F415167

General Info

Members Datasets Scaffolds Average Seq Length
342 220 340 192

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10487036|Ga0157375_104870361
Length 227
Sequence MNGHRRAVVLRDALRAPQDDGIDSNLRTKDFGASHMLTLYFAPGASSFAPHIALHEIGVAFEGKPMSFKRNDMRSPEFLAINPEGKVPTLIVDGRPLTEVAAILFYLARRFPEAGLLPTDDIEAEAQAVSWMSFIASTLHPARQRGLDYAKVAYGIADRRLGNGWAIGRYSIADIHLFRLYWRLANSFHPAPETFPNLTAHYARMMARPAVQRTIAVESAVGYELPA

Samples

Sample ID Description Type Environment
1 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
2 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
119 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
120 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
218 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.85
Nodule 0.29
Rhizoplane 6.43
Rhizosphere 85.09
Stem 0
Stem Tuber 0
Unclassified 2.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000233 3300003203 Bacteria 24719
2 Ga0070658_10028406 3300005327 Bacteria 4490
3 Ga0070658_10662769 3300005327 Bacteria 905
4 Ga0070683_100117092 3300005329 Bacteria 2516
5 Ga0070677_10172763 3300005333 Unclassified 1023
6 Ga0070680_100005047 3300005336 Bacteria 9955
7 Ga0070680_100221429 3300005336 Bacteria 1597
8 Ga0070680_100750129 3300005336 Bacteria 840
9 Ga0070682_100306817 3300005337 Bacteria 1167
10 Ga0070660_100018090 3300005339 Bacteria 5143
11 Ga0070660_100452364 3300005339 Bacteria 1065
12 Ga0070660_100620953 3300005339 Bacteria 904
13 Ga0070689_100146657 3300005340 Bacteria 1901
14 Ga0070691_10394925 3300005341 Bacteria 778
15 Ga0070661_100014823 3300005344 Bacteria 5498
16 Ga0070668_100093364 3300005347 Bacteria 2374
17 Ga0070671_100507066 3300005355 Bacteria 1038
18 Ga0070659_100013772 3300005366 Bacteria 6031
19 Ga0070659_100033720 3300005366 Bacteria 3979
20 Ga0070659_100289888 3300005366 Bacteria 1363
21 Ga0070709_10058614 3300005434 Bacteria 2442
22 Ga0070714_100039825 3300005435 Bacteria 3959
23 Ga0070714_100057282 3300005435 Bacteria 3335
24 Ga0070714_100331854 3300005435 Bacteria 1424
25 Ga0070710_10023846 3300005437 Bacteria 3221
26 Ga0070710_10470035 3300005437 Unclassified 856
27 Ga0070711_100263672 3300005439 Bacteria 1357
28 Ga0070663_100338897 3300005455 Bacteria 1214
29 Ga0070678_100335365 3300005456 Bacteria 1295
30 Ga0070681_10136308 3300005458 Bacteria 2385
31 Ga0070681_10173382 3300005458 Bacteria 2078
32 Ga0068867_100337781 3300005459 Bacteria 1253
33 Ga0070698_100001306 3300005471 Bacteria 27744
34 Ga0070679_100014442 3300005530 Bacteria 7584
35 Ga0070679_100044155 3300005530 Bacteria 4440
36 Ga0070679_100335789 3300005530 Bacteria 1459
37 Ga0070679_100866723 3300005530 Bacteria 846
38 Ga0070697_100045154 3300005536 Bacteria 3570
39 Ga0068853_100020318 3300005539 Bacteria 5522
40 Ga0068853_100212330 3300005539 Bacteria 1764
41 Ga0068853_100329527 3300005539 Bacteria 1416
42 Ga0068853_100386083 3300005539 Bacteria 1308
43 Ga0070686_100605686 3300005544 Bacteria 864
44 Ga0070665_100865021 3300005548 Bacteria 917
45 Ga0068855_100020027 3300005563 Bacteria 8033
46 Ga0068855_100050064 3300005563 Bacteria 4924
47 Ga0068855_100126764 3300005563 Bacteria 2918
48 Ga0068855_100567888 3300005563 Bacteria 1226
49 Ga0068855_101081081 3300005563 Bacteria 839
50 Ga0068857_100069625 3300005577 Bacteria 3133
51 Ga0068856_100202019 3300005614 Bacteria 2002
52 Ga0068856_101181021 3300005614 Bacteria 782
53 Ga0070702_100539393 3300005615 Bacteria 864
54 Ga0068852_100013902 3300005616 Bacteria 6173
55 Ga0068852_100083488 3300005616 Bacteria 2841
56 Ga0068852_100651646 3300005616 Unclassified 1061
57 Ga0068859_100546292 3300005617 Bacteria 1253
58 Ga0068866_10058711 3300005718 Bacteria 1988
59 Ga0068861_100094083 3300005719 Bacteria 2371
60 Ga0068861_100742198 3300005719 Unclassified 916
61 Ga0068858_100629016 3300005842 Unclassified 1042
62 Ga0068858_100887453 3300005842 Bacteria 872
63 Ga0068862_100162807 3300005844 Bacteria 1992
64 Ga0068862_100665354 3300005844 Bacteria 1006
65 Ga0081455_10000551 3300005937 Bacteria 48719
66 Ga0081455_10176173 3300005937 Bacteria 1623
67 Ga0081455_10252132 3300005937 Bacteria 1290
68 Ga0081540_1158446 3300005983 Bacteria 882
69 Ga0081539_10002599 3300005985 Bacteria 24763
70 Ga0081539_10002833 3300005985 Bacteria 23145
71 Ga0081539_10018938 3300005985 Bacteria 4743
72 Ga0070717_10807143 3300006028 Bacteria 854
73 Ga0075365_10082628 3300006038 Bacteria 2178
74 Ga0075362_10004415 3300006177 Bacteria 5050
75 Ga0075362_10070687 3300006177 Bacteria 1593
76 Ga0075367_10095272 3300006178 Bacteria 1815
77 Ga0075369_10324223 3300006186 Bacteria 721
78 Ga0075366_10026120 3300006195 Bacteria 3418
79 Ga0075370_10392008 3300006353 Bacteria 833
80 Ga0068871_100549512 3300006358 Bacteria 1046
81 Ga0068871_101176745 3300006358 Bacteria 719
82 Ga0075431_100337220 3300006847 Bacteria 1518
83 Ga0068865_100227390 3300006881 Bacteria 1462
84 Ga0068865_100591088 3300006881 Bacteria 937
85 Ga0075435_100890226 3300007076 Bacteria 776
86 Ga0099794_10035952 3300007265 Bacteria 2339
87 Ga0099795_10009533 3300007788 Bacteria 2822
88 Ga0099795_10083731 3300007788 Bacteria 1225
89 Ga0099795_10202202 3300007788 Bacteria 838
90 Ga0105240_10020405 3300009093 Bacteria 8840
91 Ga0105240_10597818 3300009093 Bacteria 1215
92 Ga0111539_10220629 3300009094 Bacteria 2208
93 Ga0105247_10162450 3300009101 Bacteria 1480
94 Ga0114129_12119636 3300009147 Bacteria 678
95 Ga0105243_10419810 3300009148 Bacteria 1247
96 Ga0105243_10945795 3300009148 Bacteria 860
97 Ga0105242_10194312 3300009176 Bacteria 1799
98 Ga0105248_10118079 3300009177 Bacteria 2992
99 Ga0105237_10144169 3300009545 Bacteria 2376
100 Ga0105237_10176696 3300009545 Bacteria 2135
101 Ga0105238_10024894 3300009551 Bacteria 6099
102 Ga0105238_10046039 3300009551 Bacteria 4405
103 Ga0105238_10047072 3300009551 Bacteria 4349
104 Ga0105238_10572523 3300009551 Bacteria 1135
105 Ga0099796_10030220 3300010159 Bacteria 1756
106 Ga0099796_10090828 3300010159 Bacteria 1135
107 Ga0105239_10131830 3300010375 Bacteria 2781
108 Ga0157373_10108099 3300013100 Bacteria 1956
109 Ga0157370_10035301 3300013104 Bacteria 4862
110 Ga0157369_10418908 3300013105 Bacteria 1388
111 Ga0157378_10219928 3300013297 Bacteria 1805
112 Ga0157378_11427407 3300013297 Unclassified 735
113 Ga0163162_11406738 3300013306 Bacteria 794
114 Ga0157372_10342052 3300013307 Bacteria 1743
115 Ga0157375_10487036 3300013308 Bacteria 1398
116 Ga0163163_10095711 3300014325 Bacteria 2989
117 Ga0157380_10054645 3300014326 Bacteria 3170
118 Ga0157380_11413535 3300014326 Bacteria 746
119 Ga0157379_10209807 3300014968 Bacteria 1763
120 Ga0157379_10498555 3300014968 Bacteria 1128
121 Ga0157376_10468560 3300014969 Bacteria 1232
122 Ga0157376_11207884 3300014969 Unclassified 784
123 Ga0213876_10101935 3300021384 Bacteria 1522
124 Ga0213875_10000169 3300021388 Bacteria 68414
125 Ga0213871_10060851 3300021441 Bacteria 1051
126 Ga0228598_1030748 3300024227 Unclassified 1057
127 Ga0207692_10071752 3300025898 Bacteria 1827
128 Ga0207685_10302623 3300025905 Bacteria 792
129 Ga0207645_10133098 3300025907 Bacteria 1619
130 Ga0207705_10103477 3300025909 Bacteria 2097
131 Ga0207705_10177743 3300025909 Bacteria 1605
132 Ga0207705_10212234 3300025909 Unclassified 1468
133 Ga0207705_10470422 3300025909 Bacteria 975
134 Ga0207684_10114877 3300025910 Bacteria 2305
135 Ga0207707_10014431 3300025912 Bacteria 6882
136 Ga0207695_10002233 3300025913 Bacteria 29071
137 Ga0207695_10102919 3300025913 Bacteria 2848
138 Ga0207695_10699418 3300025913 Bacteria 894
139 Ga0207671_10156663 3300025914 Bacteria 1762
140 Ga0207671_10260083 3300025914 Bacteria 1366
141 Ga0207663_10225567 3300025916 Bacteria 1366
142 Ga0207660_10024364 3300025917 Bacteria 4097
143 Ga0207660_10054251 3300025917 Bacteria 2860
144 Ga0207660_10418006 3300025917 Bacteria 1081
145 Ga0207657_10004762 3300025919 Bacteria 14321
146 Ga0207657_10173374 3300025919 Bacteria 1747
147 Ga0207657_10625988 3300025919 Bacteria 839
148 Ga0207657_10674244 3300025919 Bacteria 804
149 Ga0207657_10684600 3300025919 Unclassified 797
150 Ga0207652_10167087 3300025921 Bacteria 1973
151 Ga0207652_10275320 3300025921 Bacteria 1518
152 Ga0207652_10300746 3300025921 Bacteria 1448
153 Ga0207652_10753139 3300025921 Bacteria 867
154 Ga0207652_10784050 3300025921 Bacteria 847
155 Ga0207694_10026667 3300025924 Bacteria 4398
156 Ga0207694_10055894 3300025924 Bacteria 3064
157 Ga0207694_10467812 3300025924 Bacteria 1054
158 Ga0207650_10795105 3300025925 Bacteria 802
159 Ga0207664_10164152 3300025929 Bacteria 1896
160 Ga0207664_10382287 3300025929 Bacteria 1250
161 Ga0207644_11002169 3300025931 Bacteria 701
162 Ga0207690_10000288 3300025932 Bacteria 35803
163 Ga0207690_10142971 3300025932 Bacteria 1765
164 Ga0207686_10440888 3300025934 Bacteria 1000
165 Ga0207704_10314369 3300025938 Bacteria 1206
166 Ga0207665_10318019 3300025939 Bacteria 1167
167 Ga0207665_10463269 3300025939 Bacteria 974
168 Ga0207665_10564154 3300025939 Bacteria 886
169 Ga0207691_10210315 3300025940 Bacteria 1690
170 Ga0207667_10006492 3300025949 Bacteria 14147
171 Ga0207667_10020497 3300025949 Bacteria 7350
172 Ga0207667_10024707 3300025949 Bacteria 6590
173 Ga0207667_10038849 3300025949 Bacteria 5077
174 Ga0207667_10380464 3300025949 Bacteria 1438
175 Ga0207668_10779306 3300025972 Bacteria 845
176 Ga0207703_10737231 3300026035 Bacteria 938
177 Ga0207639_10133710 3300026041 Bacteria 2057
178 Ga0207639_10325873 3300026041 Bacteria 1365
179 Ga0207639_10490674 3300026041 Bacteria 1121
180 Ga0207702_10240067 3300026078 Bacteria 1697
181 Ga0207702_10645526 3300026078 Bacteria 1041
182 Ga0207648_10314578 3300026089 Bacteria 1406
183 Ga0207683_10322426 3300026121 Bacteria 1415
184 Ga0207698_10008432 3300026142 Bacteria 6520
185 Ga0207698_10099007 3300026142 Bacteria 2411
186 Ga0207698_10615346 3300026142 Bacteria 1072
187 Ga0209179_1000903 3300027512 Bacteria 3335
188 Ga0209588_1033592 3300027671 Bacteria 1645
189 Ga0268265_10185042 3300028380 Bacteria 1793
190 Ga0307513_10449535 3300031456 Bacteria 1013
191 Ga0265313_10020224 3300031595 Bacteria 3678
192 Ga0265314_10058759 3300031711 Unclassified 2634
193 Ga0265342_10003512 3300031712 Bacteria 12823
194 Ga0373948_0079563 3300034817 Unclassified 746
195 Ga0373958_0010725 3300034819 Unclassified 1534
196 Ga0373929_0060657 3300035085 Unclassified 885
197 Ga0373929_0109752 3300035085 Bacteria 704
198 Ga0373934_0007630 3300035086 Unclassified 4018
199 Ga0373949_0143760 3300035090 Bacteria 685
200 Ga0373951_0027847 3300035091 Unclassified 1321
201 Ga0373932_0011113 3300035112 Unclassified 2193
202 Ga0373932_0057673 3300035112 Bacteria 1171
203 Ga0373936_0030756 3300035113 Bacteria 2118
204 Ga0373936_0038514 3300035113 Bacteria 1911
205 Ga0373941_0148392 3300035115 Unclassified 858
206 Ga0373941_0153639 3300035115 Bacteria 846
207 Ga0373945_0032976 3300035116 Bacteria 1838
208 Ga0373953_0011991 3300035117 Unclassified 3057
209 Ga0373954_0007397 3300035118 Unclassified 4806
210 Ga0373954_0040863 3300035118 Bacteria 2161
211 Ga0373956_0022326 3300035119 Unclassified 2708
212 Ga0373956_0106045 3300035119 Bacteria 1306
213 Ga0373957_0053504 3300035120 Bacteria 1549
214 Ga0373960_0011354 3300035121 Bacteria 2193
215 Ga0373943_0014956 3300035170 Bacteria 3522
216 Ga0373946_0006789 3300035171 Bacteria 4161
217 Ga0373955_0188510 3300035172 Bacteria 1225
218 Ga0373961_0080817 3300035241 Unclassified 1022
219 Ga0373924_0011990 3300035410 Bacteria 3229
220 Ga0373931_0006104 3300035691 Bacteria 5614
221 Ga0373931_0006555 3300035691 Bacteria 5445
222 Ga0373931_0023552 3300035691 Bacteria 3110
223 Ga0373931_0029880 3300035691 Bacteria 2802
224 Ga0373931_0155632 3300035691 Bacteria 1336
225 Ga0373935_0001812 3300035692 Bacteria 11998
226 Ga0373927_0000137 3300035695 Bacteria 56546
227 Ga0373927_0051745 3300035695 Bacteria 2656
228 Ga0373927_0139344 3300035695 Bacteria 1586
229 Ga0373927_0446502 3300035695 Bacteria 854
230 Ga0373933_0008530 3300035724 Bacteria 5590
231 Ga0373947_0000902 3300035725 Bacteria 17985
232 Ga0373947_0105413 3300035725 Bacteria 1776
233 Ga0373947_0497785 3300035725 Bacteria 828
234 Ga0373937_0009831 3300036401 Bacteria 8342
235 Ga0373925_0008084 3300037068 Bacteria 7662
236 Ga0436364_0251822 3300037853 Bacteria 14904
237 Ga0436365_0718246 3300039437 Bacteria 887
238 Ga0436365_1492181 3300039437 Bacteria 724
239 Ga0436360_0797357 3300039438 Bacteria 3230
240 Ga0436361_0988749 3300039447 Bacteria 3739
241 Ga0436363_1161476 3300039450 Bacteria 1132
242 Ga0439460_0009833 3300042461 Bacteria 2436
243 Ga0466966_0036671 3300044684 Bacteria 3165
244 Ga0466961_0276545 3300044693 Bacteria 1028
245 Ga0466968_0090074 3300044735 Bacteria 1358
246 Ga0495603_0004836 3300046455 Bacteria 8053
247 Ga0495629_0000029 3300046459 Bacteria 127000
248 Ga0495641_0004254 3300046461 Bacteria 10233
249 Ga0495650_0042034 3300046471 Bacteria 1950
250 Ga0495580_0000321 3300046472 Bacteria 39093
251 Ga0495582_0000024 3300046473 Bacteria 82444
252 Ga0495639_0000006 3300046475 Bacteria 100361
253 Ga0495662_0063063 3300046476 Bacteria 1790
254 Ga0495662_0286717 3300046476 Unclassified 810
255 Ga0495664_0002214 3300046477 Bacteria 10401
256 Ga0495584_0367189 3300046491 Bacteria 731
257 Ga0495594_0405257 3300046499 Unclassified 776
258 Ga0495608_0143933 3300046511 Bacteria 1521
259 Ga0495608_0445499 3300046511 Bacteria 788
260 Ga0495618_0861535 3300046514 Bacteria 525
261 Ga0495628_0118125 3300046516 Bacteria 2036
262 Ga0495630_0026138 3300046517 Bacteria 4320
263 Ga0495652_0005882 3300046529 Bacteria 11474
264 Ga0495652_0355253 3300046529 Bacteria 1049
265 Ga0495665_0000158 3300046531 Bacteria 33789
266 Ga0495640_0020968 3300046533 Bacteria 4804
267 Ga0495640_0028795 3300046533 Unclassified 3995
268 Ga0495640_0053163 3300046533 Unclassified 2778
269 Ga0495645_0423670 3300046543 Bacteria 844
270 Ga0495622_0006975 3300046557 Bacteria 5245
271 Ga0495667_0008458 3300046559 Bacteria 6985
272 Ga0495634_0000354 3300046642 Bacteria 44714
273 Ga0495625_0230224 3300046660 Bacteria 1211
274 Ga0495635_0000179 3300046663 Bacteria 40014
275 Ga0495588_0067181 3300046674 Bacteria 1861
276 Ga0495657_0316045 3300046675 Bacteria 929
277 Ga0495599_0075535 3300046678 Bacteria 2104
278 Ga0495646_0022221 3300046680 Bacteria 4002
279 Ga0495647_0000068 3300046681 Bacteria 25521
280 Ga0495658_0000428 3300046683 Bacteria 23516
281 Ga0495613_0001078 3300046689 Bacteria 20808
282 Ga0495613_0413779 3300046689 Unclassified 918
283 Ga0495624_0012004 3300046690 Bacteria 5937
284 Ga0495581_0000004 3300047315 Bacteria 84424
285 Ga0495581_0440760 3300047315 Unclassified 759
286 Ga0495604_0497007 3300047317 Bacteria 792
287 Ga0495674_0000415 3300047319 Bacteria 38235
288 Ga0495674_0085898 3300047319 Bacteria 2695
289 Ga0495680_0071646 3300047322 Bacteria 2638
290 Ga0495673_0006914 3300047469 Bacteria 6607
291 Ga0495684_0021327 3300047471 Bacteria 4988
292 Ga0495684_0251838 3300047471 Bacteria 1285
293 Ga0495593_0000198 3300047673 Bacteria 31587
294 Ga0496100_0064188 3300048903 Bacteria 2429
295 Ga0496102_0475190 3300048905 Bacteria 1171
296 Ga0496103_0183772 3300048906 Bacteria 1344
297 Ga0496104_0000512 3300048907 Bacteria 33206
298 Ga0496104_0007645 3300048907 Bacteria 9570
299 Ga0496104_0478280 3300048907 Bacteria 1157
300 Ga0496105_0037038 3300048908 Bacteria 4019
301 Ga0496106_0005142 3300048909 Bacteria 9697
302 Ga0496108_0029882 3300048911 Bacteria 4516
303 Ga0496108_0233775 3300048911 Bacteria 1599
304 Ga0496108_0513499 3300048911 Bacteria 1046
305 Ga0496109_0051158 3300048912 Bacteria 3763
306 Ga0496109_0058661 3300048912 Bacteria 3516
307 Ga0496110_0029199 3300048913 Bacteria 4743
308 Ga0496112_0000035 3300048915 Bacteria 106983
309 Ga0496112_0011099 3300048915 Bacteria 8210
310 Ga0496112_0097007 3300048915 Bacteria 2918
311 Ga0496112_0634742 3300048915 Bacteria 999
312 Ga0496113_0051127 3300048916 Bacteria 3083
313 Ga0496113_0708192 3300048916 Bacteria 803
314 Ga0496114_0053462 3300048917 Bacteria 3366
315 Ga0496115_0060281 3300048918 Bacteria 3057
316 Ga0496126_0073483 3300048929 Bacteria 3040
317 Ga0501080_0522640 3300049742 Bacteria 1059
318 nmdc:mga03683_12415_c1 3300050489 Bacteria 3111
319 nmdc:mga03683_80707_c1 3300050489 Bacteria 1404
320 nmdc:mga0yw44_166058_c1 3300050492 Bacteria 1447
321 nmdc:mga0yw44_346354_c1 3300050492 Bacteria 1000
322 nmdc:mga0yw44_59458_c1 3300050492 Bacteria 2338
323 nmdc:mga0k408_111125_c1 3300050493 Bacteria 1620
324 nmdc:mga0k408_257192_c1 3300050493 Bacteria 1042
325 nmdc:mga0k408_744875_c1 3300050493 Bacteria 572
326 nmdc:mga06r32_400253_c1 3300050510 Bacteria 1355
327 nmdc:mga08y16_31708_c1 3300050511 Bacteria 5557
328 nmdc:mga08y16_895965_c1 3300050511 Bacteria 873
329 nmdc:mga0sz30_85481_c1 3300050516 Bacteria 1369
330 Ga0495601_0009522 3300053077 Bacteria 5750
331 Ga0495601_0057268 3300053077 Unclassified 2469
332 Ga0495601_0286418 3300053077 Bacteria 1074
333 Ga0495612_0045265 3300053078 Bacteria 1801
334 Ga0495612_0244144 3300053078 Bacteria 798
335 Ga0495619_0083152 3300053085 Bacteria 2159
336 Ga0495619_0346371 3300053085 Bacteria 1028
337 Ga0500644_0300641 3300053088 Bacteria 687
338 Ga0500616_0001601 3300053153 Bacteria 21092
339 Ga0500636_0106994 3300053177 Bacteria 1584
340 Ga0500552_000054 3300053733 Bacteria 9609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046514 Ga0495618_0861535 Ga0495618_0861535_17_502 158
2 3300050493 nmdc:mga0k408_744875_c1 nmdc:mga0k408_744875_c1_56_550 161
3 3300013306 Ga0163162_11406738 Ga0163162_114067381 174
4 3300005329 Ga0070683_100117092 Ga0070683_1001170923 178
5 3300005336 Ga0070680_100221429 Ga0070680_1002214292 178
6 3300005337 Ga0070682_100306817 Ga0070682_1003068172 178
7 3300005339 Ga0070660_100620953 Ga0070660_1006209531 178
8 3300005341 Ga0070691_10394925 Ga0070691_103949251 178
9 3300005366 Ga0070659_100289888 Ga0070659_1002898882 178
10 3300005458 Ga0070681_10173382 Ga0070681_101733822 178
11 3300005530 Ga0070679_100335789 Ga0070679_1003357892 178
12 3300005539 Ga0068853_100386083 Ga0068853_1003860832 178
13 3300005563 Ga0068855_100567888 Ga0068855_1005678882 178
14 3300009093 Ga0105240_10597818 Ga0105240_105978182 178
15 3300013104 Ga0157370_10035301 Ga0157370_100353014 178
16 3300013105 Ga0157369_10418908 Ga0157369_104189082 178
17 3300025909 Ga0207705_10103477 Ga0207705_101034775 178
18 3300025909 Ga0207705_10470422 Ga0207705_104704221 178
19 3300025912 Ga0207707_10014431 Ga0207707_1001443110 178
20 3300025913 Ga0207695_10102919 Ga0207695_101029191 178
21 3300025914 Ga0207671_10260083 Ga0207671_102600831 178
22 3300025917 Ga0207660_10418006 Ga0207660_104180062 178
23 3300025919 Ga0207657_10625988 Ga0207657_106259882 178
24 3300025921 Ga0207652_10300746 Ga0207652_103007462 178
25 3300025949 Ga0207667_10380464 Ga0207667_103804642 178
26 3300026041 Ga0207639_10490674 Ga0207639_104906741 178
27 3300035725 Ga0373947_0105413 Ga0373947_0105413_925_1467 178
28 3300046476 Ga0495662_0286717 Ga0495662_0286717_229_771 178
29 3300046499 Ga0495594_0405257 Ga0495594_0405257_37_579 178
30 3300046533 Ga0495640_0053163 Ga0495640_0053163_18_560 178
31 3300046689 Ga0495613_0413779 Ga0495613_0413779_160_702 178
32 3300047315 Ga0495581_0440760 Ga0495581_0440760_188_730 178
33 3300053077 Ga0495601_0009522 Ga0495601_0009522_4000_4542 178
34 3300053078 Ga0495612_0045265 Ga0495612_0045265_855_1397 178
35 3300007265 Ga0099794_10035952 Ga0099794_100359522 179
36 3300027671 Ga0209588_1033592 Ga0209588_10335921 179
37 3300035691 Ga0373931_0029880 Ga0373931_0029880_373_921 179
38 3300035695 Ga0373927_0446502 Ga0373927_0446502_235_783 179
39 3300039438 Ga0436360_0797357 Ga0436360_0797357_1644_2192 179
40 3300039447 Ga0436361_0988749 Ga0436361_0988749_2922_3470 179
41 3300048929 Ga0496126_0073483 Ga0496126_0073483_862_1410 179
42 3300050492 nmdc:mga0yw44_346354_c1 nmdc:mga0yw44_346354_c1_292_840 179
43 3300050516 nmdc:mga0sz30_85481_c1 nmdc:mga0sz30_85481_c1_354_902 179
44 iso_pu_bacteria 2883577096 2883579015 186
45 iso_pu_bacteria 2791355197 2793073868 187
46 3300005458 Ga0070681_10136308 Ga0070681_101363081 189
47 3300005563 Ga0068855_100126764 Ga0068855_1001267646 189
48 3300005614 Ga0068856_101181021 Ga0068856_1011810211 189
49 3300009551 Ga0105238_10047072 Ga0105238_100470724 189
50 3300014325 Ga0163163_10095711 Ga0163163_100957114 189
51 3300025913 Ga0207695_10002233 Ga0207695_1000223314 189
52 3300025921 Ga0207652_10275320 Ga0207652_102753202 189
53 3300025924 Ga0207694_10467812 Ga0207694_104678123 189
54 3300025949 Ga0207667_10020497 Ga0207667_100204979 189
55 3300026078 Ga0207702_10645526 Ga0207702_106455263 189
56 3300048907 Ga0496104_0000512 Ga0496104_0000512_29900_30478 189
57 3300048916 Ga0496113_0708192 Ga0496113_0708192_187_765 189
58 3300005327 Ga0070658_10028406 Ga0070658_100284061 190
59 3300005327 Ga0070658_10662769 Ga0070658_106627692 190
60 3300005336 Ga0070680_100005047 Ga0070680_10000504715 190
61 3300005336 Ga0070680_100750129 Ga0070680_1007501291 190
62 3300005339 Ga0070660_100018090 Ga0070660_1000180907 190
63 3300005339 Ga0070660_100452364 Ga0070660_1004523642 190
64 3300005340 Ga0070689_100146657 Ga0070689_1001466573 190
65 3300005344 Ga0070661_100014823 Ga0070661_1000148237 190
66 3300005366 Ga0070659_100013772 Ga0070659_1000137728 190
67 3300005366 Ga0070659_100033720 Ga0070659_1000337206 190
68 3300005435 Ga0070714_100039825 Ga0070714_1000398253 190
69 3300005437 Ga0070710_10023846 Ga0070710_100238462 190
70 3300005437 Ga0070710_10470035 Ga0070710_104700351 190
71 3300005439 Ga0070711_100263672 Ga0070711_1002636722 190
72 3300005530 Ga0070679_100014442 Ga0070679_1000144424 190
73 3300005530 Ga0070679_100044155 Ga0070679_1000441556 190
74 3300005530 Ga0070679_100866723 Ga0070679_1008667231 190
75 3300005539 Ga0068853_100020318 Ga0068853_1000203183 190
76 3300005539 Ga0068853_100212330 Ga0068853_1002123303 190
77 3300005539 Ga0068853_100329527 Ga0068853_1003295275 190
78 3300005563 Ga0068855_100020027 Ga0068855_1000200274 190
79 3300005563 Ga0068855_100050064 Ga0068855_1000500644 190
80 3300005563 Ga0068855_101081081 Ga0068855_1010810812 190
81 3300005577 Ga0068857_100069625 Ga0068857_1000696252 190
82 3300005616 Ga0068852_100013902 Ga0068852_1000139023 190
83 3300005616 Ga0068852_100651646 Ga0068852_1006516461 190
84 3300005842 Ga0068858_100629016 Ga0068858_1006290161 190
85 3300007076 Ga0075435_100890226 Ga0075435_1008902262 190
86 3300009093 Ga0105240_10020405 Ga0105240_100204053 190
87 3300009545 Ga0105237_10176696 Ga0105237_101766962 190
88 3300009551 Ga0105238_10024894 Ga0105238_100248943 190
89 3300009551 Ga0105238_10046039 Ga0105238_100460394 190
90 3300009551 Ga0105238_10572523 Ga0105238_105725233 190
91 3300013100 Ga0157373_10108099 Ga0157373_101080993 190
92 3300013297 Ga0157378_11427407 Ga0157378_114274071 190
93 3300013307 Ga0157372_10342052 Ga0157372_103420522 190
94 3300014968 Ga0157379_10498555 Ga0157379_104985551 190
95 3300021384 Ga0213876_10101935 Ga0213876_101019352 190
96 3300024227 Ga0228598_1030748 Ga0228598_10307481 190
97 3300025898 Ga0207692_10071752 Ga0207692_100717521 190
98 3300025909 Ga0207705_10177743 Ga0207705_101777432 190
99 3300025909 Ga0207705_10212234 Ga0207705_102122341 190
100 3300025913 Ga0207695_10699418 Ga0207695_106994181 190
101 3300025914 Ga0207671_10156663 Ga0207671_101566635 190
102 3300025916 Ga0207663_10225567 Ga0207663_102255672 190
103 3300025917 Ga0207660_10024364 Ga0207660_100243646 190
104 3300025917 Ga0207660_10054251 Ga0207660_100542513 190
105 3300025919 Ga0207657_10004762 Ga0207657_1000476213 190
106 3300025919 Ga0207657_10173374 Ga0207657_101733742 190
107 3300025919 Ga0207657_10674244 Ga0207657_106742441 190
108 3300025919 Ga0207657_10684600 Ga0207657_106846001 190
109 3300025921 Ga0207652_10167087 Ga0207652_101670873 190
110 3300025921 Ga0207652_10753139 Ga0207652_107531392 190
111 3300025921 Ga0207652_10784050 Ga0207652_107840502 190
112 3300025924 Ga0207694_10026667 Ga0207694_100266674 190
113 3300025924 Ga0207694_10055894 Ga0207694_100558946 190
114 3300025925 Ga0207650_10795105 Ga0207650_107951052 190
115 3300025932 Ga0207690_10000288 Ga0207690_1000028820 190
116 3300025932 Ga0207690_10142971 Ga0207690_101429712 190
117 3300025949 Ga0207667_10006492 Ga0207667_100064925 190
118 3300025949 Ga0207667_10024707 Ga0207667_100247073 190
119 3300025949 Ga0207667_10038849 Ga0207667_100388494 190
120 3300026041 Ga0207639_10133710 Ga0207639_101337102 190
121 3300026041 Ga0207639_10325873 Ga0207639_103258733 190
122 3300026142 Ga0207698_10008432 Ga0207698_100084327 190
123 3300026142 Ga0207698_10099007 Ga0207698_100990072 190
124 3300031595 Ga0265313_10020224 Ga0265313_100202244 190
125 3300031711 Ga0265314_10058759 Ga0265314_100587593 190
126 3300031712 Ga0265342_10003512 Ga0265342_100035127 190
127 3300035086 Ga0373934_0007630 Ga0373934_0007630_3211_3792 190
128 3300035115 Ga0373941_0148392 Ga0373941_0148392_239_847 190
129 3300035117 Ga0373953_0011991 Ga0373953_0011991_2419_3000 190
130 3300035118 Ga0373954_0007397 Ga0373954_0007397_878_1459 190
131 3300035119 Ga0373956_0022326 Ga0373956_0022326_531_1112 190
132 3300035120 Ga0373957_0053504 Ga0373957_0053504_194_775 190
133 3300035410 Ga0373924_0011990 Ga0373924_0011990_2347_2928 190
134 3300035691 Ga0373931_0006555 Ga0373931_0006555_1817_2425 190
135 3300035724 Ga0373933_0008530 Ga0373933_0008530_3930_4511 190
136 3300036401 Ga0373937_0009831 Ga0373937_0009831_5972_6553 190
137 3300044684 Ga0466966_0036671 Ga0466966_0036671_598_1176 190
138 3300044693 Ga0466961_0276545 Ga0466961_0276545_243_821 190
139 3300046471 Ga0495650_0042034 Ga0495650_0042034_1083_1661 190
140 3300046529 Ga0495652_0355253 Ga0495652_0355253_232_813 190
141 3300046533 Ga0495640_0028795 Ga0495640_0028795_257_838 190
142 3300046675 Ga0495657_0316045 Ga0495657_0316045_82_663 190
143 3300047471 Ga0495684_0251838 Ga0495684_0251838_617_1198 190
144 3300048905 Ga0496102_0475190 Ga0496102_0475190_12_590 190
145 3300048907 Ga0496104_0007645 Ga0496104_0007645_8059_8637 190
146 3300048908 Ga0496105_0037038 Ga0496105_0037038_474_1052 190
147 3300048911 Ga0496108_0233775 Ga0496108_0233775_16_594 190
148 3300048911 Ga0496108_0513499 Ga0496108_0513499_146_724 190
149 3300048912 Ga0496109_0051158 Ga0496109_0051158_1189_1767 190
150 3300048915 Ga0496112_0011099 Ga0496112_0011099_153_776 190
151 3300048915 Ga0496112_0634742 Ga0496112_0634742_16_594 190
152 3300049742 Ga0501080_0522640 Ga0501080_0522640_68_646 190
153 3300053077 Ga0495601_0057268 Ga0495601_0057268_1372_1953 190
154 3300053078 Ga0495612_0244144 Ga0495612_0244144_128_709 190
155 3300003203 JGI25406J46586_10000233 JGI25406J46586_1000023315 191
156 3300005333 Ga0070677_10172763 Ga0070677_101727631 191
157 3300005347 Ga0070668_100093364 Ga0070668_1000933644 191
158 3300005355 Ga0070671_100507066 Ga0070671_1005070662 191
159 3300005434 Ga0070709_10058614 Ga0070709_100586142 191
160 3300005435 Ga0070714_100057282 Ga0070714_1000572822 191
161 3300005435 Ga0070714_100331854 Ga0070714_1003318542 191
162 3300005455 Ga0070663_100338897 Ga0070663_1003388971 191
163 3300005456 Ga0070678_100335365 Ga0070678_1003353652 191
164 3300005459 Ga0068867_100337781 Ga0068867_1003377812 191
165 3300005471 Ga0070698_100001306 Ga0070698_10000130621 191
166 3300005536 Ga0070697_100045154 Ga0070697_1000451542 191
167 3300005544 Ga0070686_100605686 Ga0070686_1006056861 191
168 3300005548 Ga0070665_100865021 Ga0070665_1008650211 191
169 3300005614 Ga0068856_100202019 Ga0068856_1002020192 191
170 3300005615 Ga0070702_100539393 Ga0070702_1005393931 191
171 3300005616 Ga0068852_100083488 Ga0068852_1000834882 191
172 3300005617 Ga0068859_100546292 Ga0068859_1005462923 191
173 3300005718 Ga0068866_10058711 Ga0068866_100587112 191
174 3300005719 Ga0068861_100094083 Ga0068861_1000940831 191
175 3300005719 Ga0068861_100742198 Ga0068861_1007421981 191
176 3300005842 Ga0068858_100887453 Ga0068858_1008874532 191
177 3300005844 Ga0068862_100162807 Ga0068862_1001628072 191
178 3300005844 Ga0068862_100665354 Ga0068862_1006653542 191
179 3300005937 Ga0081455_10000551 Ga0081455_1000055133 191
180 3300005937 Ga0081455_10176173 Ga0081455_101761732 191
181 3300005937 Ga0081455_10252132 Ga0081455_102521322 191
182 3300005983 Ga0081540_1158446 Ga0081540_11584462 191
183 3300005985 Ga0081539_10002599 Ga0081539_1000259915 191
184 3300005985 Ga0081539_10002833 Ga0081539_1000283321 191
185 3300005985 Ga0081539_10018938 Ga0081539_100189382 191
186 3300006028 Ga0070717_10807143 Ga0070717_108071432 191
187 3300006038 Ga0075365_10082628 Ga0075365_100826282 191
188 3300006177 Ga0075362_10004415 Ga0075362_100044152 191
189 3300006177 Ga0075362_10070687 Ga0075362_100706872 191
190 3300006178 Ga0075367_10095272 Ga0075367_100952723 191
191 3300006186 Ga0075369_10324223 Ga0075369_103242231 191
192 3300006195 Ga0075366_10026120 Ga0075366_100261203 191
193 3300006353 Ga0075370_10392008 Ga0075370_103920081 191
194 3300006358 Ga0068871_100549512 Ga0068871_1005495122 191
195 3300006358 Ga0068871_101176745 Ga0068871_1011767451 191
196 3300006847 Ga0075431_100337220 Ga0075431_1003372202 191
197 3300006881 Ga0068865_100227390 Ga0068865_1002273903 191
198 3300006881 Ga0068865_100591088 Ga0068865_1005910881 191
199 3300007788 Ga0099795_10009533 Ga0099795_100095332 191
200 3300007788 Ga0099795_10083731 Ga0099795_100837311 191
201 3300007788 Ga0099795_10202202 Ga0099795_102022021 191
202 3300009094 Ga0111539_10220629 Ga0111539_102206292 191
203 3300009101 Ga0105247_10162450 Ga0105247_101624502 191
204 3300009147 Ga0114129_12119636 Ga0114129_121196361 191
205 3300009148 Ga0105243_10419810 Ga0105243_104198102 191
206 3300009148 Ga0105243_10945795 Ga0105243_109457951 191
207 3300009176 Ga0105242_10194312 Ga0105242_101943122 191
208 3300009177 Ga0105248_10118079 Ga0105248_101180794 191
209 3300009545 Ga0105237_10144169 Ga0105237_101441692 191
210 3300010159 Ga0099796_10030220 Ga0099796_100302202 191
211 3300010159 Ga0099796_10090828 Ga0099796_100908282 191
212 3300010375 Ga0105239_10131830 Ga0105239_101318302 191
213 3300013297 Ga0157378_10219928 Ga0157378_102199282 191
214 3300013308 Ga0157375_10487036 Ga0157375_104870361 191
215 3300014326 Ga0157380_10054645 Ga0157380_100546452 191
216 3300014326 Ga0157380_11413535 Ga0157380_114135351 191
217 3300014968 Ga0157379_10209807 Ga0157379_102098072 191
218 3300014969 Ga0157376_10468560 Ga0157376_104685602 191
219 3300014969 Ga0157376_11207884 Ga0157376_112078842 191
220 3300021388 Ga0213875_10000169 Ga0213875_1000016937 191
221 3300021441 Ga0213871_10060851 Ga0213871_100608511 191
222 3300025905 Ga0207685_10302623 Ga0207685_103026231 191
223 3300025907 Ga0207645_10133098 Ga0207645_101330982 191
224 3300025910 Ga0207684_10114877 Ga0207684_101148772 191
225 3300025929 Ga0207664_10164152 Ga0207664_101641522 191
226 3300025929 Ga0207664_10382287 Ga0207664_103822872 191
227 3300025931 Ga0207644_11002169 Ga0207644_110021691 191
228 3300025934 Ga0207686_10440888 Ga0207686_104408882 191
229 3300025938 Ga0207704_10314369 Ga0207704_103143691 191
230 3300025939 Ga0207665_10318019 Ga0207665_103180191 191
231 3300025939 Ga0207665_10463269 Ga0207665_104632691 191
232 3300025939 Ga0207665_10564154 Ga0207665_105641542 191
233 3300025940 Ga0207691_10210315 Ga0207691_102103151 191
234 3300025972 Ga0207668_10779306 Ga0207668_107793062 191
235 3300026035 Ga0207703_10737231 Ga0207703_107372312 191
236 3300026078 Ga0207702_10240067 Ga0207702_102400673 191
237 3300026089 Ga0207648_10314578 Ga0207648_103145782 191
238 3300026121 Ga0207683_10322426 Ga0207683_103224261 191
239 3300026142 Ga0207698_10615346 Ga0207698_106153462 191
240 3300027512 Ga0209179_1000903 Ga0209179_10009032 191
241 3300028380 Ga0268265_10185042 Ga0268265_101850422 191
242 3300031456 Ga0307513_10449535 Ga0307513_104495351 191
243 3300034817 Ga0373948_0079563 Ga0373948_0079563_73_654 191
244 3300034819 Ga0373958_0010725 Ga0373958_0010725_686_1267 191
245 3300035085 Ga0373929_0060657 Ga0373929_0060657_190_771 191
246 3300035085 Ga0373929_0109752 Ga0373929_0109752_30_608 191
247 3300035090 Ga0373949_0143760 Ga0373949_0143760_19_597 191
248 3300035091 Ga0373951_0027847 Ga0373951_0027847_425_1006 191
249 3300035112 Ga0373932_0011113 Ga0373932_0011113_221_802 191
250 3300035112 Ga0373932_0057673 Ga0373932_0057673_567_1145 191
251 3300035113 Ga0373936_0030756 Ga0373936_0030756_1146_1730 191
252 3300035113 Ga0373936_0038514 Ga0373936_0038514_248_826 191
253 3300035115 Ga0373941_0153639 Ga0373941_0153639_111_695 191
254 3300035116 Ga0373945_0032976 Ga0373945_0032976_265_843 191
255 3300035118 Ga0373954_0040863 Ga0373954_0040863_436_1014 191
256 3300035119 Ga0373956_0106045 Ga0373956_0106045_686_1264 191
257 3300035121 Ga0373960_0011354 Ga0373960_0011354_769_1350 191
258 3300035170 Ga0373943_0014956 Ga0373943_0014956_1330_1908 191
259 3300035171 Ga0373946_0006789 Ga0373946_0006789_915_1493 191
260 3300035172 Ga0373955_0188510 Ga0373955_0188510_49_627 191
261 3300035241 Ga0373961_0080817 Ga0373961_0080817_418_999 191
262 3300035691 Ga0373931_0006104 Ga0373931_0006104_3765_4343 191
263 3300035691 Ga0373931_0023552 Ga0373931_0023552_685_1266 191
264 3300035691 Ga0373931_0155632 Ga0373931_0155632_99_677 191
265 3300035692 Ga0373935_0001812 Ga0373935_0001812_1032_1610 191
266 3300035695 Ga0373927_0000137 Ga0373927_0000137_33830_34408 191
267 3300035695 Ga0373927_0051745 Ga0373927_0051745_1433_2065 191
268 3300035695 Ga0373927_0139344 Ga0373927_0139344_651_1229 191
269 3300035725 Ga0373947_0000902 Ga0373947_0000902_783_1361 191
270 3300035725 Ga0373947_0497785 Ga0373947_0497785_209_787 191
271 3300037068 Ga0373925_0008084 Ga0373925_0008084_2089_2667 191
272 3300037853 Ga0436364_0251822 Ga0436364_0251822_12581_13162 191
273 3300039437 Ga0436365_0718246 Ga0436365_0718246_88_669 191
274 3300039437 Ga0436365_1492181 Ga0436365_1492181_51_632 191
275 3300039450 Ga0436363_1161476 Ga0436363_1161476_72_653 191
276 3300042461 Ga0439460_0009833 Ga0439460_0009833_973_1581 191
277 3300044735 Ga0466968_0090074 Ga0466968_0090074_229_834 191
278 3300046455 Ga0495603_0004836 Ga0495603_0004836_5977_6555 191
279 3300046459 Ga0495629_0000029 Ga0495629_0000029_33975_34553 191
280 3300046461 Ga0495641_0004254 Ga0495641_0004254_2668_3246 191
281 3300046472 Ga0495580_0000321 Ga0495580_0000321_2585_3163 191
282 3300046473 Ga0495582_0000024 Ga0495582_0000024_33953_34531 191
283 3300046475 Ga0495639_0000006 Ga0495639_0000006_12712_13290 191
284 3300046476 Ga0495662_0063063 Ga0495662_0063063_1170_1748 191
285 3300046477 Ga0495664_0002214 Ga0495664_0002214_6668_7246 191
286 3300046491 Ga0495584_0367189 Ga0495584_0367189_94_672 191
287 3300046511 Ga0495608_0143933 Ga0495608_0143933_82_660 191
288 3300046511 Ga0495608_0445499 Ga0495608_0445499_159_737 191
289 3300046516 Ga0495628_0118125 Ga0495628_0118125_1342_1920 191
290 3300046517 Ga0495630_0026138 Ga0495630_0026138_2156_2734 191
291 3300046529 Ga0495652_0005882 Ga0495652_0005882_7737_8315 191
292 3300046531 Ga0495665_0000158 Ga0495665_0000158_1810_2388 191
293 3300046533 Ga0495640_0020968 Ga0495640_0020968_1318_1896 191
294 3300046543 Ga0495645_0423670 Ga0495645_0423670_60_638 191
295 3300046557 Ga0495622_0006975 Ga0495622_0006975_323_901 191
296 3300046559 Ga0495667_0008458 Ga0495667_0008458_1794_2372 191
297 3300046642 Ga0495634_0000354 Ga0495634_0000354_29375_29953 191
298 3300046660 Ga0495625_0230224 Ga0495625_0230224_374_997 191
299 3300046663 Ga0495635_0000179 Ga0495635_0000179_35259_35837 191
300 3300046674 Ga0495588_0067181 Ga0495588_0067181_178_756 191
301 3300046678 Ga0495599_0075535 Ga0495599_0075535_497_1075 191
302 3300046680 Ga0495646_0022221 Ga0495646_0022221_2121_2699 191
303 3300046681 Ga0495647_0000068 Ga0495647_0000068_7844_8422 191
304 3300046683 Ga0495658_0000428 Ga0495658_0000428_10373_10951 191
305 3300046689 Ga0495613_0001078 Ga0495613_0001078_2215_2793 191
306 3300046690 Ga0495624_0012004 Ga0495624_0012004_5084_5662 191
307 3300047315 Ga0495581_0000004 Ga0495581_0000004_50888_51466 191
308 3300047317 Ga0495604_0497007 Ga0495604_0497007_43_621 191
309 3300047319 Ga0495674_0000415 Ga0495674_0000415_21596_22174 191
310 3300047319 Ga0495674_0085898 Ga0495674_0085898_764_1342 191
311 3300047322 Ga0495680_0071646 Ga0495680_0071646_702_1280 191
312 3300047469 Ga0495673_0006914 Ga0495673_0006914_5898_6476 191
313 3300047471 Ga0495684_0021327 Ga0495684_0021327_1902_2480 191
314 3300047673 Ga0495593_0000198 Ga0495593_0000198_10536_11114 191
315 3300048903 Ga0496100_0064188 Ga0496100_0064188_1377_1955 191
316 3300048906 Ga0496103_0183772 Ga0496103_0183772_726_1304 191
317 3300048907 Ga0496104_0478280 Ga0496104_0478280_33_611 191
318 3300048909 Ga0496106_0005142 Ga0496106_0005142_3757_4335 191
319 3300048911 Ga0496108_0029882 Ga0496108_0029882_1361_1939 191
320 3300048912 Ga0496109_0058661 Ga0496109_0058661_724_1302 191
321 3300048913 Ga0496110_0029199 Ga0496110_0029199_733_1311 191
322 3300048915 Ga0496112_0000035 Ga0496112_0000035_63856_64431 191
323 3300048915 Ga0496112_0097007 Ga0496112_0097007_329_907 191
324 3300048916 Ga0496113_0051127 Ga0496113_0051127_718_1296 191
325 3300048917 Ga0496114_0053462 Ga0496114_0053462_2111_2689 191
326 3300048918 Ga0496115_0060281 Ga0496115_0060281_1908_2486 191
327 3300050489 nmdc:mga03683_12415_c1 nmdc:mga03683_12415_c1_371_955 191
328 3300050489 nmdc:mga03683_80707_c1 nmdc:mga03683_80707_c1_395_979 191
329 3300050492 nmdc:mga0yw44_166058_c1 nmdc:mga0yw44_166058_c1_79_663 191
330 3300050492 nmdc:mga0yw44_59458_c1 nmdc:mga0yw44_59458_c1_242_826 191
331 3300050493 nmdc:mga0k408_111125_c1 nmdc:mga0k408_111125_c1_975_1553 191
332 3300050493 nmdc:mga0k408_257192_c1 nmdc:mga0k408_257192_c1_253_837 191
333 3300050510 nmdc:mga06r32_400253_c1 nmdc:mga06r32_400253_c1_729_1310 191
334 3300050511 nmdc:mga08y16_31708_c1 nmdc:mga08y16_31708_c1_1410_2009 191
335 3300050511 nmdc:mga08y16_895965_c1 nmdc:mga08y16_895965_c1_155_739 191
336 3300053077 Ga0495601_0286418 Ga0495601_0286418_442_1020 191
337 3300053085 Ga0495619_0083152 Ga0495619_0083152_602_1180 191
338 3300053085 Ga0495619_0346371 Ga0495619_0346371_353_931 191
339 3300053088 Ga0500644_0300641 Ga0500644_0300641_39_623 191
340 3300053153 Ga0500616_0001601 Ga0500616_0001601_14934_15518 191
341 3300053177 Ga0500636_0106994 Ga0500636_0106994_245_823 191
342 3300053733 Ga0500552_000054 Ga0500552_000054_6510_7094 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

35

109

0.97

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

40

115

0.91

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

148

216

0.9

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

46

110

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

128

209

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.903 3 183
4f0b-assembly1.cif.gz_B crystal structure of the glutathione transferase ure2p1 from phanerochaete chrysosporium. 0.901 2 181
2x64-assembly2.cif.gz_A glutathione-s-transferase from xylella fastidiosa 0.8999 1 183
6f05-assembly4.cif.gz_D arabidopsis thaliana gstf9, gso3 bound 0.8984 1 182
6f05-assembly2.cif.gz_A arabidopsis thaliana gstf9, gso3 bound 0.898 1 180
ID Description Score Start End Superfamily
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9525 2 75 3.40.30.10
4gf0A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9521 1 78 3.40.30.10
2x64A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9463 1 80 3.40.30.10
af_Q7JVI6_5_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9458 4 75 3.40.30.10
af_I1KAF0_1_75_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9378 3 73 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2A6NAB5-F1-model_v4 Glutathione S-transferase 0.9756 1 191 GO:0016740
AF-A0A1Q3KB35-F1-model_v4 Glutathione S-transferase 0.9722 1 185
AF-A0A2D9F2W1-F1-model_v4 Glutathione S-transferase 0.9708 2 185 GO:0016740
AF-A0A2A6NAB5-F1-model_v4 Glutathione S-transferase 0.9706 1 191 GO:0016740
AF-A0A2E4Y1A4-F1-model_v4 Glutathione S-transferase 0.9686 1 184 GO:0016740

Feature Viewer

pLDDT pTM Quality
94.7 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map