F415137

General Info

Members Datasets Scaffolds Average Seq Length
342 224 323 283

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10017171|Ga0105247_100171715
Length 306
Sequence MLCGPEIFSGSIGLLLKTNSGRTFMRLLAYRKDGKMGLAIATGADEWRGAFEGDAAYPGSIAELLEKGDFSAASALQNVAVIDLDDVEVLPPLSNPPKIICLGLNYSEHAAESGFEPPPFPTIFGRFNSSLVGHGQPVLKPKVSDDFDYEGELVAIIGKKGRHISKADALSHVAGYSVFNDVSVRDYQLMTPQWTVGKNFDATGAFGPAFVTADELPAGASGLKLETRLNGLVVQSDTTDHMIFDVATTIELLSRGITLEVGDVLVMGTPSGIGLARDPKLYMKQGDVIEVEIEKVGLLRNPVVNE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
4 2643221607 Rhizobium sp. Root73 Isolate Unclassified
5 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
6 2738541277 Variovorax sp. GV051 Isolate Unclassified
7 2738541307 Variovorax sp. GV008 Isolate Unclassified
8 2738543019 Variovorax sp. GV040 Isolate Unclassified
9 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
10 2818991446 Variovorax sp. 1180 Isolate Unclassified
11 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
12 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
13 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
14 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
15 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
16 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
17 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
18 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
21 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
207 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
208 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
209 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
210 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
211 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
212 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
215 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
222 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.69
Metatranscriptomes 1.75
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.45
Nodule 1.75
Rhizoplane 4.39
Rhizosphere 70.18
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1673370 2162886007 Bacteria 4535
2 JGI24752J21851_1000059 3300001976 Bacteria 13802
3 JGI24752J21851_1000894 3300001976 Bacteria 4054
4 JGI24750J21931_1000105 3300002070 Bacteria 13123
5 JGI24748J21848_1000043 3300002074 Bacteria 61255
6 JGI24034J26672_10000031 3300002239 Bacteria 93812
7 JGI24034J26672_10000059 3300002239 Bacteria 41224
8 JGI25151J46595_10049525 3300003187 Bacteria 1440
9 JGI25153J46596_10000136 3300003215 Bacteria 78754
10 Ga0055532_1000095 3300003758 Bacteria 99346
11 Ga0065704_10073021 3300005289 Bacteria 7678
12 Ga0065707_10121008 3300005295 Bacteria 2120
13 Ga0070690_100000010 3300005330 Bacteria 103492
14 Ga0070670_100000218 3300005331 Bacteria 53025
15 Ga0068869_100019517 3300005334 Bacteria 4634
16 Ga0070666_10000006 3300005335 Bacteria 319173
17 Ga0070668_100009770 3300005347 Bacteria 7112
18 Ga0070668_100082007 3300005347 Bacteria 2529
19 Ga0070669_100000326 3300005353 Bacteria 37229
20 Ga0070669_100019677 3300005353 Bacteria 4822
21 Ga0070669_100258473 3300005353 Bacteria 1389
22 Ga0070675_100213121 3300005354 Bacteria 1680
23 Ga0070671_100029746 3300005355 Bacteria 4505
24 Ga0070671_100180246 3300005355 Bacteria 1788
25 Ga0070671_100426831 3300005355 Bacteria 1136
26 Ga0070674_100059083 3300005356 Bacteria 2668
27 Ga0070674_100310447 3300005356 Bacteria 1261
28 Ga0070688_100020688 3300005365 Bacteria 3830
29 Ga0070667_100000039 3300005367 Bacteria 170228
30 Ga0070667_100012822 3300005367 Bacteria 6927
31 Ga0070709_10025971 3300005434 Unclassified 3465
32 Ga0070713_100553212 3300005436 Bacteria 1090
33 Ga0070710_10013104 3300005437 Bacteria 4139
34 Ga0070710_10045438 3300005437 Unclassified 2441
35 Ga0070711_100005457 3300005439 Bacteria 7606
36 Ga0070711_100013513 3300005439 Bacteria 5126
37 Ga0070711_100059796 3300005439 Bacteria 2647
38 Ga0070681_10002532 3300005458 Bacteria 16751
39 Ga0068867_100116017 3300005459 Bacteria 2063
40 Ga0070685_10000331 3300005466 Bacteria 29097
41 Ga0070706_100033925 3300005467 Bacteria 4712
42 Ga0070679_100447934 3300005530 Bacteria 1236
43 Ga0070686_100000042 3300005544 Bacteria 103828
44 Ga0070665_100000019 3300005548 Bacteria 413972
45 Ga0070665_100088988 3300005548 Bacteria 3093
46 Ga0070704_100401948 3300005549 Bacteria 1169
47 Ga0068855_100017643 3300005563 Bacteria 8583
48 Ga0068859_100030881 3300005617 Bacteria 5376
49 Ga0068859_100084872 3300005617 Bacteria 3211
50 Ga0068864_100000016 3300005618 Bacteria 292454
51 Ga0068864_100057400 3300005618 Bacteria 3363
52 Ga0068861_100000707 3300005719 Bacteria 19902
53 Ga0068861_100012821 3300005719 Bacteria 5853
54 Ga0068863_100000033 3300005841 Bacteria 170238
55 Ga0068863_100000113 3300005841 Bacteria 85761
56 Ga0068863_100024416 3300005841 Bacteria 5765
57 Ga0068863_100125833 3300005841 Bacteria 2445
58 Ga0068860_100000014 3300005843 Bacteria 319437
59 Ga0068860_100015747 3300005843 Bacteria 7382
60 Ga0068860_100331096 3300005843 Bacteria 1496
61 Ga0068862_100000040 3300005844 Bacteria 167832
62 Ga0068862_100001998 3300005844 Bacteria 18487
63 Ga0068862_100002032 3300005844 Bacteria 18326
64 Ga0068862_100003549 3300005844 Bacteria 13363
65 Ga0070712_100059275 3300006175 Bacteria 2695
66 Ga0070712_100279639 3300006175 Bacteria 1344
67 Ga0075366_10112346 3300006195 Bacteria 1639
68 Ga0075366_10253178 3300006195 Bacteria 1074
69 Ga0097621_100032618 3300006237 Bacteria 4142
70 Ga0097621_100287439 3300006237 Bacteria 1449
71 Ga0068871_100008754 3300006358 Bacteria 7285
72 Ga0068871_100616616 3300006358 Bacteria 988
73 Ga0075428_100002601 3300006844 Bacteria 19625
74 Ga0075431_100008282 3300006847 Bacteria 10394
75 Ga0075434_100024826 3300006871 Bacteria 5860
76 Ga0075434_100058492 3300006871 Bacteria 3831
77 Ga0075429_100010088 3300006880 Bacteria 8184
78 Ga0097620_100030883 3300006931 Bacteria 5376
79 Ga0097620_100084877 3300006931 Bacteria 3211
80 Ga0075435_100057735 3300007076 Bacteria 3140
81 Ga0075435_100345576 3300007076 Bacteria 1275
82 Ga0099794_10013006 3300007265 Bacteria 3611
83 Ga0099794_10057094 3300007265 Bacteria 1891
84 Ga0099795_10088468 3300007788 Unclassified 1197
85 Ga0105251_10000974 3300009011 Bacteria 25401
86 Ga0105240_10064355 3300009093 Bacteria 4557
87 Ga0111539_10025594 3300009094 Bacteria 7233
88 Ga0111539_10043042 3300009094 Bacteria 5417
89 Ga0105247_10017171 3300009101 Bacteria 4344
90 Ga0114129_10029101 3300009147 Bacteria 7825
91 Ga0105248_10000021 3300009177 Bacteria 276159
92 Ga0105248_10041943 3300009177 Bacteria 5131
93 Ga0105248_10330554 3300009177 Bacteria 1717
94 Ga0105249_10000035 3300009553 Bacteria 201325
95 Ga0105249_10000128 3300009553 Bacteria 101030
96 Ga0105249_10108580 3300009553 Bacteria 2620
97 Ga0105246_10331080 3300011119 Bacteria 1241
98 Ga0157370_10017192 3300013104 Bacteria 7300
99 Ga0157370_10271350 3300013104 Bacteria 1567
100 Ga0157370_10281293 3300013104 Bacteria 1537
101 Ga0157370_10325997 3300013104 Bacteria 1416
102 Ga0157369_10249331 3300013105 Bacteria 1853
103 Ga0157374_10225509 3300013296 Bacteria 1840
104 Ga0157374_10289534 3300013296 Bacteria 1618
105 Ga0163162_10026035 3300013306 Bacteria 5780
106 Ga0163162_10033808 3300013306 Bacteria 5083
107 Ga0163162_10034618 3300013306 Bacteria 5027
108 Ga0163162_10143444 3300013306 Bacteria 2502
109 Ga0157375_10207381 3300013308 Bacteria 2117
110 Ga0157375_10790879 3300013308 Bacteria 1098
111 Ga0163163_10011297 3300014325 Bacteria 8094
112 Ga0157380_10003582 3300014326 Bacteria 10684
113 Ga0182008_10003565 3300014497 Bacteria 9336
114 Ga0157379_10026684 3300014968 Bacteria 5142
115 Ga0157379_10029509 3300014968 Bacteria 4876
116 Ga0157379_10206488 3300014968 Bacteria 1777
117 Ga0157379_10645042 3300014968 Bacteria 991
118 Ga0157376_10009778 3300014969 Bacteria 6986
119 Ga0157376_10044721 3300014969 Bacteria 3641
120 Ga0157376_10264288 3300014969 Bacteria 1614
121 Ga0182007_10000225 3300015262 Bacteria 37944
122 Ga0182005_1012374 3300015265 Bacteria 2412
123 Ga0163161_10000366 3300017792 Bacteria 37791
124 Ga0163161_10016265 3300017792 Bacteria 5192
125 Ga0163161_10031644 3300017792 Bacteria 3771
126 Ga0209566_100207 3300025225 Bacteria 60569
127 Ga0209674_100653 3300025226 Bacteria 12473
128 Ga0209147_100021 3300025229 Bacteria 464719
129 Ga0209675_1011623 3300025291 Bacteria 2906
130 Ga0209025_1000600 3300025294 Bacteria 64945
131 Ga0209758_1000015 3300025297 Bacteria 851943
132 Ga0209758_1000195 3300025297 Bacteria 133982
133 Ga0209050_1024269 3300025298 Bacteria 2104
134 Ga0207713_1001413 3300025735 Bacteria 19329
135 Ga0207692_10009088 3300025898 Bacteria 4136
136 Ga0207710_10035153 3300025900 Bacteria 2204
137 Ga0207680_10000011 3300025903 Bacteria 391225
138 Ga0207699_10007566 3300025906 Bacteria 5317
139 Ga0207707_10182194 3300025912 Bacteria 1833
140 Ga0207695_10004022 3300025913 Bacteria 20238
141 Ga0207695_10311404 3300025913 Bacteria 1464
142 Ga0207693_10008378 3300025915 Bacteria 8459
143 Ga0207693_10053395 3300025915 Bacteria 3171
144 Ga0207693_10248867 3300025915 Bacteria 1395
145 Ga0207663_10003471 3300025916 Bacteria 7711
146 Ga0207663_10014887 3300025916 Unclassified 4274
147 Ga0207663_10206224 3300025916 Bacteria 1421
148 Ga0207681_10000587 3300025923 Bacteria 24785
149 Ga0207681_10116069 3300025923 Bacteria 1955
150 Ga0207681_10122574 3300025923 Bacteria 1909
151 Ga0207650_10000279 3300025925 Bacteria 53043
152 Ga0207644_10210801 3300025931 Bacteria 1536
153 Ga0207670_10001578 3300025936 Bacteria 11929
154 Ga0207704_10248388 3300025938 Bacteria 1334
155 Ga0207711_10000025 3300025941 Bacteria 289972
156 Ga0207711_10028336 3300025941 Bacteria 4712
157 Ga0207667_10038636 3300025949 Bacteria 5095
158 Ga0207651_10282025 3300025960 Bacteria 1374
159 Ga0207712_10000013 3300025961 Bacteria 391208
160 Ga0207712_10000126 3300025961 Bacteria 81637
161 Ga0207712_10003517 3300025961 Bacteria 9890
162 Ga0207668_10003986 3300025972 Bacteria 8699
163 Ga0207668_10024025 3300025972 Bacteria 3928
164 Ga0207668_10033589 3300025972 Bacteria 3399
165 Ga0207658_10000369 3300025986 Bacteria 44354
166 Ga0207658_10001521 3300025986 Bacteria 18015
167 Ga0207677_10313452 3300026023 Bacteria 1301
168 Ga0207703_10001418 3300026035 Bacteria 21847
169 Ga0207703_10064222 3300026035 Bacteria 3012
170 Ga0207641_10000002 3300026088 Bacteria 981004
171 Ga0207641_10000161 3300026088 Bacteria 94555
172 Ga0207641_10006658 3300026088 Bacteria 9700
173 Ga0207641_10440287 3300026088 Bacteria 1258
174 Ga0207648_10110094 3300026089 Bacteria 2418
175 Ga0207648_10394379 3300026089 Bacteria 1253
176 Ga0207676_10000005 3300026095 Bacteria 698744
177 Ga0207676_10000543 3300026095 Bacteria 31456
178 Ga0207676_10544560 3300026095 Bacteria 1108
179 Ga0207675_100000269 3300026118 Bacteria 49352
180 Ga0207675_100005438 3300026118 Bacteria 12208
181 Ga0207683_10046774 3300026121 Bacteria 3788
182 Ga0207683_10143533 3300026121 Bacteria 2152
183 Ga0207428_10011286 3300027907 Bacteria 7912
184 Ga0207428_10202967 3300027907 Bacteria 1491
185 Ga0265354_1001156 3300028016 Unclassified 4027
186 Ga0268266_10000025 3300028379 Bacteria 477143
187 Ga0268266_10183523 3300028379 Bacteria 1906
188 Ga0268265_10000003 3300028380 Bacteria 949201
189 Ga0268265_10000857 3300028380 Bacteria 28514
190 Ga0268265_10004898 3300028380 Bacteria 9217
191 Ga0268265_10022057 3300028380 Bacteria 4470
192 Ga0268264_10000037 3300028381 Bacteria 391116
193 Ga0268264_10088783 3300028381 Bacteria 2661
194 Ga0265334_10017010 3300028573 Bacteria 3008
195 Ga0307517_10000100 3300028786 Bacteria 125762
196 Ga0307515_10000521 3300028794 Bacteria 91558
197 Ga0307515_10001079 3300028794 Bacteria 62391
198 Ga0265338_10017628 3300028800 Bacteria 7684
199 Ga0265762_1000497 3300030760 Bacteria 6843
200 Ga0265762_1001500 3300030760 Bacteria 4239
201 Ga0265762_1030122 3300030760 Bacteria 1028
202 Ga0265770_1004224 3300030878 Bacteria 1957
203 Ga0265770_1023584 3300030878 Bacteria 992
204 Ga0265771_1001650 3300031010 Bacteria 1093
205 Ga0265340_10095124 3300031247 Bacteria 1389
206 Ga0265327_10043193 3300031251 Bacteria 2414
207 Ga0307509_10000003 3300031507 Bacteria 577578
208 Ga0307509_10178859 3300031507 Bacteria 1990
209 Ga0307508_10127751 3300031616 Bacteria 2145
210 Ga0307516_10000049 3300031730 Bacteria 129849
211 Ga0307510_10000003 3300033180 Bacteria 756654
212 Ga0307510_10000688 3300033180 Bacteria 34580
213 Ga0373936_0017515 3300035113 Bacteria 2760
214 Ga0395899_0083988 3300037312 Bacteria 2315
215 Ga0395898_0123460 3300037466 Bacteria 2481
216 Ga0395905_0001574 3300037471 Bacteria 27238
217 Ga0395901_0072002 3300038443 Bacteria 3602
218 Ga0436363_0362526 3300039450 Bacteria 1179
219 Ga0495627_007531 3300046453 Bacteria 4162
220 Ga0495627_034256 3300046453 Bacteria 1587
221 Ga0495638_0000019 3300046460 Bacteria 384671
222 Ga0495638_0023627 3300046460 Bacteria 4017
223 Ga0495651_0164543 3300046462 Bacteria 1586
224 Ga0495651_0184592 3300046462 Bacteria 1473
225 Ga0495580_0086406 3300046472 Bacteria 2185
226 Ga0495606_0092140 3300046507 Bacteria 1862
227 Ga0495610_0046625 3300046512 Bacteria 2137
228 Ga0495616_0001139 3300046513 Bacteria 18805
229 Ga0495620_0003096 3300046515 Bacteria 9554
230 Ga0495620_0023587 3300046515 Bacteria 2939
231 Ga0495628_0219103 3300046516 Bacteria 1430
232 Ga0495631_0000135 3300046518 Bacteria 50021
233 Ga0495637_0012441 3300046520 Bacteria 4068
234 Ga0495637_0030599 3300046520 Bacteria 2387
235 Ga0495654_0011707 3300046530 Bacteria 4740
236 Ga0495640_0295811 3300046533 Bacteria 1006
237 Ga0495621_0004099 3300046539 Bacteria 4060
238 Ga0495645_0370152 3300046543 Bacteria 919
239 Ga0495633_0051574 3300046558 Bacteria 1938
240 Ga0495656_0000615 3300046615 Bacteria 11375
241 Ga0495668_0087427 3300046616 Bacteria 1709
242 Ga0495625_0039409 3300046660 Bacteria 3450
243 Ga0495588_0052588 3300046674 Bacteria 2100
244 Ga0495588_0225800 3300046674 Bacteria 988
245 Ga0495658_0132467 3300046683 Bacteria 1519
246 Ga0495671_0001335 3300046692 Bacteria 16734
247 Ga0495581_0111920 3300047315 Bacteria 1588
248 Ga0495672_0028603 3300047320 Bacteria 3523
249 Ga0495676_0027733 3300047321 Bacteria 4852
250 Ga0495677_0005711 3300047445 Bacteria 4715
251 Ga0495615_0014165 3300048090 Bacteria 1680
252 Ga0496100_0004480 3300048903 Bacteria 7412
253 Ga0496101_0168452 3300048904 Bacteria 1682
254 Ga0496101_0170791 3300048904 Bacteria 1671
255 Ga0496102_0025829 3300048905 Bacteria 5231
256 Ga0496103_0002746 3300048906 Bacteria 10980
257 Ga0496103_0045806 3300048906 Bacteria 2699
258 Ga0496104_0004136 3300048907 Bacteria 12598
259 Ga0496104_0019174 3300048907 Bacteria 6254
260 Ga0496104_0143469 3300048907 Bacteria 2294
261 Ga0496105_0031894 3300048908 Bacteria 4321
262 Ga0496106_0041352 3300048909 Bacteria 3454
263 Ga0496110_0077644 3300048913 Bacteria 2954
264 Ga0496111_0092967 3300048914 Bacteria 2211
265 Ga0496115_0026681 3300048918 Bacteria 4511
266 Ga0496116_0035515 3300048919 Bacteria 3500
267 Ga0496116_0167519 3300048919 Bacteria 1195
268 Ga0496117_0008968 3300048920 Bacteria 9414
269 Ga0496117_0013687 3300048920 Bacteria 7054
270 Ga0496117_0040676 3300048920 Bacteria 3415
271 Ga0496118_0000761 3300048921 Bacteria 51859
272 Ga0496118_0002765 3300048921 Bacteria 22997
273 Ga0496118_0021168 3300048921 Bacteria 5734
274 Ga0496119_0107419 3300048922 Bacteria 1556
275 Ga0496121_0022533 3300048924 Bacteria 6106
276 Ga0496122_0094094 3300048925 Bacteria 2030
277 Ga0496122_0129714 3300048925 Bacteria 1605
278 Ga0496123_0037846 3300048926 Bacteria 3401
279 Ga0496123_0082978 3300048926 Bacteria 1940
280 Ga0496124_0026920 3300048927 Bacteria 5176
281 Ga0496124_0052903 3300048927 Bacteria 3447
282 Ga0501281_00001 3300049777 Bacteria 41708
283 nmdc:mga0k408_104440_c1 3300050493 Bacteria 1672
284 nmdc:mga0k408_75773_c1 3300050493 Bacteria 1966
285 nmdc:mga05p37_10022_c1 3300050507 Bacteria 11250
286 nmdc:mga09592_5857_c1 3300050508 Bacteria 10027
287 nmdc:mga06r32_6469_c1 3300050510 Bacteria 10525
288 nmdc:mga08y16_127849_c1 3300050511 Bacteria 2643
289 nmdc:mga08y16_7065_c1 3300050511 Bacteria 11785
290 nmdc:mga08x19_668_c1 3300050514 Bacteria 22042
291 nmdc:mga0a205_317319_c1 3300050515 Bacteria 1430
292 nmdc:mga0a205_420018_c1 3300050515 Bacteria 1199
293 Ga0500610_0004206 3300053079 Bacteria 5666
294 Ga0500610_0010003 3300053079 Bacteria 4244
295 Ga0500643_001365 3300053087 Bacteria 14159
296 Ga0500643_002761 3300053087 Bacteria 8787
297 Ga0500643_003070 3300053087 Bacteria 8212
298 Ga0500651_0000042 3300053093 Bacteria 87895
299 Ga0500566_0099836 3300053094 Bacteria 1593
300 Ga0500571_000058 3300053110 Bacteria 33693
301 Ga0500593_000377 3300053117 Bacteria 17807
302 Ga0500594_0078624 3300053118 Bacteria 982
303 Ga0500597_047511 3300053120 Bacteria 1821
304 Ga0500607_008046 3300053121 Bacteria 6445
305 Ga0500626_057362 3300053128 Bacteria 1745
306 Ga0500655_000263 3300053133 Bacteria 12276
307 Ga0500658_0000157 3300053134 Bacteria 32831
308 Ga0500658_0003717 3300053134 Bacteria 5746
309 Ga0500658_0003727 3300053134 Bacteria 5741
310 Ga0500561_0008495 3300053137 Bacteria 2048
311 Ga0500564_001016 3300053138 Bacteria 9181
312 Ga0500568_0000841 3300053139 Bacteria 21571
313 Ga0500568_0002574 3300053139 Bacteria 10560
314 Ga0500616_0000342 3300053153 Bacteria 66451
315 Ga0500627_0000649 3300053158 Bacteria 9245
316 Ga0500634_0018914 3300053161 Bacteria 3705
317 Ga0500634_0030672 3300053161 Bacteria 2930
318 Ga0500636_0055880 3300053177 Bacteria 2313
319 Ga0500637_0021721 3300053178 Bacteria 3489
320 Ga0500625_025988 3300053729 Bacteria 2772
321 Ga0500645_007313 3300053730 Bacteria 3859
322 Ga0500645_009983 3300053730 Bacteria 3163
323 Ga0500645_062210 3300053730 Bacteria 1078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026023 Ga0207677_10313452 Ga0207677_103134522 237
2 3300026089 Ga0207648_10394379 Ga0207648_103943793 237
3 3300053128 Ga0500626_057362 Ga0500626_057362_1013_1735 237
4 3300053730 Ga0500645_009983 Ga0500645_009983_287_1063 246
5 3300005434 Ga0070709_10025971 Ga0070709_100259712 260
6 3300005437 Ga0070710_10045438 Ga0070710_100454382 260
7 3300025915 Ga0207693_10248867 Ga0207693_102488671 260
8 3300025916 Ga0207663_10014887 Ga0207663_100148872 260
9 3300053087 Ga0500643_002761 Ga0500643_002761_2442_3239 265
10 3300013104 Ga0157370_10271350 Ga0157370_102713502 266
11 3300025913 Ga0207695_10004022 Ga0207695_100040221 266
12 3300025949 Ga0207667_10038636 Ga0207667_100386365 266
13 3300005355 Ga0070671_100426831 Ga0070671_1004268311 270
14 3300006237 Ga0097621_100032618 Ga0097621_1000326183 270
15 3300006358 Ga0068871_100008754 Ga0068871_1000087545 270
16 3300014968 Ga0157379_10206488 Ga0157379_102064882 270
17 3300033180 Ga0307510_10000688 Ga0307510_1000068818 270
18 iso_pu_bacteria 2643221607 2644048781 270
19 iso_pu_bacteria 2643221686 2644481582 270
20 3300003215 JGI25153J46596_10000136 JGI25153J46596_1000013616 273
21 3300025297 Ga0209758_1000015 Ga0209758_1000015454 273
22 3300028786 Ga0307517_10000100 Ga0307517_1000010016 273
23 iso_pu_bacteria 2738541277 2738717506 275
24 iso_pu_bacteria 2738541307 2738879109 275
25 iso_pu_bacteria 2738543019 2739278192 275
26 iso_pu_bacteria 2818991446 2819600206 275
27 iso_pu_bacteria 2904541872 2904543602 275
28 iso_pu_bacteria 2928084124 2928088276 275
29 iso_pu_bacteria 2929160207 2929162847 275
30 3300031616 Ga0307508_10127751 Ga0307508_101277513 276
31 3300053178 Ga0500637_0021721 Ga0500637_0021721_1467_2318 276
32 3300047445 Ga0495677_0005711 Ga0495677_0005711_527_1369 277
33 3300053087 Ga0500643_001365 Ga0500643_001365_1204_2046 277
34 iso_pu_bacteria 2513237094 2513639868 277
35 iso_pu_bacteria 2808606387 2808990299 277
36 iso_pu_bacteria 2888350351 2888352474 277
37 iso_pu_bacteria 2922130491 2922138687 277
38 iso_pu_bacteria 2928157003 2928161991 277
39 iso_pu_bacteria 2977971508 2977977595 277
40 iso_pu_bacteria 2979742915 2979750050 277
41 3300005530 Ga0070679_100447934 Ga0070679_1004479341 278
42 iso_pu_bacteria 2513237094 2513639914 278
43 iso_pu_bacteria 2599185239 2599739125 278
44 iso_pu_bacteria 8021120328 8021125885 278
45 3300003187 JGI25151J46595_10049525 JGI25151J46595_100495252 279
46 3300005353 Ga0070669_100258473 Ga0070669_1002584732 279
47 3300005354 Ga0070675_100213121 Ga0070675_1002131212 279
48 3300005356 Ga0070674_100059083 Ga0070674_1000590832 279
49 3300005356 Ga0070674_100310447 Ga0070674_1003104472 279
50 3300005458 Ga0070681_10002532 Ga0070681_100025326 279
51 3300005459 Ga0068867_100116017 Ga0068867_1001160172 279
52 3300005548 Ga0070665_100088988 Ga0070665_1000889883 279
53 3300005563 Ga0068855_100017643 Ga0068855_1000176439 279
54 3300005841 Ga0068863_100125833 Ga0068863_1001258333 279
55 3300006195 Ga0075366_10253178 Ga0075366_102531782 279
56 3300009093 Ga0105240_10064355 Ga0105240_100643553 279
57 3300013104 Ga0157370_10281293 Ga0157370_102812932 279
58 3300013104 Ga0157370_10325997 Ga0157370_103259972 279
59 3300013308 Ga0157375_10790879 Ga0157375_107908792 279
60 3300014497 Ga0182008_10003565 Ga0182008_100035651 279
61 3300015262 Ga0182007_10000225 Ga0182007_100002253 279
62 3300015265 Ga0182005_1012374 Ga0182005_10123743 279
63 3300017792 Ga0163161_10016265 Ga0163161_100162653 279
64 3300017792 Ga0163161_10031644 Ga0163161_100316442 279
65 3300025291 Ga0209675_1011623 Ga0209675_10116232 279
66 3300025294 Ga0209025_1000600 Ga0209025_100060044 279
67 3300025298 Ga0209050_1024269 Ga0209050_10242692 279
68 3300025912 Ga0207707_10182194 Ga0207707_101821941 279
69 3300025913 Ga0207695_10311404 Ga0207695_103114041 279
70 3300025923 Ga0207681_10122574 Ga0207681_101225742 279
71 3300025960 Ga0207651_10282025 Ga0207651_102820252 279
72 3300026088 Ga0207641_10440287 Ga0207641_104402872 279
73 3300026089 Ga0207648_10110094 Ga0207648_101100942 279
74 3300026121 Ga0207683_10046774 Ga0207683_100467743 279
75 3300026121 Ga0207683_10143533 Ga0207683_101435331 279
76 3300028379 Ga0268266_10183523 Ga0268266_101835232 279
77 3300028794 Ga0307515_10000521 Ga0307515_100005217 279
78 3300028794 Ga0307515_10001079 Ga0307515_100010792 279
79 3300031251 Ga0265327_10043193 Ga0265327_100431933 279
80 3300037471 Ga0395905_0001574 Ga0395905_0001574_10199_11053 279
81 3300039450 Ga0436363_0362526 Ga0436363_0362526_276_1136 279
82 3300046453 Ga0495627_007531 Ga0495627_007531_614_1468 279
83 3300046453 Ga0495627_034256 Ga0495627_034256_700_1554 279
84 3300046460 Ga0495638_0023627 Ga0495638_0023627_2013_2867 279
85 3300046462 Ga0495651_0164543 Ga0495651_0164543_73_927 279
86 3300046462 Ga0495651_0184592 Ga0495651_0184592_601_1455 279
87 3300046507 Ga0495606_0092140 Ga0495606_0092140_103_957 279
88 3300046512 Ga0495610_0046625 Ga0495610_0046625_134_988 279
89 3300046513 Ga0495616_0001139 Ga0495616_0001139_9320_10174 279
90 3300046515 Ga0495620_0003096 Ga0495620_0003096_2990_3841 279
91 3300046515 Ga0495620_0023587 Ga0495620_0023587_1815_2669 279
92 3300046516 Ga0495628_0219103 Ga0495628_0219103_241_1095 279
93 3300046518 Ga0495631_0000135 Ga0495631_0000135_13805_14659 279
94 3300046520 Ga0495637_0012441 Ga0495637_0012441_2883_3737 279
95 3300046520 Ga0495637_0030599 Ga0495637_0030599_613_1467 279
96 3300046530 Ga0495654_0011707 Ga0495654_0011707_881_1735 279
97 3300046533 Ga0495640_0295811 Ga0495640_0295811_59_913 279
98 3300046539 Ga0495621_0004099 Ga0495621_0004099_498_1352 279
99 3300046543 Ga0495645_0370152 Ga0495645_0370152_31_885 279
100 3300046558 Ga0495633_0051574 Ga0495633_0051574_331_1185 279
101 3300046615 Ga0495656_0000615 Ga0495656_0000615_465_1319 279
102 3300046616 Ga0495668_0087427 Ga0495668_0087427_104_958 279
103 3300046660 Ga0495625_0039409 Ga0495625_0039409_294_1148 279
104 3300046674 Ga0495588_0052588 Ga0495588_0052588_1154_2008 279
105 3300046674 Ga0495588_0225800 Ga0495588_0225800_45_899 279
106 3300046683 Ga0495658_0132467 Ga0495658_0132467_10_864 279
107 3300046692 Ga0495671_0001335 Ga0495671_0001335_9799_10653 279
108 3300047315 Ga0495581_0111920 Ga0495581_0111920_486_1340 279
109 3300047321 Ga0495676_0027733 Ga0495676_0027733_2794_3648 279
110 3300048090 Ga0495615_0014165 Ga0495615_0014165_562_1416 279
111 3300048903 Ga0496100_0004480 Ga0496100_0004480_2345_3199 279
112 3300048904 Ga0496101_0170791 Ga0496101_0170791_305_1159 279
113 3300048906 Ga0496103_0045806 Ga0496103_0045806_1299_2153 279
114 3300048907 Ga0496104_0004136 Ga0496104_0004136_4148_5002 279
115 3300048908 Ga0496105_0031894 Ga0496105_0031894_133_987 279
116 3300048913 Ga0496110_0077644 Ga0496110_0077644_59_913 279
117 3300048914 Ga0496111_0092967 Ga0496111_0092967_1063_1917 279
118 3300048919 Ga0496116_0167519 Ga0496116_0167519_184_1038 279
119 3300048920 Ga0496117_0013687 Ga0496117_0013687_1232_2086 279
120 3300048922 Ga0496119_0107419 Ga0496119_0107419_179_1033 279
121 3300048924 Ga0496121_0022533 Ga0496121_0022533_4336_5190 279
122 3300048925 Ga0496122_0094094 Ga0496122_0094094_24_878 279
123 3300048926 Ga0496123_0037846 Ga0496123_0037846_601_1455 279
124 3300048927 Ga0496124_0052903 Ga0496124_0052903_454_1308 279
125 3300050493 nmdc:mga0k408_75773_c1 nmdc:mga0k408_75773_c1_76_930 279
126 3300053079 Ga0500610_0004206 Ga0500610_0004206_2064_2918 279
127 3300053079 Ga0500610_0010003 Ga0500610_0010003_1324_2178 279
128 3300053087 Ga0500643_003070 Ga0500643_003070_4145_4999 279
129 3300053093 Ga0500651_0000042 Ga0500651_0000042_50698_51552 279
130 3300053094 Ga0500566_0099836 Ga0500566_0099836_507_1361 279
131 3300053110 Ga0500571_000058 Ga0500571_000058_19052_19906 279
132 3300053117 Ga0500593_000377 Ga0500593_000377_10386_11240 279
133 3300053120 Ga0500597_047511 Ga0500597_047511_780_1634 279
134 3300053121 Ga0500607_008046 Ga0500607_008046_531_1385 279
135 3300053133 Ga0500655_000263 Ga0500655_000263_5316_6170 279
136 3300053134 Ga0500658_0003717 Ga0500658_0003717_424_1278 279
137 3300053134 Ga0500658_0003727 Ga0500658_0003727_407_1261 279
138 3300053137 Ga0500561_0008495 Ga0500561_0008495_854_1708 279
139 3300053138 Ga0500564_001016 Ga0500564_001016_1091_1945 279
140 3300053139 Ga0500568_0000841 Ga0500568_0000841_11380_12234 279
141 3300053158 Ga0500627_0000649 Ga0500627_0000649_823_1677 279
142 3300053161 Ga0500634_0018914 Ga0500634_0018914_2255_3109 279
143 3300053161 Ga0500634_0030672 Ga0500634_0030672_1968_2822 279
144 3300053177 Ga0500636_0055880 Ga0500636_0055880_149_1003 279
145 3300053729 Ga0500625_025988 Ga0500625_025988_593_1447 279
146 3300028800 Ga0265338_10017628 Ga0265338_100176283 280
147 3300031247 Ga0265340_10095124 Ga0265340_100951242 280
148 3300037312 Ga0395899_0083988 Ga0395899_0083988_1129_1989 280
149 3300037466 Ga0395898_0123460 Ga0395898_0123460_517_1377 280
150 3300038443 Ga0395901_0072002 Ga0395901_0072002_1516_2376 280
151 3300005334 Ga0068869_100019517 Ga0068869_1000195172 281
152 3300005347 Ga0070668_100009770 Ga0070668_1000097707 281
153 3300005436 Ga0070713_100553212 Ga0070713_1005532121 281
154 3300005437 Ga0070710_10013104 Ga0070710_100131042 281
155 3300005439 Ga0070711_100005457 Ga0070711_1000054572 281
156 3300005439 Ga0070711_100013513 Ga0070711_1000135136 281
157 3300005439 Ga0070711_100059796 Ga0070711_1000597962 281
158 3300005467 Ga0070706_100033925 Ga0070706_1000339254 281
159 3300005549 Ga0070704_100401948 Ga0070704_1004019482 281
160 3300005719 Ga0068861_100000707 Ga0068861_1000007077 281
161 3300005841 Ga0068863_100024416 Ga0068863_1000244162 281
162 3300005843 Ga0068860_100015747 Ga0068860_1000157472 281
163 3300005843 Ga0068860_100331096 Ga0068860_1003310961 281
164 3300005844 Ga0068862_100001998 Ga0068862_10000199818 281
165 3300006175 Ga0070712_100059275 Ga0070712_1000592752 281
166 3300006175 Ga0070712_100279639 Ga0070712_1002796392 281
167 3300006195 Ga0075366_10112346 Ga0075366_101123462 281
168 3300006237 Ga0097621_100287439 Ga0097621_1002874392 281
169 3300006358 Ga0068871_100616616 Ga0068871_1006166161 281
170 3300006844 Ga0075428_100002601 Ga0075428_1000026014 281
171 3300006847 Ga0075431_100008282 Ga0075431_10000828210 281
172 3300006871 Ga0075434_100024826 Ga0075434_1000248267 281
173 3300006871 Ga0075434_100058492 Ga0075434_1000584922 281
174 3300006880 Ga0075429_100010088 Ga0075429_1000100884 281
175 3300007076 Ga0075435_100057735 Ga0075435_1000577352 281
176 3300007076 Ga0075435_100345576 Ga0075435_1003455761 281
177 3300007265 Ga0099794_10013006 Ga0099794_100130065 281
178 3300007265 Ga0099794_10057094 Ga0099794_100570942 281
179 3300007788 Ga0099795_10088468 Ga0099795_100884681 281
180 3300009094 Ga0111539_10025594 Ga0111539_100255942 281
181 3300009094 Ga0111539_10043042 Ga0111539_100430424 281
182 3300009147 Ga0114129_10029101 Ga0114129_100291015 281
183 3300009177 Ga0105248_10330554 Ga0105248_103305542 281
184 3300009553 Ga0105249_10108580 Ga0105249_101085802 281
185 3300011119 Ga0105246_10331080 Ga0105246_103310802 281
186 3300013104 Ga0157370_10017192 Ga0157370_100171924 281
187 3300013105 Ga0157369_10249331 Ga0157369_102493312 281
188 3300013296 Ga0157374_10225509 Ga0157374_102255092 281
189 3300013296 Ga0157374_10289534 Ga0157374_102895342 281
190 3300013306 Ga0163162_10026035 Ga0163162_100260354 281
191 3300013306 Ga0163162_10033808 Ga0163162_100338082 281
192 3300013308 Ga0157375_10207381 Ga0157375_102073812 281
193 3300014968 Ga0157379_10645042 Ga0157379_106450421 281
194 3300014969 Ga0157376_10009778 Ga0157376_100097784 281
195 3300014969 Ga0157376_10044721 Ga0157376_100447213 281
196 3300014969 Ga0157376_10264288 Ga0157376_102642882 281
197 3300025226 Ga0209674_100653 Ga0209674_1006535 281
198 3300025297 Ga0209758_1000195 Ga0209758_100019550 281
199 3300025898 Ga0207692_10009088 Ga0207692_100090883 281
200 3300025906 Ga0207699_10007566 Ga0207699_100075663 281
201 3300025915 Ga0207693_10008378 Ga0207693_100083782 281
202 3300025915 Ga0207693_10053395 Ga0207693_100533953 281
203 3300025916 Ga0207663_10003471 Ga0207663_100034716 281
204 3300025916 Ga0207663_10206224 Ga0207663_102062242 281
205 3300025938 Ga0207704_10248388 Ga0207704_102483882 281
206 3300025961 Ga0207712_10003517 Ga0207712_100035172 281
207 3300025972 Ga0207668_10033589 Ga0207668_100335892 281
208 3300026035 Ga0207703_10064222 Ga0207703_100642222 281
209 3300026088 Ga0207641_10006658 Ga0207641_100066586 281
210 3300026095 Ga0207676_10544560 Ga0207676_105445601 281
211 3300026118 Ga0207675_100005438 Ga0207675_1000054384 281
212 3300027907 Ga0207428_10011286 Ga0207428_100112865 281
213 3300027907 Ga0207428_10202967 Ga0207428_102029672 281
214 3300028016 Ga0265354_1001156 Ga0265354_10011566 281
215 3300028380 Ga0268265_10004898 Ga0268265_100048986 281
216 3300028381 Ga0268264_10088783 Ga0268264_100887832 281
217 3300028573 Ga0265334_10017010 Ga0265334_100170101 281
218 3300030760 Ga0265762_1000497 Ga0265762_10004972 281
219 3300030760 Ga0265762_1001500 Ga0265762_10015002 281
220 3300030760 Ga0265762_1030122 Ga0265762_10301221 281
221 3300030878 Ga0265770_1004224 Ga0265770_10042244 281
222 3300030878 Ga0265770_1023584 Ga0265770_10235841 281
223 3300031010 Ga0265771_1001650 Ga0265771_10016501 281
224 3300031507 Ga0307509_10178859 Ga0307509_101788592 281
225 3300031730 Ga0307516_10000049 Ga0307516_1000004928 281
226 3300033180 Ga0307510_10000003 Ga0307510_10000003541 281
227 3300035113 Ga0373936_0017515 Ga0373936_0017515_38_889 281
228 3300046472 Ga0495580_0086406 Ga0495580_0086406_335_1186 281
229 3300047320 Ga0495672_0028603 Ga0495672_0028603_1215_2066 281
230 3300048907 Ga0496104_0019174 Ga0496104_0019174_3370_4221 281
231 3300048918 Ga0496115_0026681 Ga0496115_0026681_2651_3502 281
232 3300050493 nmdc:mga0k408_104440_c1 nmdc:mga0k408_104440_c1_382_1254 281
233 3300050507 nmdc:mga05p37_10022_c1 nmdc:mga05p37_10022_c1_4956_5807 281
234 3300050508 nmdc:mga09592_5857_c1 nmdc:mga09592_5857_c1_2792_3643 281
235 3300050510 nmdc:mga06r32_6469_c1 nmdc:mga06r32_6469_c1_1755_2606 281
236 3300050511 nmdc:mga08y16_127849_c1 nmdc:mga08y16_127849_c1_1132_1983 281
237 3300050511 nmdc:mga08y16_7065_c1 nmdc:mga08y16_7065_c1_4845_5696 281
238 3300050514 nmdc:mga08x19_668_c1 nmdc:mga08x19_668_c1_18811_19662 281
239 3300050515 nmdc:mga0a205_317319_c1 nmdc:mga0a205_317319_c1_27_878 281
240 3300050515 nmdc:mga0a205_420018_c1 nmdc:mga0a205_420018_c1_67_918 281
241 3300053118 Ga0500594_0078624 Ga0500594_0078624_117_968 281
242 3300053134 Ga0500658_0000157 Ga0500658_0000157_5927_6778 281
243 3300053139 Ga0500568_0002574 Ga0500568_0002574_5606_6457 281
244 3300053153 Ga0500616_0000342 Ga0500616_0000342_59858_60709 281
245 3300053730 Ga0500645_007313 Ga0500645_007313_2211_3062 281
246 3300053730 Ga0500645_062210 Ga0500645_062210_212_1063 281
247 2162886007 SwRhRL2b_contig_1673370 SwRhRL2b_0169.00007130 282
248 3300001976 JGI24752J21851_1000059 JGI24752J21851_10000592 282
249 3300001976 JGI24752J21851_1000894 JGI24752J21851_10008942 282
250 3300002070 JGI24750J21931_1000105 JGI24750J21931_10001053 282
251 3300002074 JGI24748J21848_1000043 JGI24748J21848_100004321 282
252 3300002239 JGI24034J26672_10000031 JGI24034J26672_1000003183 282
253 3300002239 JGI24034J26672_10000059 JGI24034J26672_1000005920 282
254 3300003758 Ga0055532_1000095 Ga0055532_100009548 282
255 3300005289 Ga0065704_10073021 Ga0065704_100730215 282
256 3300005295 Ga0065707_10121008 Ga0065707_101210082 282
257 3300005330 Ga0070690_100000010 Ga0070690_10000001022 282
258 3300005331 Ga0070670_100000218 Ga0070670_10000021841 282
259 3300005335 Ga0070666_10000006 Ga0070666_10000006313 282
260 3300005347 Ga0070668_100082007 Ga0070668_1000820073 282
261 3300005353 Ga0070669_100000326 Ga0070669_10000032625 282
262 3300005353 Ga0070669_100019677 Ga0070669_1000196772 282
263 3300005355 Ga0070671_100029746 Ga0070671_1000297465 282
264 3300005355 Ga0070671_100180246 Ga0070671_1001802461 282
265 3300005365 Ga0070688_100020688 Ga0070688_1000206882 282
266 3300005367 Ga0070667_100000039 Ga0070667_100000039170 282
267 3300005367 Ga0070667_100012822 Ga0070667_1000128225 282
268 3300005466 Ga0070685_10000331 Ga0070685_1000033114 282
269 3300005544 Ga0070686_100000042 Ga0070686_10000004222 282
270 3300005548 Ga0070665_100000019 Ga0070665_10000001921 282
271 3300005617 Ga0068859_100030881 Ga0068859_1000308816 282
272 3300005617 Ga0068859_100084872 Ga0068859_1000848723 282
273 3300005618 Ga0068864_100000016 Ga0068864_100000016313 282
274 3300005618 Ga0068864_100057400 Ga0068864_1000574002 282
275 3300005719 Ga0068861_100012821 Ga0068861_1000128215 282
276 3300005841 Ga0068863_100000033 Ga0068863_100000033165 282
277 3300005841 Ga0068863_100000113 Ga0068863_10000011340 282
278 3300005843 Ga0068860_100000014 Ga0068860_100000014312 282
279 3300005844 Ga0068862_100000040 Ga0068862_100000040164 282
280 3300005844 Ga0068862_100002032 Ga0068862_1000020323 282
281 3300005844 Ga0068862_100003549 Ga0068862_1000035498 282
282 3300006931 Ga0097620_100030883 Ga0097620_1000308831 282
283 3300006931 Ga0097620_100084877 Ga0097620_1000848773 282
284 3300009011 Ga0105251_10000974 Ga0105251_1000097416 282
285 3300009101 Ga0105247_10017171 Ga0105247_100171715 282
286 3300009177 Ga0105248_10000021 Ga0105248_10000021281 282
287 3300009177 Ga0105248_10041943 Ga0105248_100419435 282
288 3300009553 Ga0105249_10000035 Ga0105249_1000003520 282
289 3300009553 Ga0105249_10000128 Ga0105249_1000012813 282
290 3300013306 Ga0163162_10034618 Ga0163162_100346185 282
291 3300013306 Ga0163162_10143444 Ga0163162_101434441 282
292 3300014325 Ga0163163_10011297 Ga0163163_100112977 282
293 3300014326 Ga0157380_10003582 Ga0157380_100035824 282
294 3300014968 Ga0157379_10026684 Ga0157379_100266844 282
295 3300014968 Ga0157379_10029509 Ga0157379_100295094 282
296 3300017792 Ga0163161_10000366 Ga0163161_1000036627 282
297 3300025225 Ga0209566_100207 Ga0209566_10020740 282
298 3300025229 Ga0209147_100021 Ga0209147_10002191 282
299 3300025735 Ga0207713_1001413 Ga0207713_100141315 282
300 3300025900 Ga0207710_10035153 Ga0207710_100351532 282
301 3300025903 Ga0207680_10000011 Ga0207680_10000011309 282
302 3300025923 Ga0207681_10000587 Ga0207681_1000058715 282
303 3300025923 Ga0207681_10116069 Ga0207681_101160692 282
304 3300025925 Ga0207650_10000279 Ga0207650_1000027939 282
305 3300025931 Ga0207644_10210801 Ga0207644_102108012 282
306 3300025936 Ga0207670_10001578 Ga0207670_1000157813 282
307 3300025941 Ga0207711_10000025 Ga0207711_1000002515 282
308 3300025941 Ga0207711_10028336 Ga0207711_100283363 282
309 3300025961 Ga0207712_10000013 Ga0207712_10000013309 282
310 3300025961 Ga0207712_10000126 Ga0207712_1000012661 282
311 3300025972 Ga0207668_10003986 Ga0207668_100039864 282
312 3300025972 Ga0207668_10024025 Ga0207668_100240254 282
313 3300025986 Ga0207658_10000369 Ga0207658_1000036938 282
314 3300025986 Ga0207658_10001521 Ga0207658_1000152112 282
315 3300026035 Ga0207703_10001418 Ga0207703_100014182 282
316 3300026088 Ga0207641_10000002 Ga0207641_10000002163 282
317 3300026088 Ga0207641_10000161 Ga0207641_1000016140 282
318 3300026095 Ga0207676_10000005 Ga0207676_10000005644 282
319 3300026095 Ga0207676_10000543 Ga0207676_1000054321 282
320 3300026118 Ga0207675_100000269 Ga0207675_10000026920 282
321 3300028379 Ga0268266_10000025 Ga0268266_10000025466 282
322 3300028380 Ga0268265_10000003 Ga0268265_10000003827 282
323 3300028380 Ga0268265_10000857 Ga0268265_1000085720 282
324 3300028380 Ga0268265_10022057 Ga0268265_100220574 282
325 3300028381 Ga0268264_10000037 Ga0268264_10000037309 282
326 3300031507 Ga0307509_10000003 Ga0307509_10000003446 282
327 3300046460 Ga0495638_0000019 Ga0495638_0000019_317131_318000 282
328 3300048904 Ga0496101_0168452 Ga0496101_0168452_107_1027 282
329 3300048905 Ga0496102_0025829 Ga0496102_0025829_926_1774 282
330 3300048906 Ga0496103_0002746 Ga0496103_0002746_7068_7916 282
331 3300048907 Ga0496104_0143469 Ga0496104_0143469_1361_2209 282
332 3300048909 Ga0496106_0041352 Ga0496106_0041352_2239_3087 282
333 3300048919 Ga0496116_0035515 Ga0496116_0035515_54_902 282
334 3300048920 Ga0496117_0008968 Ga0496117_0008968_4059_4907 282
335 3300048920 Ga0496117_0040676 Ga0496117_0040676_2369_3217 282
336 3300048921 Ga0496118_0000761 Ga0496118_0000761_13267_14115 282
337 3300048921 Ga0496118_0002765 Ga0496118_0002765_11930_12778 282
338 3300048921 Ga0496118_0021168 Ga0496118_0021168_437_1285 282
339 3300048925 Ga0496122_0129714 Ga0496122_0129714_158_1006 282
340 3300048926 Ga0496123_0082978 Ga0496123_0082978_985_1833 282
341 3300048927 Ga0496124_0026920 Ga0496124_0026920_1959_2807 282
342 3300049777 Ga0501281_00001 Ga0501281_00001_1653_2501 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

98

304

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.9268 1 282
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.9266 1 282
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9237 72 282
1wzo-assembly1.cif.gz_C crystal structure of the hpce from thermus thermophilus hb8 0.9228 1 282
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9223 72 282
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9497 69 281 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9453 73 280 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.942 72 281 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9391 71 282 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9365 69 281 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2E9A8S3-F1-model_v4 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase 0.9807 72 282 GO:0003824
GO:0046872
AF-A0A484Q1U5-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9794 78 282 GO:0016787
GO:0046872
AF-A0A1M7DVY3-F1-model_v4 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) 0.9742 66 282 GO:0003824
GO:0044281
AF-A0A6I3EIT8-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9742 71 279 GO:0016853
GO:0044281
AF-W4VH25-F1-model_v4 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase 0.9722 100 282 GO:0003824
GO:0044281

Feature Viewer

pLDDT pTM Quality
93.36 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map