F415128

General Info

Members Datasets Scaffolds Average Seq Length
342 155 684 144

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10129007|Ga0105244_101290071
Length 148
Sequence MINIRVMTMDDYDAVIALMSNTPGISLRDADSRXXXARYLQRNPGLSFVAEFVAESETGLCGCVMSGHDGRRGYLQHLLVLPEYRRQGIANRLVERCLSSLEALGIAKCHLDVFKTNESAARYWQHQGWTLRVDIDRYSFTRPGNENA

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
66 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
67 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
68 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
69 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
79 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
107 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
108 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
117 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
118 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
119 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
120 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
128 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
129 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
130 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
131 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
132 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
133 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
134 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
135 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
136 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
137 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
138 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
139 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
140 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
141 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
142 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
143 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
144 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
145 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
146 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
147 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
148 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
149 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
150 2738541307 Variovorax sp. GV008 Isolate Unclassified
151 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
152 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
153 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
154 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
155 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 0
Isolates 6.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 6.14
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10129007 3300009036 Bacteria 1221
2 JGI24740J21852_10024753 3300001979 Bacteria 2032
3 rootL2_10358497 3300003322 Bacteria 1646
4 Ga0065714_10064945 3300005288 Bacteria 15037
5 Ga0065714_10079686 3300005288 Bacteria 2494
6 Ga0070658_10189916 3300005327 Bacteria 1731
7 Ga0070683_100005047 3300005329 Bacteria 10959
8 Ga0070683_100116704 3300005329 Bacteria 2520
9 Ga0070670_100000945 3300005331 Bacteria 22835
10 Ga0070660_100086648 3300005339 Bacteria 2464
11 Ga0070691_10002745 3300005341 Bacteria 7847
12 Ga0070661_100000310 3300005344 Bacteria 39292
13 Ga0070681_10007349 3300005458 Bacteria 10765
14 Ga0070679_100006368 3300005530 Bacteria 10995
15 Ga0070684_100032174 3300005535 Bacteria 4469
16 Ga0068855_100036864 3300005563 Bacteria 5817
17 Ga0068855_100100363 3300005563 Bacteria 3333
18 Ga0070664_100000241 3300005564 Bacteria 39292
19 Ga0068857_100024352 3300005577 Bacteria 5328
20 Ga0068856_100007337 3300005614 Bacteria 10761
21 Ga0068856_100787456 3300005614 Unclassified 971
22 Ga0068852_100017207 3300005616 Bacteria 5666
23 Ga0068852_100206512 3300005616 Bacteria 1861
24 Ga0105251_10000225 3300009011 Bacteria 56822
25 Ga0105251_10005643 3300009011 Bacteria 8129
26 Ga0105251_10081395 3300009011 Bacteria 1496
27 Ga0105244_10000140 3300009036 Bacteria 75393
28 Ga0105244_10003318 3300009036 Bacteria 11586
29 Ga0105244_10018027 3300009036 Bacteria 3974
30 Ga0105244_10037288 3300009036 Bacteria 2542
31 Ga0105244_10270299 3300009036 Unclassified 790
32 Ga0105240_10103778 3300009093 Bacteria 3453
33 Ga0105243_10042310 3300009148 Bacteria 3566
34 Ga0105243_10422472 3300009148 Bacteria 1244
35 Ga0105241_10011075 3300009174 Bacteria 6618
36 Ga0105241_10148775 3300009174 Bacteria 1914
37 Ga0105242_10000099 3300009176 Bacteria 61092
38 Ga0105237_10002377 3300009545 Bacteria 23363
39 Ga0105237_10050520 3300009545 Bacteria 4178
40 Ga0105238_10072907 3300009551 Bacteria 3428
41 Ga0105238_10078949 3300009551 Bacteria 3281
42 Ga0105249_12081728 3300009553 Bacteria 640
43 Ga0105239_10037531 3300010375 Bacteria 5309
44 Ga0105239_10964720 3300010375 Bacteria 980
45 Ga0105246_10006501 3300011119 Bacteria 7135
46 Ga0105246_10010354 3300011119 Bacteria 5768
47 Ga0157373_10000596 3300013100 Bacteria 28045
48 Ga0157373_10011494 3300013100 Bacteria 6506
49 Ga0157373_10028776 3300013100 Bacteria 4007
50 Ga0157373_10092398 3300013100 Bacteria 2131
51 Ga0157371_10121191 3300013102 Bacteria 1860
52 Ga0157371_10123384 3300013102 Bacteria 1842
53 Ga0157371_10376313 3300013102 Bacteria 1036
54 Ga0157370_10064825 3300013104 Bacteria 3457
55 Ga0157370_10186500 3300013104 Bacteria 1926
56 Ga0157370_10544583 3300013104 Bacteria 1064
57 Ga0157370_11438241 3300013104 Unclassified 620
58 Ga0157369_10013113 3300013105 Bacteria 9379
59 Ga0157369_10021547 3300013105 Bacteria 7208
60 Ga0157369_11883250 3300013105 Bacteria 607
61 Ga0157372_10004517 3300013307 Bacteria 14842
62 Ga0157375_10000602 3300013308 Bacteria 31951
63 Ga0157375_10001025 3300013308 Bacteria 24117
64 Ga0157375_10099513 3300013308 Bacteria 2987
65 Ga0182008_10000998 3300014497 Bacteria 19680
66 Ga0182008_10049931 3300014497 Bacteria 2076
67 Ga0182008_10940840 3300014497 Unclassified 511
68 Ga0182006_1000158 3300015261 Bacteria 72283
69 Ga0182006_1030501 3300015261 Bacteria 2179
70 Ga0182005_1001019 3300015265 Bacteria 11956
71 Ga0182005_1012518 3300015265 Bacteria 2395
72 Ga0207655_1000203 3300025728 Bacteria 103900
73 Ga0207655_1001779 3300025728 Bacteria 18775
74 Ga0207655_1008155 3300025728 Bacteria 6695
75 Ga0207655_1046314 3300025728 Bacteria 1807
76 Ga0207713_1000234 3300025735 Bacteria 74226
77 Ga0207713_1037542 3300025735 Bacteria 2064
78 Ga0207654_10002307 3300025911 Bacteria 9789
79 Ga0207707_10000882 3300025912 Bacteria 29354
80 Ga0207695_10059056 3300025913 Bacteria 3980
81 Ga0207671_10002355 3300025914 Bacteria 20338
82 Ga0207671_10028771 3300025914 Bacteria 4151
83 Ga0207662_10324896 3300025918 Unclassified 1028
84 Ga0207649_10000289 3300025920 Bacteria 39217
85 Ga0207649_10079398 3300025920 Bacteria 2120
86 Ga0207652_10127370 3300025921 Bacteria 2269
87 Ga0207694_10001837 3300025924 Bacteria 17676
88 Ga0207694_10508226 3300025924 Bacteria 1009
89 Ga0207650_10000721 3300025925 Bacteria 25687
90 Ga0207686_10066160 3300025934 Bacteria 2307
91 Ga0207709_10281477 3300025935 Bacteria 1228
92 Ga0207709_10340037 3300025935 Bacteria 1129
93 Ga0207661_10026191 3300025944 Bacteria 4440
94 Ga0207661_10038018 3300025944 Bacteria 3769
95 Ga0207679_10000037 3300025945 Bacteria 133550
96 Ga0207679_10514346 3300025945 Bacteria 1070
97 Ga0207667_10001427 3300025949 Bacteria 29937
98 Ga0207667_10136287 3300025949 Unclassified 2528
99 Ga0207639_10028439 3300026041 Bacteria 4082
100 Ga0207702_10021433 3300026078 Bacteria 5350
101 Ga0207674_10007777 3300026116 Bacteria 12471
102 Ga0207698_10051253 3300026142 Plasmid 3154
103 Ga0207698_10180392 3300026142 Bacteria 1870
104 Ga0265322_10123399 3300028654 Bacteria 738
105 Ga0316182_1348522 3300030745 Bacteria 951
106 Ga0265313_10011133 3300031595 Bacteria 5610
107 Ga0307510_10075809 3300033180 Bacteria 3313
108 Ga0395900_0029826 3300037418 Bacteria 5599
109 Ga0395898_0011900 3300037466 Bacteria 9011
110 Ga0395901_0000012 3300038443 Bacteria 381361
111 Ga0439438_171467 3300041405 Bacteria 516
112 Ga0439451_009087 3300042009 Bacteria 2013
113 Ga0439456_012814 3300042013 Bacteria 1741
114 Ga0439463_001033 3300042016 Bacteria 7557
115 Ga0439463_011270 3300042016 Bacteria 2196
116 Ga0439463_174017 3300042016 Bacteria 558
117 Ga0439464_0013386 3300042439 Bacteria 2196
118 Ga0453684_0054252 3300044712 Bacteria 5223
119 Ga0453684_0248490 3300044712 Bacteria 2044
120 Ga0495617_028946 3300046452 Bacteria 1863
121 Ga0495627_000054 3300046453 Bacteria 151899
122 Ga0495627_000504 3300046453 Bacteria 32717
123 Ga0495627_015763 3300046453 Bacteria 2604
124 Ga0495591_000040 3300046458 Bacteria 155841
125 Ga0495591_000117 3300046458 Bacteria 89645
126 Ga0495591_000336 3300046458 Bacteria 42037
127 Ga0495591_000397 3300046458 Bacteria 36701
128 Ga0495591_002219 3300046458 Bacteria 11080
129 Ga0495591_007523 3300046458 Bacteria 4616
130 Ga0495591_011221 3300046458 Bacteria 3408
131 Ga0495653_0000051 3300046463 Bacteria 106012
132 Ga0495650_0006937 3300046471 Bacteria 6930
133 Ga0495650_0033965 3300046471 Bacteria 2263
134 Ga0495605_0000017 3300046474 Bacteria 273775
135 Ga0495605_0000031 3300046474 Bacteria 213242
136 Ga0495605_0000762 3300046474 Bacteria 23551
137 Ga0495605_0002910 3300046474 Bacteria 10387
138 Ga0495605_0006888 3300046474 Bacteria 6491
139 Ga0495605_0008317 3300046474 Bacteria 5866
140 Ga0495605_0070509 3300046474 Bacteria 1652
141 Ga0495605_0210272 3300046474 Bacteria 845
142 Ga0495605_0370593 3300046474 Bacteria 598
143 Ga0495584_0001072 3300046491 Bacteria 16988
144 Ga0495584_0031014 3300046491 Bacteria 2705
145 Ga0495596_0176518 3300046500 Bacteria 830
146 Ga0495607_0000022 3300046501 Bacteria 162516
147 Ga0495607_0000350 3300046501 Bacteria 47725
148 Ga0495607_0000352 3300046501 Bacteria 47564
149 Ga0495607_0000397 3300046501 Bacteria 44177
150 Ga0495607_0000680 3300046501 Bacteria 32879
151 Ga0495607_0007816 3300046501 Bacteria 7360
152 Ga0495607_0008745 3300046501 Bacteria 6898
153 Ga0495607_0008826 3300046501 Bacteria 6861
154 Ga0495607_0017014 3300046501 Bacteria 4680
155 Ga0495607_0068534 3300046501 Bacteria 1989
156 Ga0495607_0098140 3300046501 Bacteria 1574
157 Ga0495607_0118678 3300046501 Bacteria 1392
158 Ga0495607_0155519 3300046501 Bacteria 1166
159 Ga0495607_0255132 3300046501 Bacteria 842
160 Ga0495607_0272373 3300046501 Unclassified 806
161 Ga0495583_0000511 3300046506 Bacteria 55564
162 Ga0495583_0000698 3300046506 Bacteria 43244
163 Ga0495583_0000722 3300046506 Bacteria 42246
164 Ga0495583_0001780 3300046506 Bacteria 20527
165 Ga0495583_0001956 3300046506 Bacteria 18948
166 Ga0495583_0004054 3300046506 Bacteria 10772
167 Ga0495583_0017614 3300046506 Bacteria 3786
168 Ga0495606_0000015 3300046507 Bacteria 288808
169 Ga0495606_0000270 3300046507 Bacteria 91423
170 Ga0495606_0000343 3300046507 Bacteria 79977
171 Ga0495606_0000504 3300046507 Bacteria 63622
172 Ga0495606_0001285 3300046507 Bacteria 34788
173 Ga0495606_0012781 3300046507 Bacteria 6689
174 Ga0495606_0034598 3300046507 Bacteria 3467
175 Ga0495606_0179482 3300046507 Bacteria 1222
176 Ga0495606_0320258 3300046507 Bacteria 833
177 Ga0495610_0011138 3300046512 Bacteria 5520
178 Ga0495610_0028545 3300046512 Bacteria 2949
179 Ga0495610_0030484 3300046512 Bacteria 2826
180 Ga0495610_0041108 3300046512 Bacteria 2324
181 Ga0495610_0061853 3300046512 Bacteria 1777
182 Ga0495610_0113710 3300046512 Bacteria 1195
183 Ga0495610_0213495 3300046512 Bacteria 783
184 Ga0495610_0311864 3300046512 Bacteria 603
185 Ga0495616_0037093 3300046513 Bacteria 2510
186 Ga0495620_0000105 3300046515 Bacteria 67077
187 Ga0495620_0000236 3300046515 Bacteria 41329
188 Ga0495620_0003815 3300046515 Bacteria 8596
189 Ga0495620_0004610 3300046515 Bacteria 7747
190 Ga0495620_0045850 3300046515 Bacteria 1890
191 Ga0495631_0001917 3300046518 Bacteria 12243
192 Ga0495631_0006841 3300046518 Bacteria 5852
193 Ga0495631_0043331 3300046518 Bacteria 1985
194 Ga0495632_0000912 3300046519 Bacteria 25920
195 Ga0495632_0002053 3300046519 Bacteria 15819
196 Ga0495632_0002626 3300046519 Bacteria 13531
197 Ga0495632_0010740 3300046519 Bacteria 5395
198 Ga0495632_0156749 3300046519 Bacteria 1050
199 Ga0495637_0000050 3300046520 Bacteria 101502
200 Ga0495637_0000133 3300046520 Bacteria 55485
201 Ga0495637_0014674 3300046520 Bacteria 3691
202 Ga0495637_0037604 3300046520 Bacteria 2100
203 Ga0495643_0010542 3300046522 Bacteria 5682
204 Ga0495643_0070440 3300046522 Bacteria 1836
205 Ga0495644_0002830 3300046523 Bacteria 6876
206 Ga0495648_0000219 3300046524 Bacteria 65619
207 Ga0495648_0008673 3300046524 Bacteria 7971
208 Ga0495648_0073869 3300046524 Bacteria 1966
209 Ga0495654_0000432 3300046530 Bacteria 35485
210 Ga0495654_0002676 3300046530 Bacteria 11281
211 Ga0495654_0003317 3300046530 Bacteria 9912
212 Ga0495654_0004191 3300046530 Bacteria 8626
213 Ga0495609_0000070 3300046538 Bacteria 128181
214 Ga0495609_0000104 3300046538 Bacteria 98657
215 Ga0495609_0007342 3300046538 Bacteria 5513
216 Ga0495609_0100238 3300046538 Bacteria 1255
217 Ga0495597_0000002 3300046542 Bacteria 420382
218 Ga0495597_0131633 3300046542 Bacteria 1037
219 Ga0495597_0133199 3300046542 Bacteria 1029
220 Ga0495622_0003225 3300046557 Bacteria 7727
221 Ga0495633_0014153 3300046558 Bacteria 4180
222 Ga0495668_0041137 3300046616 Bacteria 2576
223 Ga0495611_0000863 3300046648 Bacteria 16615
224 Ga0495611_0003655 3300046648 Bacteria 6747
225 Ga0495625_0001167 3300046660 Bacteria 33819
226 Ga0495661_0000100 3300046665 Bacteria 104957
227 Ga0495661_0000156 3300046665 Bacteria 80747
228 Ga0495661_0000194 3300046665 Bacteria 70173
229 Ga0495661_0001273 3300046665 Bacteria 21643
230 Ga0495661_0004179 3300046665 Bacteria 10497
231 Ga0495661_0016051 3300046665 Bacteria 4975
232 Ga0495661_0223627 3300046665 Bacteria 974
233 Ga0495671_0008780 3300046692 Bacteria 5675
234 Ga0495671_0119534 3300046692 Bacteria 1286
235 Ga0495649_0002230 3300046694 Bacteria 13787
236 Ga0495649_0024941 3300046694 Bacteria 3331
237 Ga0495649_0167411 3300046694 Bacteria 1151
238 Ga0495589_0000297 3300046794 Bacteria 39517
239 Ga0495660_0000865 3300046810 Bacteria 22365
240 Ga0495660_0002955 3300046810 Bacteria 10643
241 Ga0495660_0003496 3300046810 Bacteria 9690
242 Ga0495660_0005744 3300046810 Bacteria 7410
243 Ga0495660_0006291 3300046810 Bacteria 7042
244 Ga0495660_0032754 3300046810 Bacteria 2918
245 Ga0495660_0121584 3300046810 Bacteria 1320
246 Ga0495660_0235471 3300046810 Bacteria 856
247 Ga0495672_0006423 3300047320 Bacteria 9108
248 Ga0495672_0006653 3300047320 Bacteria 8879
249 Ga0495672_0027577 3300047320 Bacteria 3606
250 Ga0495672_0030529 3300047320 Bacteria 3379
251 Ga0495672_0099462 3300047320 Bacteria 1581
252 Ga0495672_0118294 3300047320 Bacteria 1412
253 Ga0495676_0000043 3300047321 Bacteria 103066
254 Ga0495683_0096478 3300047323 Bacteria 1426
255 Ga0495679_000049 3300047446 Bacteria 127408
256 Ga0495679_000247 3300047446 Bacteria 44736
257 Ga0495679_005347 3300047446 Bacteria 5707
258 Ga0495679_010491 3300047446 Bacteria 3634
259 Ga0495673_0000292 3300047469 Bacteria 67107
260 Ga0495673_0000447 3300047469 Bacteria 45237
261 Ga0495673_0000561 3300047469 Bacteria 37888
262 Ga0495673_0002256 3300047469 Bacteria 13842
263 Ga0495673_0004590 3300047469 Bacteria 8605
264 Ga0495673_0015373 3300047469 Bacteria 3946
265 Ga0495673_0030075 3300047469 Bacteria 2556
266 Ga0495673_0062414 3300047469 Bacteria 1591
267 Ga0495673_0072139 3300047469 Bacteria 1450
268 Ga0495673_0223087 3300047469 Bacteria 696
269 Ga0495681_0005452 3300047470 Bacteria 8507
270 Ga0495681_0007287 3300047470 Bacteria 7097
271 Ga0495681_0010790 3300047470 Bacteria 5502
272 Ga0495681_0042261 3300047470 Bacteria 2207
273 Ga0495681_0047520 3300047470 Bacteria 2041
274 Ga0495686_0010404 3300047472 Bacteria 6622
275 Ga0495686_0133087 3300047472 Bacteria 1473
276 Ga0495626_0000093 3300048091 Bacteria 116329
277 Ga0496102_0137466 3300048905 Bacteria 2290
278 Ga0496103_0187748 3300048906 Bacteria 1329
279 Ga0496110_0038153 3300048913 Bacteria 4179
280 Ga0496110_0711610 3300048913 Unclassified 906
281 Ga0496111_0176993 3300048914 Bacteria 1586
282 Ga0496116_0215290 3300048919 Bacteria 991
283 Ga0496117_0000359 3300048920 Bacteria 79857
284 Ga0496117_0252141 3300048920 Bacteria 962
285 Ga0496118_0058809 3300048921 Bacteria 2868
286 Ga0496118_0061104 3300048921 Bacteria 2792
287 Ga0496118_0093438 3300048921 Bacteria 2060
288 Ga0496118_0129956 3300048921 Bacteria 1620
289 Ga0496119_0005330 3300048922 Bacteria 12372
290 Ga0496120_0001278 3300048923 Bacteria 31428
291 Ga0496121_0016196 3300048924 Bacteria 7717
292 Ga0496122_0002215 3300048925 Bacteria 28365
293 Ga0496122_0014762 3300048925 Bacteria 7530
294 Ga0496122_0060483 3300048925 Bacteria 2789
295 Ga0496122_0112513 3300048925 Bacteria 1782
296 Ga0496123_0000513 3300048926 Bacteria 67386
297 Ga0496123_0012552 3300048926 Bacteria 7213
298 Ga0496123_0013173 3300048926 Bacteria 6972
299 Ga0496123_0014177 3300048926 Bacteria 6625
300 Ga0496123_0483430 3300048926 Bacteria 544
301 Ga0496124_0000309 3300048927 Bacteria 90452
302 Ga0496124_0000383 3300048927 Bacteria 80834
303 Ga0496124_0000714 3300048927 Bacteria 54365
304 Ga0496124_0007907 3300048927 Bacteria 11201
305 Ga0496125_0000459 3300048928 Bacteria 73809
306 Ga0496125_0001073 3300048928 Bacteria 42119
307 Ga0496126_0039551 3300048929 Bacteria 4375
308 Ga0495678_000043 3300049459 Bacteria 172593
309 Ga0495678_006360 3300049459 Bacteria 6298
310 Ga0495678_007927 3300049459 Bacteria 5443
311 Ga0495678_008563 3300049459 Bacteria 5146
312 Ga0495678_016577 3300049459 Bacteria 3364
313 Ga0495678_031975 3300049459 Bacteria 2187
314 Ga0495682_0000355 3300049460 Bacteria 33636
315 Ga0495682_0179345 3300049460 Bacteria 753
316 Ga0500650_0166948 3300053098 Bacteria 1013
317 Ga0500573_0016276 3300053140 Bacteria 4221
318 Ga0500634_0001971 3300053161 Bacteria 8383
319 Ga0500637_0280762 3300053178 Bacteria 917
320 2599329538 2599185155 Bacteria 5827168
321 2599397525 2599185167 Bacteria 6353609
322 2599451970 2599185179 Bacteria 6611171
323 2599513648 2599185190 Bacteria 6285678
324 2599521953 2599185191 Bacteria 6297582
325 2599616844 2599185212 Bacteria 6765997
326 2599892325 2599185290 Bacteria 6289611
327 2599971471 2599185307 Bacteria 6194719
328 2599995359 2599185311 Bacteria 6354990
329 2600032760 2599185317 Bacteria 6435722
330 2600045048 2599185319 Bacteria 6637840
331 2600058556 2599185322 Bacteria 6763055
332 2600066769 2599185323 Bacteria 6688755
333 2600358197 2600254930 Bacteria 6431253
334 2601628062 2600255283 Bacteria 6061572
335 2671127988 2667528176 Bacteria 6724917
336 2738688345 2738541271 Bacteria 5657310
337 2738885382 2738541307 Bacteria 8606193
338 2739264076 2738543016 Bacteria 5657564
339 2881415597 2881412998 Bacteria 6492157
340 2945963090 2945961074 Bacteria 7342064
341 2946010477 2946006987 Bacteria 6705746
342 8055821520 8055817908 Bacteria 6609162
343 Ga0105244_10129007
344 JGI24740J21852_10024753
345 rootL2_10358497
346 Ga0065714_10064945
347 Ga0065714_10079686
348 Ga0070658_10189916
349 Ga0070683_100005047
350 Ga0070683_100116704
351 Ga0070670_100000945
352 Ga0070660_100086648
353 Ga0070691_10002745
354 Ga0070661_100000310
355 Ga0070681_10007349
356 Ga0070679_100006368
357 Ga0070684_100032174
358 Ga0068855_100036864
359 Ga0068855_100100363
360 Ga0070664_100000241
361 Ga0068857_100024352
362 Ga0068856_100007337
363 Ga0068856_100787456
364 Ga0068852_100017207
365 Ga0068852_100206512
366 Ga0105251_10000225
367 Ga0105251_10005643
368 Ga0105251_10081395
369 Ga0105244_10000140
370 Ga0105244_10003318
371 Ga0105244_10018027
372 Ga0105244_10037288
373 Ga0105244_10270299
374 Ga0105240_10103778
375 Ga0105243_10042310
376 Ga0105243_10422472
377 Ga0105241_10011075
378 Ga0105241_10148775
379 Ga0105242_10000099
380 Ga0105237_10002377
381 Ga0105237_10050520
382 Ga0105238_10072907
383 Ga0105238_10078949
384 Ga0105249_12081728
385 Ga0105239_10037531
386 Ga0105239_10964720
387 Ga0105246_10006501
388 Ga0105246_10010354
389 Ga0157373_10000596
390 Ga0157373_10011494
391 Ga0157373_10028776
392 Ga0157373_10092398
393 Ga0157371_10121191
394 Ga0157371_10123384
395 Ga0157371_10376313
396 Ga0157370_10064825
397 Ga0157370_10186500
398 Ga0157370_10544583
399 Ga0157370_11438241
400 Ga0157369_10013113
401 Ga0157369_10021547
402 Ga0157369_11883250
403 Ga0157372_10004517
404 Ga0157375_10000602
405 Ga0157375_10001025
406 Ga0157375_10099513
407 Ga0182008_10000998
408 Ga0182008_10049931
409 Ga0182008_10940840
410 Ga0182006_1000158
411 Ga0182006_1030501
412 Ga0182005_1001019
413 Ga0182005_1012518
414 Ga0207655_1000203
415 Ga0207655_1001779
416 Ga0207655_1008155
417 Ga0207655_1046314
418 Ga0207713_1000234
419 Ga0207713_1037542
420 Ga0207654_10002307
421 Ga0207707_10000882
422 Ga0207695_10059056
423 Ga0207671_10002355
424 Ga0207671_10028771
425 Ga0207662_10324896
426 Ga0207649_10000289
427 Ga0207649_10079398
428 Ga0207652_10127370
429 Ga0207694_10001837
430 Ga0207694_10508226
431 Ga0207650_10000721
432 Ga0207686_10066160
433 Ga0207709_10281477
434 Ga0207709_10340037
435 Ga0207661_10026191
436 Ga0207661_10038018
437 Ga0207679_10000037
438 Ga0207679_10514346
439 Ga0207667_10001427
440 Ga0207667_10136287
441 Ga0207639_10028439
442 Ga0207702_10021433
443 Ga0207674_10007777
444 Ga0207698_10051253
445 Ga0207698_10180392
446 Ga0265322_10123399
447 Ga0316182_1348522
448 Ga0265313_10011133
449 Ga0307510_10075809
450 Ga0395900_0029826
451 Ga0395898_0011900
452 Ga0395901_0000012
453 Ga0439438_171467
454 Ga0439451_009087
455 Ga0439456_012814
456 Ga0439463_001033
457 Ga0439463_011270
458 Ga0439463_174017
459 Ga0439464_0013386
460 Ga0453684_0054252
461 Ga0453684_0248490
462 Ga0495617_028946
463 Ga0495627_000054
464 Ga0495627_000504
465 Ga0495627_015763
466 Ga0495591_000040
467 Ga0495591_000117
468 Ga0495591_000336
469 Ga0495591_000397
470 Ga0495591_002219
471 Ga0495591_007523
472 Ga0495591_011221
473 Ga0495653_0000051
474 Ga0495650_0006937
475 Ga0495650_0033965
476 Ga0495605_0000017
477 Ga0495605_0000031
478 Ga0495605_0000762
479 Ga0495605_0002910
480 Ga0495605_0006888
481 Ga0495605_0008317
482 Ga0495605_0070509
483 Ga0495605_0210272
484 Ga0495605_0370593
485 Ga0495584_0001072
486 Ga0495584_0031014
487 Ga0495596_0176518
488 Ga0495607_0000022
489 Ga0495607_0000350
490 Ga0495607_0000352
491 Ga0495607_0000397
492 Ga0495607_0000680
493 Ga0495607_0007816
494 Ga0495607_0008745
495 Ga0495607_0008826
496 Ga0495607_0017014
497 Ga0495607_0068534
498 Ga0495607_0098140
499 Ga0495607_0118678
500 Ga0495607_0155519
501 Ga0495607_0255132
502 Ga0495607_0272373
503 Ga0495583_0000511
504 Ga0495583_0000698
505 Ga0495583_0000722
506 Ga0495583_0001780
507 Ga0495583_0001956
508 Ga0495583_0004054
509 Ga0495583_0017614
510 Ga0495606_0000015
511 Ga0495606_0000270
512 Ga0495606_0000343
513 Ga0495606_0000504
514 Ga0495606_0001285
515 Ga0495606_0012781
516 Ga0495606_0034598
517 Ga0495606_0179482
518 Ga0495606_0320258
519 Ga0495610_0011138
520 Ga0495610_0028545
521 Ga0495610_0030484
522 Ga0495610_0041108
523 Ga0495610_0061853
524 Ga0495610_0113710
525 Ga0495610_0213495
526 Ga0495610_0311864
527 Ga0495616_0037093
528 Ga0495620_0000105
529 Ga0495620_0000236
530 Ga0495620_0003815
531 Ga0495620_0004610
532 Ga0495620_0045850
533 Ga0495631_0001917
534 Ga0495631_0006841
535 Ga0495631_0043331
536 Ga0495632_0000912
537 Ga0495632_0002053
538 Ga0495632_0002626
539 Ga0495632_0010740
540 Ga0495632_0156749
541 Ga0495637_0000050
542 Ga0495637_0000133
543 Ga0495637_0014674
544 Ga0495637_0037604
545 Ga0495643_0010542
546 Ga0495643_0070440
547 Ga0495644_0002830
548 Ga0495648_0000219
549 Ga0495648_0008673
550 Ga0495648_0073869
551 Ga0495654_0000432
552 Ga0495654_0002676
553 Ga0495654_0003317
554 Ga0495654_0004191
555 Ga0495609_0000070
556 Ga0495609_0000104
557 Ga0495609_0007342
558 Ga0495609_0100238
559 Ga0495597_0000002
560 Ga0495597_0131633
561 Ga0495597_0133199
562 Ga0495622_0003225
563 Ga0495633_0014153
564 Ga0495668_0041137
565 Ga0495611_0000863
566 Ga0495611_0003655
567 Ga0495625_0001167
568 Ga0495661_0000100
569 Ga0495661_0000156
570 Ga0495661_0000194
571 Ga0495661_0001273
572 Ga0495661_0004179
573 Ga0495661_0016051
574 Ga0495661_0223627
575 Ga0495671_0008780
576 Ga0495671_0119534
577 Ga0495649_0002230
578 Ga0495649_0024941
579 Ga0495649_0167411
580 Ga0495589_0000297
581 Ga0495660_0000865
582 Ga0495660_0002955
583 Ga0495660_0003496
584 Ga0495660_0005744
585 Ga0495660_0006291
586 Ga0495660_0032754
587 Ga0495660_0121584
588 Ga0495660_0235471
589 Ga0495672_0006423
590 Ga0495672_0006653
591 Ga0495672_0027577
592 Ga0495672_0030529
593 Ga0495672_0099462
594 Ga0495672_0118294
595 Ga0495676_0000043
596 Ga0495683_0096478
597 Ga0495679_000049
598 Ga0495679_000247
599 Ga0495679_005347
600 Ga0495679_010491
601 Ga0495673_0000292
602 Ga0495673_0000447
603 Ga0495673_0000561
604 Ga0495673_0002256
605 Ga0495673_0004590
606 Ga0495673_0015373
607 Ga0495673_0030075
608 Ga0495673_0062414
609 Ga0495673_0072139
610 Ga0495673_0223087
611 Ga0495681_0005452
612 Ga0495681_0007287
613 Ga0495681_0010790
614 Ga0495681_0042261
615 Ga0495681_0047520
616 Ga0495686_0010404
617 Ga0495686_0133087
618 Ga0495626_0000093
619 Ga0496102_0137466
620 Ga0496103_0187748
621 Ga0496110_0038153
622 Ga0496110_0711610
623 Ga0496111_0176993
624 Ga0496116_0215290
625 Ga0496117_0000359
626 Ga0496117_0252141
627 Ga0496118_0058809
628 Ga0496118_0061104
629 Ga0496118_0093438
630 Ga0496118_0129956
631 Ga0496119_0005330
632 Ga0496120_0001278
633 Ga0496121_0016196
634 Ga0496122_0002215
635 Ga0496122_0014762
636 Ga0496122_0060483
637 Ga0496122_0112513
638 Ga0496123_0000513
639 Ga0496123_0012552
640 Ga0496123_0013173
641 Ga0496123_0014177
642 Ga0496123_0483430
643 Ga0496124_0000309
644 Ga0496124_0000383
645 Ga0496124_0000714
646 Ga0496124_0007907
647 Ga0496125_0000459
648 Ga0496125_0001073
649 Ga0496126_0039551
650 Ga0495678_000043
651 Ga0495678_006360
652 Ga0495678_007927
653 Ga0495678_008563
654 Ga0495678_016577
655 Ga0495678_031975
656 Ga0495682_0000355
657 Ga0495682_0179345
658 Ga0500650_0166948
659 Ga0500573_0016276
660 Ga0500634_0001971
661 Ga0500637_0280762
662 2599329538
663 2599397525
664 2599451970
665 2599513648
666 2599521953
667 2599616844
668 2599892325
669 2599971471
670 2599995359
671 2600032760
672 2600045048
673 2600058556
674 2600066769
675 2600358197
676 2601628062
677 2671127988
678 2738688345
679 2738885382
680 2739264076
681 2881415597
682 2945963090
683 2946010477
684 8055821520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

46

135

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

13

129

0.78

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

49

131

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ib0-assembly1.cif.gz_A pa4534: acetyl coa complex 0.9651 11 139
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9067 11 137
5ib0-assembly1.cif.gz_A pa4534: acetyl coa complex 0.9037 11 139
2pdo-assembly1.cif.gz_A crystal structure of the putative acetyltransferase of gnat family from shigella flexneri 0.9018 10 137
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9002 11 137
ID Description Score Start End Superfamily
4ubrB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9677 11 139 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9144 57 136 3.40.630.30
4ubrB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.906 11 139 3.40.630.30
4qvtA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8964 11 132 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.889 59 107 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A661W6C7-F1-model_v4 GNAT family N-acetyltransferase 0.9909 10 118 GO:0016747
AF-A0A2M8S879-F1-model_v4 GNAT family N-acetyltransferase 0.9878 9 138 GO:0016747
AF-A0A522KRT1-F1-model_v4 deleted 0.9804 15 138
AF-A0A6I1K3N9-F1-model_v4 N-acetyltransferase GCN5 0.9801 9 140 GO:0016747
AF-B2A0S9-F1-model_v4 GCN5-related N-acetyltransferase 0.9793 10 138 GO:0016747

Map