F415195

General Info

Members Datasets Scaffolds Average Seq Length
342 180 684 322

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10007353|Ga0207639_100073538
Length 324
Sequence MEKSNFVDQIRIFCRSGHGGAGSKHFMRNKLTAMGGPDGGAHIILKGNSQLWTLLHLRYFKNVLAENGQNGSKNNSSGLTGKDIIIEVPLGTVARDEETNAVVAEILEDGQEIILAKGGRGGLGNSNFKTATNQAPEYAQPGEWKVLELKVLADVGLVGFPNAGKSTLLSSITAAKPKIADYAFTTLVPQLGMVEYRDGKSFCIADLPGIIEGAAEGKGLGHRFLRHIERNSILLFLIPADSKDHKKEFGILHKELEEYNPEMLQKDFVIAISKSDMLDEELKTAIEKELPKNIPHVFISSVTGLGLQELKDLLWKTLNAPVKQ

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
172 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
173 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
174 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
180 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.97
Nodule 0
Rhizoplane 0.58
Rhizosphere 89.77
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_10007353 3300026041 Bacteria 7506
2 SwRhRL2b_contig_1663676 2162886007 Bacteria 241831
3 JGI25406J46586_10001527 3300003203 Bacteria 10924
4 rootH1_10045052 3300003316 Bacteria 4863
5 rootH2_10006463 3300003320 Bacteria 45674
6 rootH2_10056072 3300003320 Bacteria 3960
7 rootH2_10148925 3300003320 Bacteria 3779
8 rootL2_10060842 3300003322 Bacteria 7201
9 rootL2_10100629 3300003322 Bacteria 1681
10 JGI25160J50197_1003012 3300003354 Bacteria 7679
11 JGI25160J50197_1005456 3300003354 Bacteria 5290
12 Ga0065714_10073881 3300005288 Bacteria 3118
13 Ga0070658_10000626 3300005327 Bacteria 30535
14 Ga0070658_10148931 3300005327 Bacteria 1958
15 Ga0070676_10000167 3300005328 Bacteria 26643
16 Ga0070676_10116625 3300005328 Bacteria 1670
17 Ga0070690_100011489 3300005330 Bacteria 5180
18 Ga0068869_100042923 3300005334 Bacteria 3245
19 Ga0068869_100060371 3300005334 Bacteria 2778
20 Ga0068869_100145461 3300005334 Bacteria 1834
21 Ga0068869_100203872 3300005334 Bacteria 1561
22 Ga0070666_10000064 3300005335 Bacteria 79823
23 Ga0070666_10046785 3300005335 Bacteria 2903
24 Ga0070666_10071267 3300005335 Bacteria 2365
25 Ga0070680_100183931 3300005336 Bacteria 1760
26 Ga0070682_100000041 3300005337 Bacteria 142152
27 Ga0068868_100000280 3300005338 Bacteria 34319
28 Ga0068868_100071839 3300005338 Bacteria 2760
29 Ga0068868_100073261 3300005338 Bacteria 2734
30 Ga0070689_100128758 3300005340 Bacteria 2028
31 Ga0070668_100000267 3300005347 Bacteria 34430
32 Ga0070668_100189505 3300005347 Bacteria 1684
33 Ga0070669_100033600 3300005353 Bacteria 3711
34 Ga0070671_100091215 3300005355 Bacteria 2552
35 Ga0070673_100048435 3300005364 Bacteria 3313
36 Ga0070688_100067129 3300005365 Bacteria 2284
37 Ga0070667_100001041 3300005367 Bacteria 25338
38 Ga0070714_100212909 3300005435 Bacteria 1772
39 Ga0070681_10064250 3300005458 Bacteria 3641
40 Ga0068867_100008995 3300005459 Bacteria 7047
41 Ga0068867_100105862 3300005459 Bacteria 2154
42 Ga0068867_100157568 3300005459 Bacteria 1788
43 Ga0070698_100065707 3300005471 Bacteria 3652
44 Ga0070679_100025584 3300005530 Bacteria 5794
45 Ga0070684_100010994 3300005535 Bacteria 7198
46 Ga0068853_100005441 3300005539 Bacteria 9983
47 Ga0068853_100024232 3300005539 Bacteria 5086
48 Ga0068853_100257738 3300005539 Bacteria 1602
49 Ga0070672_100000310 3300005543 Bacteria 27579
50 Ga0070672_100069121 3300005543 Bacteria 2803
51 Ga0070672_100317566 3300005543 Bacteria 1324
52 Ga0070686_100058576 3300005544 Bacteria 2479
53 Ga0070665_100000845 3300005548 Bacteria 39974
54 Ga0070665_100019827 3300005548 Bacteria 6751
55 Ga0068855_100009549 3300005563 Bacteria 11715
56 Ga0068855_100026762 3300005563 Bacteria 6901
57 Ga0068855_100030104 3300005563 Bacteria 6492
58 Ga0068855_100236281 3300005563 Bacteria 2044
59 Ga0070664_100057516 3300005564 Bacteria 3306
60 Ga0070664_100185490 3300005564 Bacteria 1851
61 Ga0068854_100032661 3300005578 Bacteria 3623
62 Ga0068856_100067002 3300005614 Bacteria 3548
63 Ga0068852_100006842 3300005616 Bacteria 8283
64 Ga0068852_100077982 3300005616 Bacteria 2930
65 Ga0068852_100129118 3300005616 Unclassified 2325
66 Ga0068859_100000003 3300005617 Bacteria 479218
67 Ga0068859_100000872 3300005617 Bacteria 30780
68 Ga0068864_100005189 3300005618 Bacteria 10670
69 Ga0068864_100020807 3300005618 Bacteria 5490
70 Ga0068866_10032012 3300005718 Bacteria 2539
71 Ga0068866_10043881 3300005718 Bacteria 2234
72 Ga0068861_100006132 3300005719 Bacteria 8178
73 Ga0068861_100037225 3300005719 Bacteria 3617
74 Ga0068851_10001250 3300005834 Bacteria 11060
75 Ga0068851_10042627 3300005834 Bacteria 2285
76 Ga0068863_100001446 3300005841 Bacteria 23574
77 Ga0068863_100002398 3300005841 Bacteria 18634
78 Ga0068863_100515293 3300005841 Bacteria 1179
79 Ga0068858_100002672 3300005842 Bacteria 17944
80 Ga0068858_100002928 3300005842 Bacteria 17176
81 Ga0068860_100006378 3300005843 Bacteria 11839
82 Ga0068860_100030292 3300005843 Bacteria 5204
83 Ga0068860_100043752 3300005843 Bacteria 4270
84 Ga0068860_100078567 3300005843 Bacteria 3138
85 Ga0081539_10001794 3300005985 Bacteria 33997
86 Ga0075366_10004746 3300006195 Bacteria 7325
87 Ga0097621_100006034 3300006237 Bacteria 8562
88 Ga0097621_100013337 3300006237 Bacteria 6122
89 Ga0097621_100222283 3300006237 Bacteria 1646
90 Ga0068871_100002911 3300006358 Bacteria 11736
91 Ga0068871_100005277 3300006358 Bacteria 9046
92 Ga0068871_100025501 3300006358 Bacteria 4601
93 Ga0068871_100082942 3300006358 Bacteria 2659
94 Ga0075428_100009481 3300006844 Bacteria 10805
95 Ga0068865_100005619 3300006881 Bacteria 7611
96 Ga0068865_100073467 3300006881 Bacteria 2432
97 Ga0097620_100000003 3300006931 Bacteria 479218
98 Ga0097620_100000872 3300006931 Bacteria 30780
99 Ga0105240_10000011 3300009093 Bacteria 523646
100 Ga0105240_10003002 3300009093 Bacteria 26548
101 Ga0105240_10005046 3300009093 Bacteria 19803
102 Ga0105240_10021850 3300009093 Bacteria 8502
103 Ga0105240_10069171 3300009093 Bacteria 4371
104 Ga0105240_10077291 3300009093 Bacteria 4101
105 Ga0105240_10162782 3300009093 Bacteria 2649
106 Ga0105247_10002345 3300009101 Bacteria 12924
107 Ga0105247_10031004 3300009101 Bacteria 3243
108 Ga0105241_10000543 3300009174 Bacteria 28453
109 Ga0105241_10239249 3300009174 Bacteria 1534
110 Ga0105242_10043154 3300009176 Bacteria 3647
111 Ga0105248_10053027 3300009177 Bacteria 4551
112 Ga0105237_10005614 3300009545 Bacteria 14142
113 Ga0105237_10073493 3300009545 Bacteria 3411
114 Ga0105237_10106263 3300009545 Bacteria 2799
115 Ga0105237_10152972 3300009545 Unclassified 2303
116 Ga0105238_10035260 3300009551 Bacteria 5087
117 Ga0105238_10047287 3300009551 Bacteria 4340
118 Ga0105249_10005321 3300009553 Bacteria 11108
119 Ga0105249_10018347 3300009553 Bacteria 6221
120 Ga0105239_10000488 3300010375 Bacteria 57554
121 Ga0105239_10001268 3300010375 Bacteria 34104
122 Ga0105239_10005650 3300010375 Bacteria 14618
123 Ga0105239_10066603 3300010375 Bacteria 3956
124 Ga0105239_10098587 3300010375 Bacteria 3230
125 Ga0105239_10176169 3300010375 Bacteria 2392
126 Ga0105239_10303194 3300010375 Bacteria 1799
127 Ga0105246_10050439 3300011119 Bacteria 2855
128 Ga0105246_10090751 3300011119 Bacteria 2201
129 Ga0157373_10070764 3300013100 Bacteria 2465
130 Ga0157373_10149794 3300013100 Bacteria 1641
131 Ga0157371_10000654 3300013102 Bacteria 41046
132 Ga0157371_10007130 3300013102 Bacteria 9079
133 Ga0157371_10016206 3300013102 Bacteria 5568
134 Ga0157370_10001484 3300013104 Bacteria 29041
135 Ga0157370_10003750 3300013104 Bacteria 17754
136 Ga0157370_10093872 3300013104 Bacteria 2816
137 Ga0157369_10038639 3300013105 Bacteria 5218
138 Ga0157369_10044130 3300013105 Bacteria 4855
139 Ga0157374_10000168 3300013296 Bacteria 60649
140 Ga0157374_10057151 3300013296 Bacteria 3644
141 Ga0157374_10069208 3300013296 Bacteria 3323
142 Ga0157378_10070483 3300013297 Bacteria 3139
143 Ga0163162_10000359 3300013306 Bacteria 41296
144 Ga0163162_10000725 3300013306 Bacteria 30582
145 Ga0163162_10001104 3300013306 Bacteria 25036
146 Ga0163162_10004389 3300013306 Bacteria 13572
147 Ga0163162_10011167 3300013306 Bacteria 8749
148 Ga0163162_10013259 3300013306 Bacteria 8049
149 Ga0163162_10075172 3300013306 Bacteria 3438
150 Ga0163162_10253849 3300013306 Bacteria 1890
151 Ga0157372_10000747 3300013307 Bacteria 35352
152 Ga0157372_10005321 3300013307 Bacteria 13668
153 Ga0157372_10005908 3300013307 Bacteria 13031
154 Ga0157372_10020633 3300013307 Bacteria 7110
155 Ga0157372_10141826 3300013307 Bacteria 2769
156 Ga0157372_10458903 3300013307 Unclassified 1485
157 Ga0157372_10511532 3300013307 Bacteria 1400
158 Ga0157375_10001148 3300013308 Bacteria 22891
159 Ga0157375_10067619 3300013308 Bacteria 3571
160 Ga0163163_10003161 3300014325 Bacteria 13953
161 Ga0163163_10016566 3300014325 Bacteria 6855
162 Ga0163163_10058914 3300014325 Bacteria 3797
163 Ga0157379_10000810 3300014968 Bacteria 25369
164 Ga0157379_10083500 3300014968 Bacteria 2863
165 Ga0157379_10115788 3300014968 Bacteria 2410
166 Ga0157376_10000827 3300014969 Bacteria 20261
167 Ga0157376_10018546 3300014969 Bacteria 5338
168 Ga0157376_10117332 3300014969 Bacteria 2353
169 Ga0163161_10017470 3300017792 Bacteria 5020
170 Ga0163161_10018033 3300017792 Bacteria 4947
171 Ga0213876_10017067 3300021384 Bacteria 3835
172 Ga0207426_1000040 3300025302 Bacteria 433920
173 Ga0209257_1000007 3300025304 Bacteria 1564415
174 Ga0207656_10005877 3300025321 Bacteria 4374
175 Ga0207710_10000732 3300025900 Bacteria 18146
176 Ga0207688_10179181 3300025901 Bacteria 1263
177 Ga0207680_10000463 3300025903 Bacteria 19165
178 Ga0207680_10001799 3300025903 Bacteria 10121
179 Ga0207680_10010100 3300025903 Bacteria 4712
180 Ga0207647_10001289 3300025904 Bacteria 19277
181 Ga0207647_10006031 3300025904 Bacteria 8835
182 Ga0207647_10043104 3300025904 Bacteria 2825
183 Ga0207645_10003328 3300025907 Bacteria 12257
184 Ga0207645_10200384 3300025907 Bacteria 1313
185 Ga0207705_10006189 3300025909 Bacteria 8901
186 Ga0207654_10006451 3300025911 Bacteria 5906
187 Ga0207695_10000010 3300025913 Bacteria 981919
188 Ga0207695_10001317 3300025913 Bacteria 42084
189 Ga0207695_10002258 3300025913 Bacteria 28855
190 Ga0207695_10005055 3300025913 Bacteria 17689
191 Ga0207695_10044020 3300025913 Bacteria 4752
192 Ga0207695_10044238 3300025913 Bacteria 4737
193 Ga0207695_10270337 3300025913 Bacteria 1595
194 Ga0207695_10336055 3300025913 Bacteria 1399
195 Ga0207671_10001848 3300025914 Bacteria 23634
196 Ga0207671_10003111 3300025914 Bacteria 16871
197 Ga0207662_10023647 3300025918 Bacteria 3532
198 Ga0207652_10000018 3300025921 Bacteria 187527
199 Ga0207681_10157479 3300025923 Bacteria 1708
200 Ga0207650_10342080 3300025925 Bacteria 1229
201 Ga0207659_10179315 3300025926 Bacteria 1677
202 Ga0207644_10151608 3300025931 Bacteria 1794
203 Ga0207686_10116736 3300025934 Bacteria 1809
204 Ga0207669_10204111 3300025937 Bacteria 1437
205 Ga0207669_10321760 3300025937 Bacteria 1184
206 Ga0207691_10000234 3300025940 Bacteria 54055
207 Ga0207691_10023864 3300025940 Bacteria 5756
208 Ga0207691_10134594 3300025940 Bacteria 2181
209 Ga0207689_10012742 3300025942 Bacteria 7183
210 Ga0207689_10028758 3300025942 Bacteria 4648
211 Ga0207689_10068343 3300025942 Bacteria 2920
212 Ga0207661_10092746 3300025944 Bacteria 2518
213 Ga0207679_10018708 3300025945 Bacteria 4646
214 Ga0207679_10106636 3300025945 Bacteria 2203
215 Ga0207667_10001839 3300025949 Bacteria 26648
216 Ga0207667_10009289 3300025949 Bacteria 11600
217 Ga0207667_10208901 3300025949 Bacteria 2001
218 Ga0207712_10009401 3300025961 Bacteria 6186
219 Ga0207712_10121490 3300025961 Bacteria 1977
220 Ga0207668_10002523 3300025972 Bacteria 10687
221 Ga0207658_10002543 3300025986 Bacteria 13258
222 Ga0207677_10048063 3300026023 Bacteria 2870
223 Ga0207677_10152310 3300026023 Bacteria 1786
224 Ga0207703_10007084 3300026035 Bacteria 8922
225 Ga0207703_10049840 3300026035 Bacteria 3386
226 Ga0207639_10005013 3300026041 Bacteria 8918
227 Ga0207639_10133876 3300026041 Bacteria 2055
228 Ga0207639_10300080 3300026041 Bacteria 1420
229 Ga0207702_10017623 3300026078 Bacteria 5910
230 Ga0207641_10000026 3300026088 Bacteria 245091
231 Ga0207641_10016086 3300026088 Bacteria 6127
232 Ga0207648_10009688 3300026089 Bacteria 9214
233 Ga0207676_10007131 3300026095 Bacteria 7917
234 Ga0207676_10020492 3300026095 Bacteria 4839
235 Ga0207676_10471534 3300026095 Bacteria 1187
236 Ga0207675_100011583 3300026118 Bacteria 8247
237 Ga0207675_100052232 3300026118 Bacteria 3814
238 Ga0207675_100304270 3300026118 Bacteria 1553
239 Ga0207683_10176395 3300026121 Bacteria 1937
240 Ga0207698_10001999 3300026142 Bacteria 12012
241 Ga0207698_10012100 3300026142 Bacteria 5630
242 Ga0207428_10018807 3300027907 Bacteria 5895
243 Ga0268266_10003269 3300028379 Bacteria 16320
244 Ga0268266_10007513 3300028379 Bacteria 9825
245 Ga0268264_10001142 3300028381 Bacteria 25957
246 Ga0268264_10058733 3300028381 Bacteria 3222
247 Ga0307515_10000001 3300028794 Bacteria 4259510
248 Ga0307515_10000009 3300028794 Bacteria 653206
249 Ga0307515_10000031 3300028794 Bacteria 358648
250 Ga0265338_10082886 3300028800 Bacteria 2684
251 Ga0265324_10017953 3300029957 Bacteria 2568
252 Ga0265324_10052402 3300029957 Bacteria 1401
253 Ga0265327_10000006 3300031251 Bacteria 693716
254 Ga0265327_10000013 3300031251 Bacteria 519549
255 Ga0265327_10000031 3300031251 Bacteria 325718
256 Ga0265327_10020520 3300031251 Unclassified 4022
257 Ga0265327_10097920 3300031251 Bacteria 1420
258 Ga0307509_10041771 3300031507 Bacteria 4973
259 Ga0307514_10077542 3300031649 Bacteria 2471
260 Ga0307416_100122945 3300032002 Bacteria 2318
261 Ga0307414_10011328 3300032004 Bacteria 5225
262 Ga0373935_0167359 3300035692 Unclassified 1502
263 Ga0395899_0003522 3300037312 Bacteria 12406
264 Ga0395899_0013608 3300037312 Bacteria 6220
265 Ga0395899_0024569 3300037312 Bacteria 4555
266 Ga0395900_0059521 3300037418 Unclassified 3932
267 Ga0395900_0182293 3300037418 Bacteria 2133
268 Ga0395898_0028571 3300037466 Bacteria 5588
269 Ga0395901_0008197 3300038443 Bacteria 10559
270 Ga0395901_0194298 3300038443 Bacteria 2128
271 Ga0436365_0070052 3300039437 Bacteria 17912
272 Ga0451855_1263871 3300041511 Bacteria 13743
273 Ga0451577_0033941 3300042876 Bacteria 4601
274 Ga0451577_0143863 3300042876 Bacteria 2144
275 Ga0466969_0000207 3300044656 Bacteria 32129
276 Ga0466972_0005916 3300044658 Bacteria 6137
277 Ga0466972_0023256 3300044658 Bacteria 3082
278 Ga0453683_0000119 3300044673 Bacteria 117129
279 Ga0466964_0117760 3300044706 Bacteria 1193
280 Ga0453684_0000322 3300044712 Bacteria 202241
281 Ga0453684_0003205 3300044712 Bacteria 37500
282 Ga0453684_0026224 3300044712 Bacteria 8430
283 Ga0453684_0046652 3300044712 Bacteria 5760
284 Ga0453684_0066038 3300044712 Bacteria 4609
285 Ga0453684_0083074 3300044712 Bacteria 3988
286 Ga0453684_0422047 3300044712 Bacteria 1490
287 Ga0466968_0006094 3300044735 Bacteria 4530
288 Ga0466970_0002827 3300044765 Bacteria 8383
289 Ga0466959_0000236 3300045049 Bacteria 34631
290 Ga0451576_0000195 3300045051 Bacteria 153276
291 Ga0451576_0023402 3300045051 Bacteria 6687
292 Ga0451576_0093657 3300045051 Bacteria 3123
293 Ga0451576_0130072 3300045051 Bacteria 2624
294 Ga0451576_0161351 3300045051 Bacteria 2340
295 Ga0451576_0231268 3300045051 Bacteria 1931
296 Ga0451576_0347073 3300045051 Bacteria 1554
297 Ga0495638_0073843 3300046460 Bacteria 2081
298 Ga0495648_0001692 3300046524 Bacteria 21327
299 Ga0495642_0051725 3300046528 Bacteria 1691
300 Ga0495665_0089261 3300046531 Unclassified 1620
301 Ga0495636_0000003 3300047318 Bacteria 132818
302 Ga0496105_0135159 3300048908 Bacteria 2032
303 Ga0496109_0180534 3300048912 Bacteria 1982
304 Ga0496124_0048279 3300048927 Bacteria 3639
305 Ga0501034_0194784 3300049571 Bacteria 1987
306 Ga0501034_0234855 3300049571 Bacteria 1781
307 Ga0501034_0316690 3300049571 Bacteria 1493
308 Ga0501036_0137198 3300049572 Bacteria 2064
309 Ga0501039_0047584 3300049575 Bacteria 3315
310 Ga0501039_0099133 3300049575 Bacteria 2274
311 Ga0501046_0023808 3300049580 Bacteria 5031
312 Ga0501046_0251513 3300049580 Bacteria 1301
313 Ga0501047_0170632 3300049581 Bacteria 2044
314 Ga0501047_0340339 3300049581 Bacteria 1338
315 Ga0501067_0010190 3300049583 Bacteria 5200
316 Ga0501068_0040017 3300049584 Bacteria 2813
317 Ga0501070_0034138 3300049586 Bacteria 4255
318 Ga0501073_0047846 3300049589 Bacteria 3004
319 Ga0501074_0009776 3300049590 Bacteria 6965
320 Ga0501207_000869 3300049654 Bacteria 3613
321 Ga0501079_0055075 3300049741 Bacteria 3069
322 Ga0501080_0025360 3300049742 Bacteria 5501
323 Ga0501083_0067062 3300049744 Bacteria 2389
324 Ga0501035_0038913 3300049822 Bacteria 4306
325 Ga0501035_0045247 3300049822 Bacteria 3960
326 Ga0501044_0129897 3300049823 Bacteria 2514
327 Ga0501044_0317073 3300049823 Bacteria 1484
328 nmdc:mga0k408_15262_c1 3300050493 Bacteria 4244
329 Ga0495619_0033844 3300053085 Unclassified 3320
330 Ga0500646_0036619 3300053090 Bacteria 1367
331 Ga0500583_0001832 3300053092 Bacteria 6227
332 Ga0500556_0021973 3300053104 Bacteria 2066
333 Ga0500562_000012 3300053108 Bacteria 168210
334 Ga0500642_0009654 3300053130 Bacteria 3362
335 Ga0500588_0004291 3300053146 Bacteria 3079
336 Ga0500616_0013764 3300053153 Unclassified 4678
337 Ga0500622_0000404 3300053156 Bacteria 41279
338 Ga0500622_0002409 3300053156 Bacteria 13517
339 Ga0500627_0014840 3300053158 Bacteria 2995
340 Ga0501084_0164726 3300054114 Bacteria 1871
341 Ga0500661_005712 3300055283 Bacteria 2319
342 2884636180 2884634485 Bacteria 3928637
343 Ga0207639_10007353
344 SwRhRL2b_contig_1663676
345 JGI25406J46586_10001527
346 rootH1_10045052
347 rootH2_10006463
348 rootH2_10056072
349 rootH2_10148925
350 rootL2_10060842
351 rootL2_10100629
352 JGI25160J50197_1003012
353 JGI25160J50197_1005456
354 Ga0065714_10073881
355 Ga0070658_10000626
356 Ga0070658_10148931
357 Ga0070676_10000167
358 Ga0070676_10116625
359 Ga0070690_100011489
360 Ga0068869_100042923
361 Ga0068869_100060371
362 Ga0068869_100145461
363 Ga0068869_100203872
364 Ga0070666_10000064
365 Ga0070666_10046785
366 Ga0070666_10071267
367 Ga0070680_100183931
368 Ga0070682_100000041
369 Ga0068868_100000280
370 Ga0068868_100071839
371 Ga0068868_100073261
372 Ga0070689_100128758
373 Ga0070668_100000267
374 Ga0070668_100189505
375 Ga0070669_100033600
376 Ga0070671_100091215
377 Ga0070673_100048435
378 Ga0070688_100067129
379 Ga0070667_100001041
380 Ga0070714_100212909
381 Ga0070681_10064250
382 Ga0068867_100008995
383 Ga0068867_100105862
384 Ga0068867_100157568
385 Ga0070698_100065707
386 Ga0070679_100025584
387 Ga0070684_100010994
388 Ga0068853_100005441
389 Ga0068853_100024232
390 Ga0068853_100257738
391 Ga0070672_100000310
392 Ga0070672_100069121
393 Ga0070672_100317566
394 Ga0070686_100058576
395 Ga0070665_100000845
396 Ga0070665_100019827
397 Ga0068855_100009549
398 Ga0068855_100026762
399 Ga0068855_100030104
400 Ga0068855_100236281
401 Ga0070664_100057516
402 Ga0070664_100185490
403 Ga0068854_100032661
404 Ga0068856_100067002
405 Ga0068852_100006842
406 Ga0068852_100077982
407 Ga0068852_100129118
408 Ga0068859_100000003
409 Ga0068859_100000872
410 Ga0068864_100005189
411 Ga0068864_100020807
412 Ga0068866_10032012
413 Ga0068866_10043881
414 Ga0068861_100006132
415 Ga0068861_100037225
416 Ga0068851_10001250
417 Ga0068851_10042627
418 Ga0068863_100001446
419 Ga0068863_100002398
420 Ga0068863_100515293
421 Ga0068858_100002672
422 Ga0068858_100002928
423 Ga0068860_100006378
424 Ga0068860_100030292
425 Ga0068860_100043752
426 Ga0068860_100078567
427 Ga0081539_10001794
428 Ga0075366_10004746
429 Ga0097621_100006034
430 Ga0097621_100013337
431 Ga0097621_100222283
432 Ga0068871_100002911
433 Ga0068871_100005277
434 Ga0068871_100025501
435 Ga0068871_100082942
436 Ga0075428_100009481
437 Ga0068865_100005619
438 Ga0068865_100073467
439 Ga0097620_100000003
440 Ga0097620_100000872
441 Ga0105240_10000011
442 Ga0105240_10003002
443 Ga0105240_10005046
444 Ga0105240_10021850
445 Ga0105240_10069171
446 Ga0105240_10077291
447 Ga0105240_10162782
448 Ga0105247_10002345
449 Ga0105247_10031004
450 Ga0105241_10000543
451 Ga0105241_10239249
452 Ga0105242_10043154
453 Ga0105248_10053027
454 Ga0105237_10005614
455 Ga0105237_10073493
456 Ga0105237_10106263
457 Ga0105237_10152972
458 Ga0105238_10035260
459 Ga0105238_10047287
460 Ga0105249_10005321
461 Ga0105249_10018347
462 Ga0105239_10000488
463 Ga0105239_10001268
464 Ga0105239_10005650
465 Ga0105239_10066603
466 Ga0105239_10098587
467 Ga0105239_10176169
468 Ga0105239_10303194
469 Ga0105246_10050439
470 Ga0105246_10090751
471 Ga0157373_10070764
472 Ga0157373_10149794
473 Ga0157371_10000654
474 Ga0157371_10007130
475 Ga0157371_10016206
476 Ga0157370_10001484
477 Ga0157370_10003750
478 Ga0157370_10093872
479 Ga0157369_10038639
480 Ga0157369_10044130
481 Ga0157374_10000168
482 Ga0157374_10057151
483 Ga0157374_10069208
484 Ga0157378_10070483
485 Ga0163162_10000359
486 Ga0163162_10000725
487 Ga0163162_10001104
488 Ga0163162_10004389
489 Ga0163162_10011167
490 Ga0163162_10013259
491 Ga0163162_10075172
492 Ga0163162_10253849
493 Ga0157372_10000747
494 Ga0157372_10005321
495 Ga0157372_10005908
496 Ga0157372_10020633
497 Ga0157372_10141826
498 Ga0157372_10458903
499 Ga0157372_10511532
500 Ga0157375_10001148
501 Ga0157375_10067619
502 Ga0163163_10003161
503 Ga0163163_10016566
504 Ga0163163_10058914
505 Ga0157379_10000810
506 Ga0157379_10083500
507 Ga0157379_10115788
508 Ga0157376_10000827
509 Ga0157376_10018546
510 Ga0157376_10117332
511 Ga0163161_10017470
512 Ga0163161_10018033
513 Ga0213876_10017067
514 Ga0207426_1000040
515 Ga0209257_1000007
516 Ga0207656_10005877
517 Ga0207710_10000732
518 Ga0207688_10179181
519 Ga0207680_10000463
520 Ga0207680_10001799
521 Ga0207680_10010100
522 Ga0207647_10001289
523 Ga0207647_10006031
524 Ga0207647_10043104
525 Ga0207645_10003328
526 Ga0207645_10200384
527 Ga0207705_10006189
528 Ga0207654_10006451
529 Ga0207695_10000010
530 Ga0207695_10001317
531 Ga0207695_10002258
532 Ga0207695_10005055
533 Ga0207695_10044020
534 Ga0207695_10044238
535 Ga0207695_10270337
536 Ga0207695_10336055
537 Ga0207671_10001848
538 Ga0207671_10003111
539 Ga0207662_10023647
540 Ga0207652_10000018
541 Ga0207681_10157479
542 Ga0207650_10342080
543 Ga0207659_10179315
544 Ga0207644_10151608
545 Ga0207686_10116736
546 Ga0207669_10204111
547 Ga0207669_10321760
548 Ga0207691_10000234
549 Ga0207691_10023864
550 Ga0207691_10134594
551 Ga0207689_10012742
552 Ga0207689_10028758
553 Ga0207689_10068343
554 Ga0207661_10092746
555 Ga0207679_10018708
556 Ga0207679_10106636
557 Ga0207667_10001839
558 Ga0207667_10009289
559 Ga0207667_10208901
560 Ga0207712_10009401
561 Ga0207712_10121490
562 Ga0207668_10002523
563 Ga0207658_10002543
564 Ga0207677_10048063
565 Ga0207677_10152310
566 Ga0207703_10007084
567 Ga0207703_10049840
568 Ga0207639_10005013
569 Ga0207639_10133876
570 Ga0207639_10300080
571 Ga0207702_10017623
572 Ga0207641_10000026
573 Ga0207641_10016086
574 Ga0207648_10009688
575 Ga0207676_10007131
576 Ga0207676_10020492
577 Ga0207676_10471534
578 Ga0207675_100011583
579 Ga0207675_100052232
580 Ga0207675_100304270
581 Ga0207683_10176395
582 Ga0207698_10001999
583 Ga0207698_10012100
584 Ga0207428_10018807
585 Ga0268266_10003269
586 Ga0268266_10007513
587 Ga0268264_10001142
588 Ga0268264_10058733
589 Ga0307515_10000001
590 Ga0307515_10000009
591 Ga0307515_10000031
592 Ga0265338_10082886
593 Ga0265324_10017953
594 Ga0265324_10052402
595 Ga0265327_10000006
596 Ga0265327_10000013
597 Ga0265327_10000031
598 Ga0265327_10020520
599 Ga0265327_10097920
600 Ga0307509_10041771
601 Ga0307514_10077542
602 Ga0307416_100122945
603 Ga0307414_10011328
604 Ga0373935_0167359
605 Ga0395899_0003522
606 Ga0395899_0013608
607 Ga0395899_0024569
608 Ga0395900_0059521
609 Ga0395900_0182293
610 Ga0395898_0028571
611 Ga0395901_0008197
612 Ga0395901_0194298
613 Ga0436365_0070052
614 Ga0451855_1263871
615 Ga0451577_0033941
616 Ga0451577_0143863
617 Ga0466969_0000207
618 Ga0466972_0005916
619 Ga0466972_0023256
620 Ga0453683_0000119
621 Ga0466964_0117760
622 Ga0453684_0000322
623 Ga0453684_0003205
624 Ga0453684_0026224
625 Ga0453684_0046652
626 Ga0453684_0066038
627 Ga0453684_0083074
628 Ga0453684_0422047
629 Ga0466968_0006094
630 Ga0466970_0002827
631 Ga0466959_0000236
632 Ga0451576_0000195
633 Ga0451576_0023402
634 Ga0451576_0093657
635 Ga0451576_0130072
636 Ga0451576_0161351
637 Ga0451576_0231268
638 Ga0451576_0347073
639 Ga0495638_0073843
640 Ga0495648_0001692
641 Ga0495642_0051725
642 Ga0495665_0089261
643 Ga0495636_0000003
644 Ga0496105_0135159
645 Ga0496109_0180534
646 Ga0496124_0048279
647 Ga0501034_0194784
648 Ga0501034_0234855
649 Ga0501034_0316690
650 Ga0501036_0137198
651 Ga0501039_0047584
652 Ga0501039_0099133
653 Ga0501046_0023808
654 Ga0501046_0251513
655 Ga0501047_0170632
656 Ga0501047_0340339
657 Ga0501067_0010190
658 Ga0501068_0040017
659 Ga0501070_0034138
660 Ga0501073_0047846
661 Ga0501074_0009776
662 Ga0501207_000869
663 Ga0501079_0055075
664 Ga0501080_0025360
665 Ga0501083_0067062
666 Ga0501035_0038913
667 Ga0501035_0045247
668 Ga0501044_0129897
669 Ga0501044_0317073
670 nmdc:mga0k408_15262_c1
671 Ga0495619_0033844
672 Ga0500646_0036619
673 Ga0500583_0001832
674 Ga0500556_0021973
675 Ga0500562_000012
676 Ga0500642_0009654
677 Ga0500588_0004291
678 Ga0500616_0013764
679 Ga0500622_0000404
680 Ga0500622_0002409
681 Ga0500627_0014840
682 Ga0501084_0164726
683 Ga0500661_005712
684 2884636180

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01018

GTP1_OBG

GTP1/OBG

7

151

0.97

PF01926

MMR_HSR1

50S ribosome-binding GTPase

154

274

0.89

PF02421

FeoB_N

Ferrous iron transport protein B

153

314

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7of7-assembly1.cif.gz_x structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset1). 0.8218 9 155
7of7-assembly1.cif.gz_x structure of a human mitochondrial ribosome large subunit assembly intermediate in complex with mterf4-nsun4 and gtpbp5 (dataset1). 0.8118 9 155
3gee-assembly1.cif.gz_A-2 crystal structure of mnme from chlorobium tepidum in complex with gdp and folinic acid 0.7327 161 329
3gei-assembly2.cif.gz_B crystal structure of mnme from chlorobium tepidum in complex with gcp 0.732 161 326
3gei-assembly1.cif.gz_A-2 crystal structure of mnme from chlorobium tepidum in complex with gcp 0.7207 161 329
ID Description Score Start End Superfamily
af_P9WMT1_2_158_2.70.210.12 Mainly Beta;Distorted Sandwich;Spo0b-associated Gtp-binding Protein; Chain: A,;GTP1/OBG domain 0.8785 4 157 2.70.210.12
af_Q4CQ87_40_200_2.70.210.12 Mainly Beta;Distorted Sandwich;Spo0b-associated Gtp-binding Protein; Chain: A,;GTP1/OBG domain 0.8721 6 157 2.70.210.12
5m04A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8709 158 326 3.40.50.300
1lnzB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8657 158 324 3.40.50.300
1lnzB01 Mainly Beta;Distorted Sandwich;Spo0b-associated Gtp-binding Protein; Chain: A,;GTP1/OBG domain 0.8641 6 157 2.70.210.12
ID Description Score Start End GO Terms
AF-A0A355UF75-F1-model_v4 GTPase ObgE 0.9044 230 329 GO:0003924
GO:0005525
AF-A0A800H9P2-F1-model_v4 GTPase ObgE 0.8986 6 159 GO:0003924
GO:0005525
GO:0042254
AF-A0A7C4NJ91-F1-model_v4 GTPase ObgE 0.8973 12 126 GO:0003924
GO:0005525
GO:0042254
AF-A0A257W944-F1-model_v4 GTPase ObgE 0.897 4 102 GO:0003924
GO:0005525
GO:0042254
AF-A0A2E0DSC6-F1-model_v4 GTPase ObgE 0.8956 6 155 GO:0003924
GO:0005525
GO:0042254

Map