F415155

General Info

Members Datasets Scaffolds Average Seq Length
342 252 684 132

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10000085|Ga0157370_1000008514
Length 147
Sequence MKLDEVPQDHSSTYGGHSKLVYAVDADGHYQGLQSDGWEPEAFATQLAVEELEGLEAGAHAAWQRGELSALKFLMYRYRLDEPALAQITGLWQWRIRRHFRPAVYKGLSPAILARYADAFGLPLADLTQYQQSKSQHSNNQHTKDPV

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
71 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
101 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
102 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
103 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
104 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
105 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
106 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
107 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
108 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
109 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
110 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
113 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
114 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
185 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
186 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
209 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
210 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
211 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
212 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
213 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
214 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
215 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
216 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
217 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
218 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
219 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
220 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
221 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
222 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
223 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
224 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
225 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
226 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
227 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
228 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
229 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
230 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
231 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
232 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
233 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
234 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
235 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
236 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
237 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
238 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
239 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
240 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
241 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
242 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
243 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
244 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
245 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
246 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
247 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
248 639633007 Azoarcus olearius BH72 Isolate Unclassified
249 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
250 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
251 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
252 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.96
Metatranscriptomes 1.17
Isolates 12.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 1.75
Rhizoplane 2.05
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10000085 3300013104 Bacteria 103847
2 Ga0006562J51391_1005558 3300003578 Bacteria 5560
3 Ga0065714_10008392 3300005288 Bacteria 3933
4 Ga0065714_10021569 3300005288 Bacteria 1312
5 Ga0065714_10124331 3300005288 Bacteria 1312
6 Ga0065714_10146408 3300005288 Bacteria 1130
7 Ga0065714_10240019 3300005288 Bacteria 797
8 Ga0065715_10043367 3300005293 Bacteria 1118
9 Ga0065715_10238077 3300005293 Bacteria 1209
10 Ga0065715_10270855 3300005293 Bacteria 1099
11 Ga0065715_10528199 3300005293 Bacteria 745
12 Ga0070680_101329001 3300005336 Bacteria 622
13 Ga0070682_100010813 3300005337 Bacteria 5193
14 Ga0070689_100964633 3300005340 Bacteria 757
15 Ga0070691_10090762 3300005341 Bacteria 1506
16 Ga0070692_10016687 3300005345 Bacteria 3498
17 Ga0070713_101266672 3300005436 Bacteria 714
18 Ga0070711_100215303 3300005439 Bacteria 1490
19 Ga0070705_100043310 3300005440 Bacteria 2579
20 Ga0070705_100494727 3300005440 Bacteria 927
21 Ga0070694_100013502 3300005444 Bacteria 5101
22 Ga0070681_10016755 3300005458 Bacteria 7317
23 Ga0070679_101743211 3300005530 Unclassified 571
24 Ga0070697_100115167 3300005536 Bacteria 2244
25 Ga0070697_100805481 3300005536 Unclassified 831
26 Ga0070695_100123743 3300005545 Bacteria 1773
27 Ga0070696_100037363 3300005546 Bacteria 3350
28 Ga0070696_100532570 3300005546 Unclassified 939
29 Ga0070696_101539562 3300005546 Bacteria 570
30 Ga0070693_100024304 3300005547 Bacteria 3248
31 Ga0070704_100003432 3300005549 Bacteria 9085
32 Ga0070704_100012723 3300005549 Bacteria 5206
33 Ga0070702_100487053 3300005615 Bacteria 903
34 Ga0070702_101606618 3300005615 Bacteria 538
35 Ga0068864_100343455 3300005618 Bacteria 1407
36 Ga0068861_101828852 3300005719 Bacteria 603
37 Ga0068863_101120136 3300005841 Bacteria 792
38 Ga0081539_10000178 3300005985 Bacteria 149201
39 Ga0070715_10024595 3300006163 Bacteria 2375
40 Ga0070716_100031113 3300006173 Bacteria 2901
41 Ga0070712_100243249 3300006175 Bacteria 1434
42 Ga0075362_10118154 3300006177 Bacteria 1253
43 Ga0097621_100288935 3300006237 Bacteria 1445
44 Ga0075428_100029366 3300006844 Bacteria 6083
45 Ga0075428_100229464 3300006844 Bacteria 2003
46 Ga0075430_100620697 3300006846 Bacteria 892
47 Ga0075430_100709033 3300006846 Bacteria 829
48 Ga0075430_101236768 3300006846 Unclassified 614
49 Ga0075431_100007718 3300006847 Bacteria 10714
50 Ga0075431_101394402 3300006847 Bacteria 660
51 Ga0075433_10144980 3300006852 Bacteria 2111
52 Ga0075433_10881139 3300006852 Bacteria 781
53 Ga0075434_100041182 3300006871 Bacteria 4576
54 Ga0075434_100565618 3300006871 Bacteria 1156
55 Ga0075434_101018452 3300006871 Bacteria 842
56 Ga0075429_100241920 3300006880 Bacteria 1581
57 Ga0075436_100024094 3300006914 Bacteria 4184
58 Ga0075436_100595841 3300006914 Bacteria 814
59 Ga0099824_1014579 3300006942 Bacteria 7751
60 Ga0079104_1000079 3300006946 Bacteria 141480
61 Ga0099826_10001967 3300006948 Bacteria 12887
62 Ga0075435_100057288 3300007076 Bacteria 3152
63 Ga0075435_100063476 3300007076 Bacteria 3000
64 Ga0075435_100272221 3300007076 Bacteria 1445
65 Ga0099794_10014515 3300007265 Bacteria 3453
66 Ga0099794_10155732 3300007265 Bacteria 1161
67 Ga0099794_10175048 3300007265 Unclassified 1094
68 Ga0099794_10330082 3300007265 Unclassified 792
69 Ga0099795_10000515 3300007788 Bacteria 7273
70 Ga0099795_10108799 3300007788 Unclassified 1096
71 Ga0105244_10000054 3300009036 Bacteria 133715
72 Ga0105244_10056967 3300009036 Bacteria 1976
73 Ga0105250_10003528 3300009092 Bacteria 7376
74 Ga0111539_10110951 3300009094 Bacteria 3219
75 Ga0114129_10083807 3300009147 Bacteria 4426
76 Ga0114129_13112858 3300009147 Unclassified 542
77 Ga0157373_10000035 3300013100 Bacteria 123284
78 Ga0157373_10016482 3300013100 Bacteria 5389
79 Ga0157371_10002347 3300013102 Bacteria 18128
80 Ga0157371_10016953 3300013102 Bacteria 5424
81 Ga0157370_10001492 3300013104 Bacteria 28987
82 Ga0157370_10011599 3300013104 Bacteria 9200
83 Ga0157370_10021334 3300013104 Bacteria 6454
84 Ga0157370_10774694 3300013104 Bacteria 873
85 Ga0157369_10000235 3300013105 Bacteria 76779
86 Ga0157369_10205469 3300013105 Bacteria 2066
87 Ga0157378_12344887 3300013297 Bacteria 585
88 Ga0163162_10033233 3300013306 Bacteria 5124
89 Ga0157375_10045547 3300013308 Bacteria 4270
90 Ga0157375_11636876 3300013308 Bacteria 761
91 Ga0157377_10342888 3300014745 Bacteria 1000
92 Ga0182006_1002746 3300015261 Bacteria 9431
93 Ga0182006_1016041 3300015261 Bacteria 3201
94 Ga0182006_1031134 3300015261 Bacteria 2152
95 Ga0182006_1041617 3300015261 Bacteria 1803
96 Ga0182006_1042775 3300015261 Bacteria 1773
97 Ga0163161_10000091 3300017792 Bacteria 90927
98 Ga0163161_10012282 3300017792 Bacteria 5944
99 Ga0163161_10027825 3300017792 Unclassified 4011
100 Ga0163161_10032934 3300017792 Bacteria 3702
101 Ga0207696_1011515 3300025711 Bacteria 3178
102 Ga0207655_1000003 3300025728 Bacteria 1081376
103 Ga0207685_10003298 3300025905 Bacteria 3902
104 Ga0207663_11587625 3300025916 Bacteria 527
105 Ga0207660_10048649 3300025917 Bacteria 3002
106 Ga0207652_11388226 3300025921 Unclassified 606
107 Ga0207700_11388583 3300025928 Bacteria 625
108 Ga0207670_10634221 3300025936 Bacteria 880
109 Ga0207665_10286446 3300025939 Bacteria 1227
110 Ga0207641_10082482 3300026088 Bacteria 2794
111 Ga0207676_10432876 3300026095 Bacteria 1236
112 Ga0209281_1000367 3300027111 Bacteria 73152
113 Ga0209371_1000032 3300027312 Bacteria 392355
114 Ga0209489_112459 3300027361 Bacteria 7706
115 Ga0209968_1003348 3300027526 Bacteria 2407
116 Ga0209282_1004798 3300027666 Bacteria 8199
117 Ga0209588_1007516 3300027671 Bacteria 3208
118 Ga0209971_1112883 3300027682 Bacteria 667
119 Ga0207428_10069648 3300027907 Bacteria 2766
120 Ga0268256_1000050 3300030500 Bacteria 300675
121 Ga0307408_100000692 3300031548 Bacteria 27725
122 Ga0307405_10484003 3300031731 Bacteria 988
123 Ga0307413_10000001 3300031824 Bacteria 159157
124 Ga0307410_10000024 3300031852 Bacteria 59872
125 Ga0307406_10000028 3300031901 Bacteria 91602
126 Ga0307407_10000626 3300031903 Bacteria 11307
127 Ga0307412_10205493 3300031911 Bacteria 1499
128 Ga0307412_10326760 3300031911 Bacteria 1222
129 Ga0307409_101424001 3300031995 Bacteria 720
130 Ga0307416_100000066 3300032002 Bacteria 94549
131 Ga0307416_100977045 3300032002 Bacteria 949
132 Ga0307414_10000022 3300032004 Bacteria 212123
133 Ga0307414_10006182 3300032004 Bacteria 6657
134 Ga0307414_10070071 3300032004 Bacteria 2523
135 Ga0307414_10448849 3300032004 Bacteria 1130
136 Ga0307414_10548361 3300032004 Bacteria 1030
137 Ga0307411_10000003 3300032005 Bacteria 477556
138 Ga0307411_10064558 3300032005 Bacteria 2452
139 Ga0307510_10019092 3300033180 Bacteria 8041
140 Ga0373929_0174832 3300035085 Unclassified 589
141 Ga0373934_0141118 3300035086 Bacteria 985
142 Ga0373956_0112648 3300035119 Bacteria 1267
143 Ga0373931_0383373 3300035691 Bacteria 887
144 Ga0373937_0146810 3300036401 Bacteria 2208
145 Ga0439439_0155095 3300041406 Unclassified 651
146 Ga0439447_000722 3300041407 Bacteria 12259
147 Ga0439466_0000209 3300041411 Bacteria 23109
148 Ga0451791_0110885 3300041451 Bacteria 691
149 Ga0451791_1199983 3300041451 Bacteria 822
150 Ga0451802_0721077 3300041460 Bacteria 834
151 Ga0451807_2412969 3300041486 Bacteria 539
152 Ga0451837_0357688 3300041494 Bacteria 795
153 Ga0451837_0390680 3300041494 Bacteria 859
154 Ga0451841_1007155 3300041498 Bacteria 520
155 Ga0439431_0011189 3300041997 Bacteria 2046
156 Ga0439452_008596 3300042010 Bacteria 3062
157 Ga0439456_006477 3300042013 Bacteria 2392
158 Ga0450911_000018 3300042115 Bacteria 104759
159 Ga0450892_003040 3300042130 Bacteria 1392
160 Ga0450900_003401 3300042136 Bacteria 1765
161 Ga0450903_004330 3300042138 Bacteria 2427
162 Ga0450904_000142 3300042139 Bacteria 15885
163 Ga0450905_004773 3300042142 Bacteria 1805
164 Ga0439446_0000081 3300042156 Bacteria 15751
165 Ga0439446_0001642 3300042156 Bacteria 5173
166 Ga0439459_0002295 3300042438 Bacteria 2934
167 Ga0439459_0039449 3300042438 Bacteria 997
168 Ga0439464_0000237 3300042439 Bacteria 10114
169 Ga0439464_0005341 3300042439 Bacteria 3317
170 Ga0439464_0005905 3300042439 Bacteria 3181
171 Ga0450893_0000687 3300042532 Bacteria 4889
172 Ga0451577_0096821 3300042876 Unclassified 2635
173 Ga0451577_0294325 3300042876 Unclassified 1471
174 Ga0453683_0021142 3300044673 Unclassified 4155
175 Ga0453684_0017676 3300044712 Bacteria 11023
176 Ga0451576_0002948 3300045051 Bacteria 24134
177 Ga0451576_2489109 3300045051 Unclassified 529
178 Ga0495592_0013389 3300046454 Bacteria 6241
179 Ga0495603_0059142 3300046455 Bacteria 2266
180 Ga0495629_0007075 3300046459 Bacteria 8266
181 Ga0495641_0072613 3300046461 Bacteria 1544
182 Ga0495582_0440853 3300046473 Bacteria 752
183 Ga0495639_0040275 3300046475 Bacteria 2101
184 Ga0495639_0069395 3300046475 Bacteria 1626
185 Ga0495662_0005797 3300046476 Bacteria 6180
186 Ga0495607_0017024 3300046501 Bacteria 4679
187 Ga0495607_0364529 3300046501 Bacteria 664
188 Ga0495606_0001936 3300046507 Bacteria 25665
189 Ga0495606_0165631 3300046507 Bacteria 1286
190 Ga0495606_0262502 3300046507 Bacteria 952
191 Ga0495608_0030707 3300046511 Bacteria 3636
192 Ga0495618_0020105 3300046514 Bacteria 4110
193 Ga0495628_0000915 3300046516 Bacteria 27087
194 Ga0495630_0003285 3300046517 Bacteria 11278
195 Ga0495643_0000275 3300046522 Bacteria 73599
196 Ga0495643_0003494 3300046522 Bacteria 11452
197 Ga0495652_0057019 3300046529 Bacteria 3315
198 Ga0495652_0536881 3300046529 Bacteria 806
199 Ga0495654_0190150 3300046530 Bacteria 884
200 Ga0495640_0004201 3300046533 Bacteria 11521
201 Ga0495586_0002703 3300046535 Bacteria 9590
202 Ga0495587_0139869 3300046536 Bacteria 1382
203 Ga0495645_0375820 3300046543 Bacteria 910
204 Ga0495622_0030382 3300046557 Bacteria 2525
205 Ga0495667_0001875 3300046559 Bacteria 13945
206 Ga0495634_0005748 3300046642 Bacteria 9469
207 Ga0495625_0023535 3300046660 Bacteria 4704
208 Ga0495635_0161695 3300046663 Bacteria 1524
209 Ga0495599_0317301 3300046678 Bacteria 938
210 Ga0495658_0021263 3300046683 Bacteria 3419
211 Ga0495613_0013580 3300046689 Bacteria 6046
212 Ga0495624_0057002 3300046690 Bacteria 2457
213 Ga0495671_0001719 3300046692 Bacteria 14214
214 Ga0495649_0002918 3300046694 Bacteria 11831
215 Ga0495649_0087591 3300046694 Bacteria 1661
216 Ga0495600_0002457 3300046809 Bacteria 10633
217 Ga0495600_0137308 3300046809 Bacteria 1588
218 Ga0495660_0160026 3300046810 Bacteria 1105
219 Ga0495604_0003656 3300047317 Bacteria 12254
220 Ga0495680_0001925 3300047322 Bacteria 21809
221 Ga0495686_0408858 3300047472 Bacteria 727
222 Ga0495593_0101496 3300047673 Bacteria 1475
223 Ga0496115_0105888 3300048918 Bacteria 2308
224 Ga0496116_0000002 3300048919 Bacteria 920291
225 Ga0496117_0055618 3300048920 Bacteria 2764
226 Ga0496118_0034877 3300048921 Bacteria 4097
227 Ga0496121_0008635 3300048924 Bacteria 11918
228 Ga0496121_0071173 3300048924 Bacteria 2798
229 Ga0496122_0154818 3300048925 Bacteria 1408
230 Ga0496124_0014480 3300048927 Bacteria 7625
231 Ga0496124_0092469 3300048927 Bacteria 2464
232 Ga0496124_0340688 3300048927 Bacteria 1065
233 Ga0496125_0000024 3300048928 Bacteria 442149
234 Ga0496125_0000108 3300048928 Bacteria 196060
235 Ga0496125_0212672 3300048928 Bacteria 1254
236 Ga0496126_0017909 3300048929 Bacteria 7048
237 Ga0496126_0303424 3300048929 Bacteria 1316
238 Ga0495678_069923 3300049459 Bacteria 1290
239 Ga0501314_006436 3300049530 Bacteria 1023
240 Ga0501326_01830 3300049542 Bacteria 1015
241 Ga0501334_07822 3300049550 Bacteria 741
242 Ga0501033_0020010 3300049570 Bacteria 5059
243 Ga0501034_0061672 3300049571 Bacteria 3765
244 Ga0501034_0420289 3300049571 Bacteria 1258
245 Ga0501036_0197725 3300049572 Bacteria 1691
246 Ga0501037_0169183 3300049573 Bacteria 1554
247 Ga0501038_0315302 3300049574 Bacteria 1224
248 Ga0501038_0422345 3300049574 Bacteria 1028
249 Ga0501039_0025453 3300049575 Bacteria 4547
250 Ga0501040_0056757 3300049576 Bacteria 2687
251 Ga0501041_0029275 3300049577 Bacteria 3322
252 Ga0501042_0004918 3300049578 Bacteria 8555
253 Ga0501043_0285832 3300049579 Bacteria 1263
254 Ga0501043_0405707 3300049579 Bacteria 1029
255 Ga0501047_0025497 3300049581 Bacteria 5684
256 Ga0501048_0070652 3300049582 Bacteria 2465
257 Ga0501048_0921082 3300049582 Unclassified 629
258 Ga0501072_0046549 3300049588 Bacteria 3414
259 Ga0501249_000002 3300049679 Bacteria 262756
260 Ga0501249_014500 3300049679 Bacteria 1680
261 Ga0501079_1129188 3300049741 Bacteria 617
262 Ga0501241_024719 3300049758 Bacteria 1116
263 Ga0501266_000003 3300049763 Bacteria 388836
264 Ga0501266_090893 3300049763 Bacteria 530
265 Ga0501280_000232 3300049776 Bacteria 13993
266 Ga0501035_0088635 3300049822 Bacteria 2726
267 Ga0501035_0379973 3300049822 Bacteria 1178
268 Ga0501044_0000065 3300049823 Bacteria 130072
269 Ga0501045_0198633 3300049824 Bacteria 1494
270 Ga0501226_000001 3300049853 Bacteria 432595
271 nmdc:mga03683_156110_c1 3300050489 Bacteria 1032
272 nmdc:mga05p37_463642_c1 3300050507 Bacteria 1463
273 nmdc:mga09592_19265_c1 3300050508 Bacteria 5603
274 nmdc:mga09592_98627_c1 3300050508 Bacteria 2501
275 nmdc:mga0qj67_657856_c1 3300050509 Bacteria 836
276 nmdc:mga0qj67_878563_c1 3300050509 Unclassified 707
277 nmdc:mga06r32_99541_c1 3300050510 Bacteria 2852
278 nmdc:mga08y16_6785_c1 3300050511 Bacteria 12012
279 nmdc:mga0n895_520357_c1 3300050512 Bacteria 1197
280 nmdc:mga0n895_6225_c1 3300050512 Bacteria 10100
281 nmdc:mga0n895_922138_c1 3300050512 Bacteria 858
282 nmdc:mga0rr50_265882_c1 3300050513 Bacteria 1428
283 nmdc:mga0rr50_535074_c1 3300050513 Bacteria 997
284 nmdc:mga0rr50_821731_c1 3300050513 Bacteria 793
285 nmdc:mga08x19_100185_c1 3300050514 Bacteria 1921
286 nmdc:mga0a205_1255281_c1 3300050515 Bacteria 589
287 nmdc:mga0a205_347929_c1 3300050515 Bacteria 1350
288 nmdc:mga0a205_739064_c1 3300050515 Bacteria 833
289 Ga0495601_0088568 3300053077 Bacteria 1990
290 Ga0500644_0110227 3300053088 Bacteria 1059
291 Ga0500646_0000785 3300053090 Bacteria 8874
292 Ga0500646_0187568 3300053090 Bacteria 704
293 Ga0500641_0000033 3300053096 Bacteria 78369
294 Ga0500641_0000138 3300053096 Bacteria 27016
295 Ga0500658_0000015 3300053134 Bacteria 151134
296 Ga0500559_0265091 3300053136 Bacteria 808
297 Ga0500573_0382220 3300053140 Bacteria 673
298 Ga0500584_000363 3300053726 Bacteria 11944
299 2513234740 2513020052 Bacteria 5120511
300 2520880503 2519899754 Bacteria 5336938
301 2574431537 2574179768 Bacteria 4907129
302 2602008620 2600255389 Bacteria 5275336
303 2644012096 2643221600 Bacteria 5530138
304 2644371324 2643221667 Bacteria 5627472
305 2644641371 2643221716 Bacteria 4986332
306 2644682509 2643221725 Bacteria 5087956
307 2738733877 2738541279 Bacteria 6149495
308 2738766166 2738541285 Bacteria 6150075
309 2739215458 2738543007 Bacteria 6149845
310 2739287228 2738543020 Bacteria 5718238
311 2739292541 2738543021 Bacteria 5718241
312 2740000318 2739367857 Bacteria 5433684
313 2740005134 2739367858 Bacteria 5432813
314 2802651282 2802428842 Bacteria 4926114
315 2808905501 2808606373 Bacteria 4423627
316 2817414168 2816332280 Bacteria 5109718
317 2823425525 2823421272 Bacteria 5372474
318 2842808480 2842805378 Bacteria 5385175
319 2857617761 2857613821 Bacteria 4917088
320 2857621423 2857618242 Bacteria 5635925
321 2881248727 2881247448 Bacteria 3717788
322 2881361470 2881359912 Bacteria 4935907
323 2903895245 2903895155 Bacteria 5258610
324 2904420360 2904419702 Bacteria 5166287
325 2904557794 2904555929 Bacteria 5218588
326 2919192438 2919191525 Bacteria 5765973
327 2919502260 2919501602 Bacteria 5286340
328 2919509930 2919509842 Bacteria 4104664
329 2919684155 2919683626 Bacteria 5534354
330 2926063933 2926063275 Bacteria 5285848
331 2929151320 2929150217 Bacteria 5462483
332 2958459592 2958458903 Bacteria 5301041
333 2958512549 2958512119 Bacteria 4528530
334 2965322512 2965320100 Bacteria 3975600
335 2977272696 2977268062 Bacteria 5243061
336 2990199653 2990196909 Bacteria 4054280
337 3007255345 3007252601 Bacteria 4559114
338 639785401 639633007 Bacteria 4376040
339 8054310833 8054307821 Bacteria 5212224
340 8055420085 8055419101 Bacteria 5289643
341 8055596976 8055592153 Bacteria 5961247
342 8056440932 8056440228 Bacteria 4946504
343 Ga0157370_10000085
344 Ga0006562J51391_1005558
345 Ga0065714_10008392
346 Ga0065714_10021569
347 Ga0065714_10124331
348 Ga0065714_10146408
349 Ga0065714_10240019
350 Ga0065715_10043367
351 Ga0065715_10238077
352 Ga0065715_10270855
353 Ga0065715_10528199
354 Ga0070680_101329001
355 Ga0070682_100010813
356 Ga0070689_100964633
357 Ga0070691_10090762
358 Ga0070692_10016687
359 Ga0070713_101266672
360 Ga0070711_100215303
361 Ga0070705_100043310
362 Ga0070705_100494727
363 Ga0070694_100013502
364 Ga0070681_10016755
365 Ga0070679_101743211
366 Ga0070697_100115167
367 Ga0070697_100805481
368 Ga0070695_100123743
369 Ga0070696_100037363
370 Ga0070696_100532570
371 Ga0070696_101539562
372 Ga0070693_100024304
373 Ga0070704_100003432
374 Ga0070704_100012723
375 Ga0070702_100487053
376 Ga0070702_101606618
377 Ga0068864_100343455
378 Ga0068861_101828852
379 Ga0068863_101120136
380 Ga0081539_10000178
381 Ga0070715_10024595
382 Ga0070716_100031113
383 Ga0070712_100243249
384 Ga0075362_10118154
385 Ga0097621_100288935
386 Ga0075428_100029366
387 Ga0075428_100229464
388 Ga0075430_100620697
389 Ga0075430_100709033
390 Ga0075430_101236768
391 Ga0075431_100007718
392 Ga0075431_101394402
393 Ga0075433_10144980
394 Ga0075433_10881139
395 Ga0075434_100041182
396 Ga0075434_100565618
397 Ga0075434_101018452
398 Ga0075429_100241920
399 Ga0075436_100024094
400 Ga0075436_100595841
401 Ga0099824_1014579
402 Ga0079104_1000079
403 Ga0099826_10001967
404 Ga0075435_100057288
405 Ga0075435_100063476
406 Ga0075435_100272221
407 Ga0099794_10014515
408 Ga0099794_10155732
409 Ga0099794_10175048
410 Ga0099794_10330082
411 Ga0099795_10000515
412 Ga0099795_10108799
413 Ga0105244_10000054
414 Ga0105244_10056967
415 Ga0105250_10003528
416 Ga0111539_10110951
417 Ga0114129_10083807
418 Ga0114129_13112858
419 Ga0157373_10000035
420 Ga0157373_10016482
421 Ga0157371_10002347
422 Ga0157371_10016953
423 Ga0157370_10001492
424 Ga0157370_10011599
425 Ga0157370_10021334
426 Ga0157370_10774694
427 Ga0157369_10000235
428 Ga0157369_10205469
429 Ga0157378_12344887
430 Ga0163162_10033233
431 Ga0157375_10045547
432 Ga0157375_11636876
433 Ga0157377_10342888
434 Ga0182006_1002746
435 Ga0182006_1016041
436 Ga0182006_1031134
437 Ga0182006_1041617
438 Ga0182006_1042775
439 Ga0163161_10000091
440 Ga0163161_10012282
441 Ga0163161_10027825
442 Ga0163161_10032934
443 Ga0207696_1011515
444 Ga0207655_1000003
445 Ga0207685_10003298
446 Ga0207663_11587625
447 Ga0207660_10048649
448 Ga0207652_11388226
449 Ga0207700_11388583
450 Ga0207670_10634221
451 Ga0207665_10286446
452 Ga0207641_10082482
453 Ga0207676_10432876
454 Ga0209281_1000367
455 Ga0209371_1000032
456 Ga0209489_112459
457 Ga0209968_1003348
458 Ga0209282_1004798
459 Ga0209588_1007516
460 Ga0209971_1112883
461 Ga0207428_10069648
462 Ga0268256_1000050
463 Ga0307408_100000692
464 Ga0307405_10484003
465 Ga0307413_10000001
466 Ga0307410_10000024
467 Ga0307406_10000028
468 Ga0307407_10000626
469 Ga0307412_10205493
470 Ga0307412_10326760
471 Ga0307409_101424001
472 Ga0307416_100000066
473 Ga0307416_100977045
474 Ga0307414_10000022
475 Ga0307414_10006182
476 Ga0307414_10070071
477 Ga0307414_10448849
478 Ga0307414_10548361
479 Ga0307411_10000003
480 Ga0307411_10064558
481 Ga0307510_10019092
482 Ga0373929_0174832
483 Ga0373934_0141118
484 Ga0373956_0112648
485 Ga0373931_0383373
486 Ga0373937_0146810
487 Ga0439439_0155095
488 Ga0439447_000722
489 Ga0439466_0000209
490 Ga0451791_0110885
491 Ga0451791_1199983
492 Ga0451802_0721077
493 Ga0451807_2412969
494 Ga0451837_0357688
495 Ga0451837_0390680
496 Ga0451841_1007155
497 Ga0439431_0011189
498 Ga0439452_008596
499 Ga0439456_006477
500 Ga0450911_000018
501 Ga0450892_003040
502 Ga0450900_003401
503 Ga0450903_004330
504 Ga0450904_000142
505 Ga0450905_004773
506 Ga0439446_0000081
507 Ga0439446_0001642
508 Ga0439459_0002295
509 Ga0439459_0039449
510 Ga0439464_0000237
511 Ga0439464_0005341
512 Ga0439464_0005905
513 Ga0450893_0000687
514 Ga0451577_0096821
515 Ga0451577_0294325
516 Ga0453683_0021142
517 Ga0453684_0017676
518 Ga0451576_0002948
519 Ga0451576_2489109
520 Ga0495592_0013389
521 Ga0495603_0059142
522 Ga0495629_0007075
523 Ga0495641_0072613
524 Ga0495582_0440853
525 Ga0495639_0040275
526 Ga0495639_0069395
527 Ga0495662_0005797
528 Ga0495607_0017024
529 Ga0495607_0364529
530 Ga0495606_0001936
531 Ga0495606_0165631
532 Ga0495606_0262502
533 Ga0495608_0030707
534 Ga0495618_0020105
535 Ga0495628_0000915
536 Ga0495630_0003285
537 Ga0495643_0000275
538 Ga0495643_0003494
539 Ga0495652_0057019
540 Ga0495652_0536881
541 Ga0495654_0190150
542 Ga0495640_0004201
543 Ga0495586_0002703
544 Ga0495587_0139869
545 Ga0495645_0375820
546 Ga0495622_0030382
547 Ga0495667_0001875
548 Ga0495634_0005748
549 Ga0495625_0023535
550 Ga0495635_0161695
551 Ga0495599_0317301
552 Ga0495658_0021263
553 Ga0495613_0013580
554 Ga0495624_0057002
555 Ga0495671_0001719
556 Ga0495649_0002918
557 Ga0495649_0087591
558 Ga0495600_0002457
559 Ga0495600_0137308
560 Ga0495660_0160026
561 Ga0495604_0003656
562 Ga0495680_0001925
563 Ga0495686_0408858
564 Ga0495593_0101496
565 Ga0496115_0105888
566 Ga0496116_0000002
567 Ga0496117_0055618
568 Ga0496118_0034877
569 Ga0496121_0008635
570 Ga0496121_0071173
571 Ga0496122_0154818
572 Ga0496124_0014480
573 Ga0496124_0092469
574 Ga0496124_0340688
575 Ga0496125_0000024
576 Ga0496125_0000108
577 Ga0496125_0212672
578 Ga0496126_0017909
579 Ga0496126_0303424
580 Ga0495678_069923
581 Ga0501314_006436
582 Ga0501326_01830
583 Ga0501334_07822
584 Ga0501033_0020010
585 Ga0501034_0061672
586 Ga0501034_0420289
587 Ga0501036_0197725
588 Ga0501037_0169183
589 Ga0501038_0315302
590 Ga0501038_0422345
591 Ga0501039_0025453
592 Ga0501040_0056757
593 Ga0501041_0029275
594 Ga0501042_0004918
595 Ga0501043_0285832
596 Ga0501043_0405707
597 Ga0501047_0025497
598 Ga0501048_0070652
599 Ga0501048_0921082
600 Ga0501072_0046549
601 Ga0501249_000002
602 Ga0501249_014500
603 Ga0501079_1129188
604 Ga0501241_024719
605 Ga0501266_000003
606 Ga0501266_090893
607 Ga0501280_000232
608 Ga0501035_0088635
609 Ga0501035_0379973
610 Ga0501044_0000065
611 Ga0501045_0198633
612 Ga0501226_000001
613 nmdc:mga03683_156110_c1
614 nmdc:mga05p37_463642_c1
615 nmdc:mga09592_19265_c1
616 nmdc:mga09592_98627_c1
617 nmdc:mga0qj67_657856_c1
618 nmdc:mga0qj67_878563_c1
619 nmdc:mga06r32_99541_c1
620 nmdc:mga08y16_6785_c1
621 nmdc:mga0n895_520357_c1
622 nmdc:mga0n895_6225_c1
623 nmdc:mga0n895_922138_c1
624 nmdc:mga0rr50_265882_c1
625 nmdc:mga0rr50_535074_c1
626 nmdc:mga0rr50_821731_c1
627 nmdc:mga08x19_100185_c1
628 nmdc:mga0a205_1255281_c1
629 nmdc:mga0a205_347929_c1
630 nmdc:mga0a205_739064_c1
631 Ga0495601_0088568
632 Ga0500644_0110227
633 Ga0500646_0000785
634 Ga0500646_0187568
635 Ga0500641_0000033
636 Ga0500641_0000138
637 Ga0500658_0000015
638 Ga0500559_0265091
639 Ga0500573_0382220
640 Ga0500584_000363
641 2513234740
642 2520880503
643 2574431537
644 2602008620
645 2644012096
646 2644371324
647 2644641371
648 2644682509
649 2738733877
650 2738766166
651 2739215458
652 2739287228
653 2739292541
654 2740000318
655 2740005134
656 2802651282
657 2808905501
658 2817414168
659 2823425525
660 2842808480
661 2857617761
662 2857621423
663 2881248727
664 2881361470
665 2903895245
666 2904420360
667 2904557794
668 2919192438
669 2919502260
670 2919509930
671 2919684155
672 2926063933
673 2929151320
674 2958459592
675 2958512549
676 2965322512
677 2977272696
678 2990199653
679 3007255345
680 639785401
681 8054310833
682 8055420085
683 8055596976
684 8056440932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b9r-assembly2.cif.gz_B streptomyces albus hepd with substrate 2-hydroxyethylphosphonate (2-hep) and fe(ii) bound 0.8857 71 128
1zz9-assembly1.cif.gz_A-2 crystal structure of feii hppe 0.871 71 129
1zz9-assembly2.cif.gz_C crystal structure of feii hppe 0.8688 71 128
4j1x-assembly2.cif.gz_C crystal structure of fe(ii)-hppe with alternative substrate (s)-1-hpp 0.8684 71 129
2lyk-assembly1.cif.gz_B noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) 0.8596 70 128
ID Description Score Start End Superfamily
1zz9B01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8748 71 128 1.10.260.40
2lykB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8596 70 128 1.10.260.40
3scgB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8515 71 129 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8512 71 133 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8503 72 128 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7W1J702-F1-model_v4 XRE family transcriptional regulator 0.9942 70 130
AF-A0A136N5R7-F1-model_v4 Uncharacterized protein 0.9673 81 130
AF-A0A7X9JV90-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9609 47 129
AF-A0A536V6L3-F1-model_v4 Uncharacterized protein 0.9579 69 130
AF-A0A7X8ND71-F1-model_v4 deleted 0.9201 70 128

Map