07m45_43309_c1 3300050496 Bacteria 2524
321 nmdc:mga07m45_88815_c1 3300050496 Bacteria 1769
322 nmdc:mga0n895_296272_c1 3300050512 Bacteria 1640
323 nmdc:mga0sz30_58547_c1 3300050516 Bacteria 1643
324 Ga0500578_0168990 3300053086 Bacteria 1353
325 Ga0500643_222807 3300053087 Bacteria 507
326 Ga0500644_0014654 3300053088 Bacteria 2218
327 Ga0500646_0027077 3300053090 Bacteria 1558
328 Ga0500583_0125474 3300053092 Bacteria 1271
329 Ga0500583_0366783 3300053092 Bacteria 695
330 Ga0500651_0211259 3300053093 Bacteria 1141
331 Ga0500594_0003320 3300053118 Bacteria 3523
332 Ga0500607_135680 3300053121 Bacteria 1166
333 Ga0500652_029224 3300053131 Bacteria 2148
334 Ga0500658_0042452 3300053134 Bacteria 1827
335 Ga0500559_0001694 3300053136 Bacteria 12147
336 Ga0500619_017417 3300053154 Bacteria 1998
337 Ga0500622_0008524 3300053156 Bacteria 5727
338 Ga0500587_009667 3300053739 Bacteria 1229
339 2644059194 2643221609 Bacteria 6756331
340 2644244934 2643221644 Bacteria 6865017
341 2644302576 2643221654 Bacteria 5273570
342 2834645135 2834641062 Bacteria 5559922
343 Ga0070664_101779192
344 rootH1_10019512
345 rootL2_10161818
346 Ga0070658_10002804
347 Ga0070676_10016341
348 Ga0070683_101460056
349 Ga0068869_100118296
350 Ga0068869_100322628
351 Ga0070666_10906978
352 Ga0070675_100224640
353 Ga0070675_102141363
354 Ga0070671_100034118
355 Ga0070671_100127377
356 Ga0070673_100086947
357 Ga0070688_101546747
358 Ga0070667_100064974
359 Ga0070667_102231629
360 Ga0070708_101231187
361 Ga0070678_100283583
362 Ga0070678_101409203
363 Ga0070685_10120501
364 Ga0070672_100010739
365 Ga0070665_100278353
366 Ga0070665_100668795
367 Ga0068855_100136672
368 Ga0068857_100162697
369 Ga0068854_100356131
370 Ga0068852_100913899
371 Ga0068859_100306399
372 Ga0068864_100014664
373 Ga0068870_10115031
374 Ga0068860_100372691
375 Ga0068860_101446200
376 Ga0081455_10052821
377 Ga0075365_10025577
378 Ga0075368_10099559
379 Ga0075368_10209250
380 Ga0075363_100024058
381 Ga0075363_100098285
382 Ga0075364_10032521
383 Ga0075362_10012721
384 Ga0075362_10027795
385 Ga0075362_10061757
386 Ga0075362_10075832
387 Ga0075362_10078719
388 Ga0075367_10003489
389 Ga0075367_10061035
390 Ga0075369_10337016
391 Ga0075369_10401783
392 Ga0075366_10004367
393 Ga0075366_10005063
394 Ga0075366_10062816
395 Ga0075366_10103288
396 Ga0075366_10108492
397 Ga0075366_10151140
398 Ga0075366_10184553
399 Ga0075366_10310856
400 Ga0075366_10327738
401 Ga0075366_10425962
402 Ga0075366_10705571
403 Ga0097621_100321941
404 Ga0097621_100455426
405 Ga0075370_10011977
406 Ga0075370_10025251
407 Ga0075370_10067824
408 Ga0075370_10079534
409 Ga0075370_10178901
410 Ga0075370_10221285
411 Ga0075370_10415758
412 Ga0075434_100139155
413 Ga0068865_100211493
414 Ga0097620_100306401
415 Ga0105240_10873097
416 Ga0105245_10011498
417 Ga0105245_10147538
418 Ga0105241_11626778
419 Ga0105248_11070018
420 Ga0105237_10123442
421 Ga0105237_10210367
422 Ga0105237_10211438
423 Ga0105238_10648551
424 Ga0105246_10116212
425 Ga0105246_11085690
426 Ga0157370_10018176
427 Ga0157374_10237908
428 Ga0157378_10382884
429 Ga0157372_11839303
430 Ga0157375_10277498
431 Ga0157375_10448228
432 Ga0163163_10574875
433 Ga0157379_10344909
434 Ga0157379_10679915
435 Ga0157379_11623683
436 Ga0157376_11158350
437 Ga0209646_1000023
438 Ga0209026_1013794
439 Ga0207688_11011810
440 Ga0207680_11026067
441 Ga0207645_10004614
442 Ga0207645_10013156
443 Ga0207643_10009830
444 Ga0207705_10002003
445 Ga0207654_10646166
446 Ga0207695_11035450
447 Ga0207671_10100261
448 Ga0207649_10527986
449 Ga0207694_10757298
450 Ga0207659_11033483
451 Ga0207687_10056676
452 Ga0207687_10078852
453 Ga0207687_10211834
454 Ga0207687_10392238
455 Ga0207644_10065196
456 Ga0207644_10070563
457 Ga0207644_10382331
458 Ga0207686_10769056
459 Ga0207704_10382054
460 Ga0207691_10153924
461 Ga0207691_11425814
462 Ga0207689_10120756
463 Ga0207689_10180386
464 Ga0207689_10269083
465 Ga0207689_10923446
466 Ga0207667_10004476
467 Ga0207651_10128082
468 Ga0207651_11743862
469 Ga0207640_10286300
470 Ga0207640_10427674
471 Ga0207640_11697448
472 Ga0207658_10017295
473 Ga0207658_10772969
474 Ga0207658_12164338
475 Ga0207677_10117791
476 Ga0207677_10426178
477 Ga0207677_12093283
478 Ga0207703_11550812
479 Ga0207678_10742731
480 Ga0207648_10017873
481 Ga0207648_10019036
482 Ga0207676_10194516
483 Ga0207674_10219577
484 Ga0207674_10604400
485 Ga0207683_10237209
486 Ga0209996_1001867
487 Ga0209968_1000702
488 Ga0209966_1000040
489 Ga0209813_10116668
490 Ga0209974_10006173
491 Ga0268266_10010170
492 Ga0268266_10455050
493 Ga0268265_10087552
494 Ga0268264_10180300
495 Ga0268264_10275052
496 Ga0268264_11259302
497 Ga0307517_10000160
498 Ga0307517_10000395
499 Ga0307517_10589362
500 Ga0307515_10000006
501 Ga0307515_10000332
502 Ga0307515_10060601
503 Ga0307515_10206740
504 Ga0307511_10013142
505 Ga0307512_10041345
506 Ga0307512_10130900
507 Ga0307512_10139063
508 Ga0307513_10020560
509 Ga0307513_10801884
510 Ga0307509_10000212
511 Ga0307509_10001515
512 Ga0307509_10161551
513 Ga0307509_10250752
514 Ga0307509_10330913
515 Ga0307509_10548735
516 Ga0307509_10552386
517 Ga0307408_100000196
518 Ga0307408_101484153
519 Ga0307508_10000332
520 Ga0307508_10001697
521 Ga0307508_10006375
522 Ga0307508_10041135
523 Ga0307514_10066783
524 Ga0307514_10176693
525 Ga0307516_10063251
526 Ga0307516_10236422
527 Ga0307516_10257903
528 Ga0307516_10291613
529 Ga0307516_10362311
530 Ga0307405_10583186
531 Ga0307405_10859803
532 Ga0307405_11761347
533 Ga0307410_11094406
534 Ga0307406_10067497
535 Ga0307406_11343612
536 Ga0307407_11518503
537 Ga0307412_10647465
538 Ga0307416_102171744
539 Ga0307507_10003609
540 Ga0307507_10084452
541 Ga0307510_10286704
542 Ga0373930_0047804
543 Ga0373932_0020198
544 Ga0373946_0292386
545 Ga0373924_0001472
546 Ga0373931_0010336
547 Ga0373931_0410910
548 Ga0373927_0949771
549 Ga0373925_0057822
550 Ga0395900_0058554
551 Ga0395898_0031332
552 Ga0395905_0003396
553 Ga0395905_0115052
554 Ga0395905_0154779
555 Ga0395901_0000012
556 Ga0436360_0650797
557 Ga0436360_1132277
558 Ga0436361_0207225
559 Ga0436363_0750708
560 Ga0439453_0117999
561 Ga0451789_1314594
562 Ga0451841_0288774
563 Ga0451849_1178856
564 Ga0451855_1378282
565 Ga0439433_0013375
566 Ga0439455_0003947
567 Ga0450894_025442
568 Ga0450905_054341
569 Ga0451577_0012109
570 Ga0451577_0680706
571 Ga0466977_0008340
572 Ga0466963_0105424
573 Ga0495592_0000175
574 Ga0495592_0003711
575 Ga0495590_0000001
576 Ga0495590_0290648
577 Ga0495638_0105756
578 Ga0495638_0365313
579 Ga0495638_0381748
580 Ga0495650_0113324
581 Ga0495585_0626440
582 Ga0495606_0530436
583 Ga0495610_0276498
584 Ga0495610_0293728
585 Ga0495618_0554303
586 Ga0495630_0194883
587 Ga0495630_0288158
588 Ga0495632_0008164
589 Ga0495643_0000044
590 Ga0495648_0000001
591 Ga0495648_0023383
592 Ga0495648_0115262
593 Ga0495648_0193289
594 Ga0495648_0194533
595 Ga0495648_0402425
596 Ga0495642_0000401
597 Ga0495642_0099496
598 Ga0495597_0000115
599 Ga0495597_0084653
600 Ga0495668_0000045
601 Ga0495668_0051691
602 Ga0495625_0000065
603 Ga0495625_0147503
604 Ga0495646_0005993
605 Ga0495669_0193509
606 Ga0495624_0215218
607 Ga0495649_0007850
608 Ga0495660_0202517
609 Ga0495676_0144215
610 Ga0495687_001099
611 Ga0495687_001273
612 Ga0495687_013163
613 Ga0495687_031321
614 Ga0495686_0001324
615 Ga0495686_0668610
616 Ga0495614_0367677
617 Ga0495626_0146678
618 Ga0496101_0561846
619 Ga0496102_0335806
620 Ga0496105_0335281
621 Ga0496106_0933359
622 Ga0496113_0133633
623 Ga0496114_0314115
624 Ga0496116_0001220
625 Ga0496121_0089403
626 Ga0496125_0622828
627 Ga0495678_033503
628 Ga0495682_0068522
629 Ga0501043_0365601
630 Ga0501206_015062
631 Ga0501229_049893
632 Ga0501272_071595
633 Ga0501279_001704
634 nmdc:mga03683_100415_c1
635 nmdc:mga03683_28002_c1
636 nmdc:mga03683_304346_c1
637 nmdc:mga03683_9830_c1
638 nmdc:mga03n38_132691_c1
639 nmdc:mga03n38_165911_c1
640 nmdc:mga03n38_44662_c1
641 nmdc:mga00v17_22087_c1
642 nmdc:mga0yw44_32210_c1
643 nmdc:mga0k408_12545_c1
644 nmdc:mga0k408_133_c1
645 nmdc:mga0k408_136604_c1
646 nmdc:mga0k408_143867_c1
647 nmdc:mga0k408_244486_c1
648 nmdc:mga0k408_359923_c1
649 nmdc:mga0k408_41756_c1
650 nmdc:mga0k408_509237_c1
651 nmdc:mga0k408_749567_c1
652 nmdc:mga0k408_79993_c1
653 nmdc:mga0k408_83142_c1
654 nmdc:mga06z11_3475_c1
655 nmdc:mga06z11_365783_c1
656 nmdc:mga04h51_180803_c1
657 nmdc:mga07m45_10967_c1
658 nmdc:mga07m45_117139_c1
659 nmdc:mga07m45_127_c1
660 nmdc:mga07m45_247529_c1
661 nmdc:mga07m45_257119_c1
662 nmdc:mga07m45_43309_c1
663 nmdc:mga07m45_88815_c1
664 nmdc:mga0n895_296272_c1
665 nmdc:mga0sz30_58547_c1
666 Ga0500578_0168990
667 Ga0500643_222807
668 Ga0500644_0014654
669 Ga0500646_0027077
670 Ga0500583_0125474
671 Ga0500583_0366783
672 Ga0500651_0211259
673 Ga0500594_0003320
674 Ga0500607_135680
675 Ga0500652_029224
676 Ga0500658_0042452
677 Ga0500559_0001694
678 Ga0500619_017417
679 Ga0500622_0008524
680 Ga0500587_009667
681 2644059194
682 2644244934
683 2644302576
684 2834645135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

6

94

0.96

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

6

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9789 6 108
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9762 9 108
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9696 6 108
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.9528 8 105
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9483 9 108
ID Description Score Start End Superfamily
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9763 9 108 2.102.10.10
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9529 11 108 2.102.10.10
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9506 11 108 2.102.10.10
af_Q9VJ03_9_118_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9502 10 108 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9484 9 108 2.102.10.10
ID Description Score Start End GO Terms
AF-O07823-F1-model_v4 Naphthalene 1,2-dioxygenase system, ferredoxin component 0.9909 22 108 GO:0009056
GO:0046872
GO:0051537
AF-A0A176XVG0-F1-model_v4 Naphthalene 1,2-dioxygenase 0.9855 8 107 GO:0009056
GO:0046872
GO:0051213
GO:0051537
AF-A0A4D6EZ52-F1-model_v4 PAH ring hydroxylating dioxygenase 0.9853 8 98 GO:0046872
GO:0051213
GO:0051537
AF-A0A1G6NR79-F1-model_v4 Naphthalene 1,2-dioxygenase system ferredoxin subunit 0.9844 6 108 GO:0009056
GO:0046872
GO:0051213
GO:0051537
AF-A0A7U3GEJ0-F1-model_v4 deleted 0.984 8 105

Map