F415113

General Info

Members Datasets Scaffolds Average Seq Length
342 232 684 264

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100051144|Ga0075430_1000511444
Length 301
Sequence LGRGATGYGRNERQSEVNVADHPYKSPSVRPRPAARGPKPAPIISIRGVVNRFGTQLVHDGVDLDVYPGEVLGIVGGSGSGKSVLLRTMLGLNKPAAGQVVIEGKDITQAPEDELLAVKQRYGVTFQQGALFSSLTVADNIELPIREYFRVSKEALAQLSELRLRMVGLSVDAGAKLPSQLSGGMIKRAALARALALDPSLLFLDEPTAGLDPISAAAFDELVLYLQRGLKLTVVMITHDLDTLVTTCDRVAVLVDRKIVVDTLDGIMKNPHPWIQEYFHGPRARAVQTPGDQGDEPGPRN

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
230 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
231 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
232 2884411467 Dyella sp. AD56 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 1.17
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.6
Nodule 0
Rhizoplane 3.51
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100051144 3300006846 Bacteria 3483
2 JGI24740J21852_10003233 3300001979 Bacteria 7189
3 JGI24740J21852_10010008 3300001979 Bacteria 3675
4 JGI24740J21852_10024292 3300001979 Bacteria 2058
5 JGI24739J22299_10004668 3300001989 Bacteria 5236
6 JGI24737J22298_10000559 3300001990 Bacteria 13038
7 JGI24735J21928_10001809 3300002067 Bacteria 7509
8 JGI25162J39368_1000072 3300002737 Bacteria 122550
9 JGI25157J39369_1000143 3300002741 Bacteria 60517
10 JGI25163J39215_1001127 3300002771 Bacteria 5360
11 JGI25164J39214_1000115 3300002772 Bacteria 77050
12 JGI25165J46597_1000063 3300003214 Bacteria 205051
13 JGI25153J46596_10008070 3300003215 Bacteria 5079
14 Ga0006562J51391_1001749 3300003578 Bacteria 7922
15 Ga0006562J51391_1001750 3300003578 Bacteria 18300
16 Ga0055538_1002088 3300003751 Bacteria 3191
17 Ga0055533_1002156 3300003756 Bacteria 4698
18 Ga0055535_1000068 3300003761 Bacteria 115329
19 Ga0055542_1000090 3300003762 Bacteria 122550
20 Ga0055529_1000084 3300003763 Bacteria 143720
21 Ga0065165_1001063 3300005262 Bacteria 32832
22 Ga0065704_10079766 3300005289 Bacteria 4086
23 Ga0065707_10095927 3300005295 Bacteria 3322
24 Ga0070658_10004051 3300005327 Bacteria 12010
25 Ga0070676_10038418 3300005328 Bacteria 2765
26 Ga0070676_10061904 3300005328 Bacteria 2225
27 Ga0070676_10450485 3300005328 Bacteria 905
28 Ga0070690_100231721 3300005330 Bacteria 1299
29 Ga0070670_100441284 3300005331 Bacteria 1153
30 Ga0070677_10124138 3300005333 Bacteria 1170
31 Ga0068869_100106789 3300005334 Bacteria 2125
32 Ga0070666_10000010 3300005335 Bacteria 264789
33 Ga0070689_100027312 3300005340 Bacteria 4303
34 Ga0070691_10156839 3300005341 Bacteria 1171
35 Ga0070661_100005371 3300005344 Bacteria 8832
36 Ga0070661_100021626 3300005344 Bacteria 4597
37 Ga0070668_100001998 3300005347 Bacteria 14909
38 Ga0070668_100016378 3300005347 Bacteria 5543
39 Ga0070668_100016553 3300005347 Bacteria 5512
40 Ga0070668_100201217 3300005347 Bacteria 1635
41 Ga0070669_100013073 3300005353 Bacteria 5896
42 Ga0070669_100158090 3300005353 Bacteria 1759
43 Ga0070669_100219436 3300005353 Bacteria 1503
44 Ga0070671_100201049 3300005355 Bacteria 1689
45 Ga0070673_100197112 3300005364 Bacteria 1733
46 Ga0070688_100021073 3300005365 Bacteria 3802
47 Ga0070688_100078168 3300005365 Bacteria 2134
48 Ga0070667_100000070 3300005367 Bacteria 126321
49 Ga0070711_100074721 3300005439 Bacteria 2398
50 Ga0070663_100044488 3300005455 Bacteria 3131
51 Ga0070663_100287794 3300005455 Bacteria 1311
52 Ga0070662_100042506 3300005457 Bacteria 3246
53 Ga0070662_100105248 3300005457 Bacteria 2142
54 Ga0070662_100329421 3300005457 Bacteria 1247
55 Ga0070681_10242753 3300005458 Bacteria 1715
56 Ga0068867_100460376 3300005459 Bacteria 1086
57 Ga0070685_10065106 3300005466 Bacteria 2145
58 Ga0070706_100168101 3300005467 Bacteria 2048
59 Ga0070696_100000267 3300005546 Bacteria 31493
60 Ga0070696_100007203 3300005546 Bacteria 7429
61 Ga0070665_100000339 3300005548 Bacteria 71205
62 Ga0070665_100016966 3300005548 Bacteria 7300
63 Ga0068855_100000696 3300005563 Bacteria 41094
64 Ga0068855_100177002 3300005563 Bacteria 2413
65 Ga0068857_100008376 3300005577 Bacteria 8936
66 Ga0068857_100031079 3300005577 Bacteria 4719
67 Ga0068854_100007700 3300005578 Bacteria 6887
68 Ga0068854_100009207 3300005578 Bacteria 6372
69 Ga0068854_100037537 3300005578 Bacteria 3402
70 Ga0068859_100010234 3300005617 Bacteria 9439
71 Ga0068859_101035461 3300005617 Bacteria 902
72 Ga0068864_100001967 3300005618 Bacteria 16895
73 Ga0068866_10060474 3300005718 Bacteria 1964
74 Ga0068861_100002407 3300005719 Bacteria 12184
75 Ga0068851_10003620 3300005834 Bacteria 6892
76 Ga0068863_100058014 3300005841 Bacteria 3664
77 Ga0068863_100131255 3300005841 Bacteria 2392
78 Ga0068863_100209479 3300005841 Bacteria 1877
79 Ga0068858_100034229 3300005842 Bacteria 4712
80 Ga0068860_100000517 3300005843 Bacteria 47364
81 Ga0068860_100001527 3300005843 Bacteria 24942
82 Ga0068860_100020901 3300005843 Bacteria 6342
83 Ga0068860_100192017 3300005843 Bacteria 1976
84 Ga0068862_100000717 3300005844 Bacteria 33735
85 Ga0068862_100058914 3300005844 Bacteria 3296
86 Ga0068862_100109548 3300005844 Bacteria 2423
87 Ga0068862_100155780 3300005844 Bacteria 2036
88 Ga0070712_100122452 3300006175 Bacteria 1959
89 Ga0075428_100004151 3300006844 Bacteria 15943
90 Ga0075428_100096852 3300006844 Bacteria 3216
91 Ga0075428_100242835 3300006844 Bacteria 1943
92 Ga0075433_10002157 3300006852 Bacteria 14904
93 Ga0075433_10391977 3300006852 Bacteria 1226
94 Ga0075434_100007796 3300006871 Bacteria 9916
95 Ga0075429_100059229 3300006880 Bacteria 3335
96 Ga0068865_100025141 3300006881 Bacteria 3914
97 Ga0068865_100050396 3300006881 Bacteria 2876
98 Ga0097620_100010235 3300006931 Bacteria 9439
99 Ga0097620_101035250 3300006931 Bacteria 902
100 Ga0099794_10017114 3300007265 Bacteria 3226
101 Ga0099794_10069042 3300007265 Bacteria 1729
102 Ga0099795_10000289 3300007788 Bacteria 8995
103 Ga0105250_10021170 3300009092 Bacteria 2625
104 Ga0105240_10000633 3300009093 Bacteria 64950
105 Ga0105240_10003017 3300009093 Bacteria 26477
106 Ga0105240_10017993 3300009093 Bacteria 9505
107 Ga0105240_10022080 3300009093 Bacteria 8447
108 Ga0105240_10101277 3300009093 Bacteria 3504
109 Ga0105240_10674715 3300009093 Bacteria 1131
110 Ga0111539_10000362 3300009094 Bacteria 55860
111 Ga0111539_10045704 3300009094 Bacteria 5241
112 Ga0111539_10050610 3300009094 Bacteria 4949
113 Ga0111539_10174885 3300009094 Bacteria 2508
114 Ga0111539_10270348 3300009094 Bacteria 1978
115 Ga0105247_10002758 3300009101 Bacteria 11759
116 Ga0114129_10055597 3300009147 Bacteria 5546
117 Ga0114129_10414586 3300009147 Bacteria 1773
118 Ga0105241_10458702 3300009174 Bacteria 1129
119 Ga0105248_10108514 3300009177 Bacteria 3130
120 Ga0105248_10108875 3300009177 Bacteria 3124
121 Ga0105248_10119702 3300009177 Bacteria 2970
122 Ga0105237_10000148 3300009545 Bacteria 98986
123 Ga0105238_10000044 3300009551 Bacteria 151485
124 Ga0105238_10099909 3300009551 Bacteria 2884
125 Ga0105249_10045696 3300009553 Bacteria 3983
126 Ga0105249_10448669 3300009553 Bacteria 1328
127 Ga0105249_10552264 3300009553 Bacteria 1202
128 Ga0105030_100317 3300009987 Bacteria 4231
129 Ga0099796_10002865 3300010159 Bacteria 3886
130 Ga0105239_10069898 3300010375 Bacteria 3856
131 Ga0157314_1000057 3300012500 Bacteria 11802
132 Ga0157373_10043822 3300013100 Bacteria 3195
133 Ga0157369_10072053 3300013105 Bacteria 3708
134 Ga0157369_10361983 3300013105 Bacteria 1506
135 Ga0157374_10214492 3300013296 Bacteria 1888
136 Ga0157378_10374881 3300013297 Bacteria 1396
137 Ga0163162_10000193 3300013306 Bacteria 56063
138 Ga0157514_120288 3300013874 Bacteria 1810
139 Ga0163163_10193138 3300014325 Bacteria 2084
140 Ga0157380_10000385 3300014326 Bacteria 26615
141 Ga0157380_10007459 3300014326 Bacteria 7767
142 Ga0157380_10543923 3300014326 Bacteria 1138
143 Ga0157376_10019218 3300014969 Bacteria 5260
144 Ga0183368_1002 3300015687 Bacteria 1865598
145 Ga0163161_10102461 3300017792 Bacteria 2132
146 Ga0209760_100542 3300025207 Bacteria 7118
147 Ga0209784_100042 3300025224 Bacteria 218070
148 Ga0209674_100033 3300025226 Bacteria 423450
149 Ga0209674_103136 3300025226 Bacteria 3147
150 Ga0207427_100096 3300025231 Bacteria 123398
151 Ga0207427_106390 3300025231 Bacteria 1498
152 Ga0209437_100074 3300025233 Bacteria 300858
153 Ga0209437_101781 3300025233 Bacteria 4653
154 Ga0209258_100136 3300025242 Bacteria 169078
155 Ga0209646_1002309 3300025246 Bacteria 4334
156 Ga0209646_1006125 3300025246 Bacteria 2038
157 Ga0209026_1000072 3300025250 Bacteria 205447
158 Ga0209148_1000036 3300025254 Bacteria 530505
159 Ga0209148_1001842 3300025254 Bacteria 8891
160 Ga0209759_1000490 3300025256 Bacteria 43624
161 Ga0209233_1000040 3300025261 Bacteria 530395
162 Ga0209455_1000071 3300025272 Bacteria 300858
163 Ga0209758_1000481 3300025297 Bacteria 65650
164 Ga0209758_1017224 3300025297 Bacteria 3613
165 Ga0207656_10013657 3300025321 Bacteria 3110
166 Ga0207680_10000002 3300025903 Bacteria 1018646
167 Ga0207680_10034900 3300025903 Bacteria 2882
168 Ga0207647_10002363 3300025904 Bacteria 14333
169 Ga0207647_10004228 3300025904 Bacteria 10644
170 Ga0207645_10007898 3300025907 Bacteria 7480
171 Ga0207645_10046879 3300025907 Bacteria 2760
172 Ga0207705_10013630 3300025909 Bacteria 5865
173 Ga0207707_10063448 3300025912 Bacteria 3216
174 Ga0207695_10001588 3300025913 Bacteria 36909
175 Ga0207695_10033104 3300025913 Bacteria 5645
176 Ga0207695_10073877 3300025913 Bacteria 3473
177 Ga0207695_10135641 3300025913 Bacteria 2414
178 Ga0207671_10000028 3300025914 Bacteria 263092
179 Ga0207649_10018790 3300025920 Bacteria 3940
180 Ga0207681_10013671 3300025923 Bacteria 5025
181 Ga0207694_10000517 3300025924 Bacteria 34931
182 Ga0207694_10081152 3300025924 Bacteria 2547
183 Ga0207650_10090000 3300025925 Bacteria 2343
184 Ga0207706_10041826 3300025933 Bacteria 4062
185 Ga0207706_10535342 3300025933 Bacteria 1009
186 Ga0207704_10016564 3300025938 Bacteria 3790
187 Ga0207704_10149128 3300025938 Bacteria 1648
188 Ga0207711_10257446 3300025941 Bacteria 1603
189 Ga0207711_10675679 3300025941 Bacteria 963
190 Ga0207667_10000080 3300025949 Bacteria 163287
191 Ga0207667_10000344 3300025949 Bacteria 63681
192 Ga0207651_10245482 3300025960 Bacteria 1462
193 Ga0207712_10306523 3300025961 Bacteria 1305
194 Ga0207668_10000912 3300025972 Bacteria 17798
195 Ga0207668_10001104 3300025972 Bacteria 16060
196 Ga0207668_10026609 3300025972 Bacteria 3757
197 Ga0207668_10071407 3300025972 Bacteria 2480
198 Ga0207668_10187019 3300025972 Bacteria 1638
199 Ga0207640_10000190 3300025981 Bacteria 43737
200 Ga0207640_10005347 3300025981 Bacteria 7000
201 Ga0207640_10103811 3300025981 Bacteria 1999
202 Ga0207658_10000035 3300025986 Bacteria 154818
203 Ga0207658_10135652 3300025986 Bacteria 1984
204 Ga0207658_10284356 3300025986 Bacteria 1419
205 Ga0207677_10059921 3300026023 Bacteria 2628
206 Ga0207678_10050935 3300026067 Bacteria 3576
207 Ga0207678_10060846 3300026067 Bacteria 3248
208 Ga0207641_10064462 3300026088 Bacteria 3132
209 Ga0207641_10186143 3300026088 Bacteria 1905
210 Ga0207641_10331043 3300026088 Bacteria 1447
211 Ga0207648_10175082 3300026089 Bacteria 1897
212 Ga0207674_10000090 3300026116 Bacteria 99821
213 Ga0207675_100001556 3300026118 Bacteria 22976
214 Ga0209179_1003938 3300027512 Bacteria 2196
215 Ga0209588_1052722 3300027671 Bacteria 1316
216 Ga0207428_10001201 3300027907 Bacteria 27753
217 Ga0207428_10121331 3300027907 Bacteria 2004
218 Ga0207428_10121855 3300027907 Bacteria 1999
219 Ga0265356_1000425 3300028017 Bacteria 7661
220 Ga0268266_10000004 3300028379 Bacteria 1495817
221 Ga0268265_10004078 3300028380 Bacteria 10263
222 Ga0268265_10020628 3300028380 Bacteria 4602
223 Ga0268265_10041795 3300028380 Bacteria 3396
224 Ga0268265_10310590 3300028380 Bacteria 1423
225 Ga0268264_10000416 3300028381 Bacteria 60203
226 Ga0268264_10021783 3300028381 Bacteria 5231
227 Ga0265326_10008324 3300028558 Bacteria 3131
228 Ga0265319_1006158 3300028563 Bacteria 5602
229 Ga0265334_10010841 3300028573 Bacteria 3848
230 Ga0265318_10001075 3300028577 Bacteria 17150
231 Ga0307517_10201161 3300028786 Bacteria 1245
232 Ga0265338_10014561 3300028800 Bacteria 8737
233 Ga0265338_10025830 3300028800 Bacteria 5944
234 Ga0265770_1000126 3300030878 Bacteria 9239
235 Ga0265760_10000920 3300031090 Bacteria 8488
236 Ga0265330_10009231 3300031235 Bacteria 4695
237 Ga0265330_10061438 3300031235 Bacteria 1635
238 Ga0265332_10003731 3300031238 Bacteria 7291
239 Ga0265328_10000718 3300031239 Bacteria 15354
240 Ga0265328_10015185 3300031239 Bacteria 3022
241 Ga0265320_10062302 3300031240 Bacteria 1776
242 Ga0265325_10045666 3300031241 Bacteria 2275
243 Ga0265329_10005847 3300031242 Bacteria 4935
244 Ga0265331_10002872 3300031250 Bacteria 11391
245 Ga0265316_10110812 3300031344 Bacteria 2078
246 Ga0307408_100146765 3300031548 Bacteria 1858
247 Ga0265313_10012381 3300031595 Bacteria 5212
248 Ga0265313_10040434 3300031595 Bacteria 2305
249 Ga0265342_10014434 3300031712 Bacteria 5243
250 Ga0307516_10000013 3300031730 Bacteria 217896
251 Ga0307416_100064846 3300032002 Bacteria 2999
252 Ga0307414_10027719 3300032004 Bacteria 3665
253 Ga0307415_100047256 3300032126 Bacteria 2897
254 Ga0307415_100303385 3300032126 Bacteria 1324
255 Ga0307510_10000059 3300033180 Bacteria 84839
256 Ga0373923_0035723 3300035111 Bacteria 2025
257 Ga0373956_0048647 3300035119 Bacteria 1900
258 Ga0373937_0431223 3300036401 Bacteria 1251
259 Ga0395899_0195383 3300037312 Bacteria 1414
260 Ga0395905_0079366 3300037471 Bacteria 3076
261 Ga0436360_0141899 3300039438 Bacteria 3321
262 Ga0451577_0418582 3300042876 Bacteria 1216
263 Ga0466969_0066383 3300044656 Bacteria 1742
264 Ga0466982_0000007 3300044672 Bacteria 250854
265 Ga0466966_0019462 3300044684 Bacteria 4466
266 Ga0466961_0334290 3300044693 Bacteria 923
267 Ga0466964_0000672 3300044706 Bacteria 10967
268 Ga0453684_0020520 3300044712 Bacteria 9957
269 Ga0466971_0006693 3300044719 Bacteria 5015
270 Ga0466968_0018035 3300044735 Bacteria 2828
271 Ga0466970_0081861 3300044765 Bacteria 1745
272 Ga0466960_0021295 3300044901 Bacteria 2884
273 Ga0451576_0070812 3300045051 Bacteria 3629
274 Ga0466958_0033140 3300045836 Bacteria 3077
275 Ga0466967_0009916 3300045976 Bacteria 7108
276 Ga0466967_0464772 3300045976 Bacteria 1238
277 Ga0495627_000209 3300046453 Bacteria 63424
278 Ga0495629_0462092 3300046459 Bacteria 859
279 Ga0495638_0000357 3300046460 Bacteria 56906
280 Ga0495638_0000907 3300046460 Bacteria 30264
281 Ga0495650_0000074 3300046471 Bacteria 251346
282 Ga0495650_0000134 3300046471 Bacteria 173331
283 Ga0495580_0220131 3300046472 Bacteria 1305
284 Ga0495662_0108482 3300046476 Bacteria 1360
285 Ga0495625_0020790 3300046660 Bacteria 5060
286 Ga0495599_0204397 3300046678 Bacteria 1213
287 Ga0495658_0029949 3300046683 Bacteria 2951
288 Ga0495669_0000001 3300046684 Bacteria 291866
289 Ga0495669_0000172 3300046684 Bacteria 40888
290 Ga0495677_0064490 3300047445 Bacteria 1361
291 Ga0496102_0754407 3300048905 Bacteria 896
292 Ga0496104_0000936 3300048907 Bacteria 25051
293 Ga0496104_0219583 3300048907 Bacteria 1813
294 Ga0496105_0001552 3300048908 Bacteria 16255
295 Ga0496106_0348758 3300048909 Bacteria 1189
296 Ga0496112_0416131 3300048915 Bacteria 1283
297 Ga0496113_0003067 3300048916 Bacteria 9912
298 Ga0496114_0006022 3300048917 Bacteria 9542
299 Ga0496114_0100908 3300048917 Bacteria 2463
300 Ga0496115_0002040 3300048918 Bacteria 14453
301 Ga0496115_0020146 3300048918 Bacteria 5141
302 Ga0496117_0013525 3300048920 Bacteria 7113
303 Ga0496118_0000434 3300048921 Bacteria 69469
304 Ga0496119_0001389 3300048922 Bacteria 29376
305 Ga0496120_0001232 3300048923 Bacteria 32376
306 Ga0496121_0000282 3300048924 Bacteria 105900
307 Ga0496121_0101792 3300048924 Bacteria 2214
308 Ga0496121_0260525 3300048924 Bacteria 1197
309 Ga0496124_0079263 3300048927 Bacteria 2705
310 Ga0496125_0000291 3300048928 Bacteria 98752
311 Ga0496125_0053640 3300048928 Bacteria 3303
312 Ga0496126_0129435 3300048929 Bacteria 2182
313 Ga0496126_0130799 3300048929 Bacteria 2169
314 Ga0501038_0000011 3300049574 Bacteria 181217
315 Ga0501067_0016436 3300049583 Bacteria 4088
316 Ga0501073_0007079 3300049589 Bacteria 8356
317 Ga0501074_0262581 3300049590 Bacteria 1227
318 Ga0501077_0013571 3300049593 Bacteria 5108
319 Ga0501257_001923 3300049686 Bacteria 4325
320 Ga0501080_0007371 3300049742 Bacteria 9928
321 Ga0501045_0008507 3300049824 Bacteria 7153
322 nmdc:mga09592_69232_c1 3300050508 Bacteria 2993
323 nmdc:mga0qj67_43011_c1 3300050509 Bacteria 3557
324 nmdc:mga06r32_593951_c1 3300050510 Bacteria 1078
325 nmdc:mga08y16_162688_c1 3300050511 Bacteria 2319
326 nmdc:mga08y16_6375_c1 3300050511 Bacteria 12372
327 nmdc:mga08y16_64041_c1 3300050511 Bacteria 3840
328 nmdc:mga08y16_84971_c1 3300050511 Bacteria 3298
329 nmdc:mga0n895_1635_c1 3300050512 Bacteria 16940
330 nmdc:mga0rr50_15525_c1 3300050513 Bacteria 5029
331 nmdc:mga0a205_133343_c1 3300050515 Bacteria 2384
332 nmdc:mga0a205_1685_c1 3300050515 Bacteria 19075
333 nmdc:mga0a205_384121_c1 3300050515 Bacteria 1269
334 Ga0501084_0219168 3300054114 Bacteria 1605
335 Ga0590075_014607 3300059424 Bacteria 1921
336 Ga0501082_0005967 3300060353 Bacteria 10564
337 Ga0501082_0044386 3300060353 Bacteria 3834
338 Ga0466962_0006046 3300061719 Bacteria 5823
339 2554814125 2554235132 Bacteria 6772433
340 2595447261 2593339238 Bacteria 4182970
341 2608384589 2606217733 Bacteria 6360972
342 2884416080 2884411467 Bacteria 5246714
343 Ga0075430_100051144
344 JGI24740J21852_10003233
345 JGI24740J21852_10010008
346 JGI24740J21852_10024292
347 JGI24739J22299_10004668
348 JGI24737J22298_10000559
349 JGI24735J21928_10001809
350 JGI25162J39368_1000072
351 JGI25157J39369_1000143
352 JGI25163J39215_1001127
353 JGI25164J39214_1000115
354 JGI25165J46597_1000063
355 JGI25153J46596_10008070
356 Ga0006562J51391_1001749
357 Ga0006562J51391_1001750
358 Ga0055538_1002088
359 Ga0055533_1002156
360 Ga0055535_1000068
361 Ga0055542_1000090
362 Ga0055529_1000084
363 Ga0065165_1001063
364 Ga0065704_10079766
365 Ga0065707_10095927
366 Ga0070658_10004051
367 Ga0070676_10038418
368 Ga0070676_10061904
369 Ga0070676_10450485
370 Ga0070690_100231721
371 Ga0070670_100441284
372 Ga0070677_10124138
373 Ga0068869_100106789
374 Ga0070666_10000010
375 Ga0070689_100027312
376 Ga0070691_10156839
377 Ga0070661_100005371
378 Ga0070661_100021626
379 Ga0070668_100001998
380 Ga0070668_100016378
381 Ga0070668_100016553
382 Ga0070668_100201217
383 Ga0070669_100013073
384 Ga0070669_100158090
385 Ga0070669_100219436
386 Ga0070671_100201049
387 Ga0070673_100197112
388 Ga0070688_100021073
389 Ga0070688_100078168
390 Ga0070667_100000070
391 Ga0070711_100074721
392 Ga0070663_100044488
393 Ga0070663_100287794
394 Ga0070662_100042506
395 Ga0070662_100105248
396 Ga0070662_100329421
397 Ga0070681_10242753
398 Ga0068867_100460376
399 Ga0070685_10065106
400 Ga0070706_100168101
401 Ga0070696_100000267
402 Ga0070696_100007203
403 Ga0070665_100000339
404 Ga0070665_100016966
405 Ga0068855_100000696
406 Ga0068855_100177002
407 Ga0068857_100008376
408 Ga0068857_100031079
409 Ga0068854_100007700
410 Ga0068854_100009207
411 Ga0068854_100037537
412 Ga0068859_100010234
413 Ga0068859_101035461
414 Ga0068864_100001967
415 Ga0068866_10060474
416 Ga0068861_100002407
417 Ga0068851_10003620
418 Ga0068863_100058014
419 Ga0068863_100131255
420 Ga0068863_100209479
421 Ga0068858_100034229
422 Ga0068860_100000517
423 Ga0068860_100001527
424 Ga0068860_100020901
425 Ga0068860_100192017
426 Ga0068862_100000717
427 Ga0068862_100058914
428 Ga0068862_100109548
429 Ga0068862_100155780
430 Ga0070712_100122452
431 Ga0075428_100004151
432 Ga0075428_100096852
433 Ga0075428_100242835
434 Ga0075433_10002157
435 Ga0075433_10391977
436 Ga0075434_100007796
437 Ga0075429_100059229
438 Ga0068865_100025141
439 Ga0068865_100050396
440 Ga0097620_100010235
441 Ga0097620_101035250
442 Ga0099794_10017114
443 Ga0099794_10069042
444 Ga0099795_10000289
445 Ga0105250_10021170
446 Ga0105240_10000633
447 Ga0105240_10003017
448 Ga0105240_10017993
449 Ga0105240_10022080
450 Ga0105240_10101277
451 Ga0105240_10674715
452 Ga0111539_10000362
453 Ga0111539_10045704
454 Ga0111539_10050610
455 Ga0111539_10174885
456 Ga0111539_10270348
457 Ga0105247_10002758
458 Ga0114129_10055597
459 Ga0114129_10414586
460 Ga0105241_10458702
461 Ga0105248_10108514
462 Ga0105248_10108875
463 Ga0105248_10119702
464 Ga0105237_10000148
465 Ga0105238_10000044
466 Ga0105238_10099909
467 Ga0105249_10045696
468 Ga0105249_10448669
469 Ga0105249_10552264
470 Ga0105030_100317
471 Ga0099796_10002865
472 Ga0105239_10069898
473 Ga0157314_1000057
474 Ga0157373_10043822
475 Ga0157369_10072053
476 Ga0157369_10361983
477 Ga0157374_10214492
478 Ga0157378_10374881
479 Ga0163162_10000193
480 Ga0157514_120288
481 Ga0163163_10193138
482 Ga0157380_10000385
483 Ga0157380_10007459
484 Ga0157380_10543923
485 Ga0157376_10019218
486 Ga0183368_1002
487 Ga0163161_10102461
488 Ga0209760_100542
489 Ga0209784_100042
490 Ga0209674_100033
491 Ga0209674_103136
492 Ga0207427_100096
493 Ga0207427_106390
494 Ga0209437_100074
495 Ga0209437_101781
496 Ga0209258_100136
497 Ga0209646_1002309
498 Ga0209646_1006125
499 Ga0209026_1000072
500 Ga0209148_1000036
501 Ga0209148_1001842
502 Ga0209759_1000490
503 Ga0209233_1000040
504 Ga0209455_1000071
505 Ga0209758_1000481
506 Ga0209758_1017224
507 Ga0207656_10013657
508 Ga0207680_10000002
509 Ga0207680_10034900
510 Ga0207647_10002363
511 Ga0207647_10004228
512 Ga0207645_10007898
513 Ga0207645_10046879
514 Ga0207705_10013630
515 Ga0207707_10063448
516 Ga0207695_10001588
517 Ga0207695_10033104
518 Ga0207695_10073877
519 Ga0207695_10135641
520 Ga0207671_10000028
521 Ga0207649_10018790
522 Ga0207681_10013671
523 Ga0207694_10000517
524 Ga0207694_10081152
525 Ga0207650_10090000
526 Ga0207706_10041826
527 Ga0207706_10535342
528 Ga0207704_10016564
529 Ga0207704_10149128
530 Ga0207711_10257446
531 Ga0207711_10675679
532 Ga0207667_10000080
533 Ga0207667_10000344
534 Ga0207651_10245482
535 Ga0207712_10306523
536 Ga0207668_10000912
537 Ga0207668_10001104
538 Ga0207668_10026609
539 Ga0207668_10071407
540 Ga0207668_10187019
541 Ga0207640_10000190
542 Ga0207640_10005347
543 Ga0207640_10103811
544 Ga0207658_10000035
545 Ga0207658_10135652
546 Ga0207658_10284356
547 Ga0207677_10059921
548 Ga0207678_10050935
549 Ga0207678_10060846
550 Ga0207641_10064462
551 Ga0207641_10186143
552 Ga0207641_10331043
553 Ga0207648_10175082
554 Ga0207674_10000090
555 Ga0207675_100001556
556 Ga0209179_1003938
557 Ga0209588_1052722
558 Ga0207428_10001201
559 Ga0207428_10121331
560 Ga0207428_10121855
561 Ga0265356_1000425
562 Ga0268266_10000004
563 Ga0268265_10004078
564 Ga0268265_10020628
565 Ga0268265_10041795
566 Ga0268265_10310590
567 Ga0268264_10000416
568 Ga0268264_10021783
569 Ga0265326_10008324
570 Ga0265319_1006158
571 Ga0265334_10010841
572 Ga0265318_10001075
573 Ga0307517_10201161
574 Ga0265338_10014561
575 Ga0265338_10025830
576 Ga0265770_1000126
577 Ga0265760_10000920
578 Ga0265330_10009231
579 Ga0265330_10061438
580 Ga0265332_10003731
581 Ga0265328_10000718
582 Ga0265328_10015185
583 Ga0265320_10062302
584 Ga0265325_10045666
585 Ga0265329_10005847
586 Ga0265331_10002872
587 Ga0265316_10110812
588 Ga0307408_100146765
589 Ga0265313_10012381
590 Ga0265313_10040434
591 Ga0265342_10014434
592 Ga0307516_10000013
593 Ga0307416_100064846
594 Ga0307414_10027719
595 Ga0307415_100047256
596 Ga0307415_100303385
597 Ga0307510_10000059
598 Ga0373923_0035723
599 Ga0373956_0048647
600 Ga0373937_0431223
601 Ga0395899_0195383
602 Ga0395905_0079366
603 Ga0436360_0141899
604 Ga0451577_0418582
605 Ga0466969_0066383
606 Ga0466982_0000007
607 Ga0466966_0019462
608 Ga0466961_0334290
609 Ga0466964_0000672
610 Ga0453684_0020520
611 Ga0466971_0006693
612 Ga0466968_0018035
613 Ga0466970_0081861
614 Ga0466960_0021295
615 Ga0451576_0070812
616 Ga0466958_0033140
617 Ga0466967_0009916
618 Ga0466967_0464772
619 Ga0495627_000209
620 Ga0495629_0462092
621 Ga0495638_0000357
622 Ga0495638_0000907
623 Ga0495650_0000074
624 Ga0495650_0000134
625 Ga0495580_0220131
626 Ga0495662_0108482
627 Ga0495625_0020790
628 Ga0495599_0204397
629 Ga0495658_0029949
630 Ga0495669_0000001
631 Ga0495669_0000172
632 Ga0495677_0064490
633 Ga0496102_0754407
634 Ga0496104_0000936
635 Ga0496104_0219583
636 Ga0496105_0001552
637 Ga0496106_0348758
638 Ga0496112_0416131
639 Ga0496113_0003067
640 Ga0496114_0006022
641 Ga0496114_0100908
642 Ga0496115_0002040
643 Ga0496115_0020146
644 Ga0496117_0013525
645 Ga0496118_0000434
646 Ga0496119_0001389
647 Ga0496120_0001232
648 Ga0496121_0000282
649 Ga0496121_0101792
650 Ga0496121_0260525
651 Ga0496124_0079263
652 Ga0496125_0000291
653 Ga0496125_0053640
654 Ga0496126_0129435
655 Ga0496126_0130799
656 Ga0501038_0000011
657 Ga0501067_0016436
658 Ga0501073_0007079
659 Ga0501074_0262581
660 Ga0501077_0013571
661 Ga0501257_001923
662 Ga0501080_0007371
663 Ga0501045_0008507
664 nmdc:mga09592_69232_c1
665 nmdc:mga0qj67_43011_c1
666 nmdc:mga06r32_593951_c1
667 nmdc:mga08y16_162688_c1
668 nmdc:mga08y16_6375_c1
669 nmdc:mga08y16_64041_c1
670 nmdc:mga08y16_84971_c1
671 nmdc:mga0n895_1635_c1
672 nmdc:mga0rr50_15525_c1
673 nmdc:mga0a205_133343_c1
674 nmdc:mga0a205_1685_c1
675 nmdc:mga0a205_384121_c1
676 Ga0501084_0219168
677 Ga0590075_014607
678 Ga0501082_0005967
679 Ga0501082_0044386
680 Ga0466962_0006046
681 2554814125
682 2595447261
683 2608384589
684 2884416080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

209

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9462 12 232
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9441 15 230
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9422 12 245
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.942 12 245
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.936 12 232
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9459 13 230 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9439 12 249 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9418 11 233 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9415 12 231 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9396 12 232 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A377GL99-F1-model_v4 Uncharacterized ABC transporter ATP-binding protein HI_1087 0.9669 12 247 GO:0005524
GO:0016887
AF-A0A522AFW5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9664 11 255 GO:0005524
GO:0016887
AF-A0A383F2Y9-F1-model_v4 ABC transporter domain-containing protein 0.958 29 230 GO:0005524
GO:0016887
AF-A0A2N3PRL6-F1-model_v4 Polyamine ABC transporter ATP-binding protein 0.9557 9 247 GO:0005524
GO:0016887
AF-A0A529HGG3-F1-model_v4 ATP-binding cassette domain-containing protein 0.9545 87 231 GO:0005524
GO:0006865
GO:0016887

Map