F415196

General Info

Members Datasets Scaffolds Average Seq Length
342 134 342 502

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10064639|Ga0207639_100646392
Length 503
Sequence MKYVLYAFLAGAVSAFAFEPVGFWPLMLIAIALLCEWVDRTQSLGRALLIGWAFGLGQFVVGLNWIATSFTYQSNMPAWLGWIAVVLLSLYLAIYPALAVGIGWRLGRDDRVVLVTVLGGAWAITEWLRGSMFTGFPWNPIAAVMAPTPLITITPLIGTYGLSGLVVLLGGAIWLEYYKKWLPLVVILAVTALLWVLPSSPVPPDPLTIRNVRIVQPNIGQEDKWRPGFDEEAARRLAQLSGGPSDQPRLLLWPEAAVTDPLQDGRTGRKQAAEFQRSQAATLLGPGDLLLTGGIAIGSHDGFHVEGAANSIFVLAPGGRIVGRYDKAHLVPYGEYLPMRPLLSAIGLSRLAPGDIDFTPGPGPRTIDLGGEWGKVGFDLCYEIIFSGHVVDWENRPGFIFNPSNDAWFGSWGPPQHLAQARLRAAEEGLPILRATPTGISAVIDARGNVLNSLQWRKAGVIDAVLPPGANSPPPFARFGNVIPLLLGFLLIAGGIVLGRKRR

Samples

Sample ID Description Type Environment
1 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.22
Rhizosphere 96.49
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000764 3300002077 Bacteria 6009
2 Ga0070658_10013180 3300005327 Bacteria 6632
3 Ga0070658_10027077 3300005327 Bacteria 4602
4 Ga0070658_10071322 3300005327 Bacteria 2845
5 Ga0070658_10136310 3300005327 Bacteria 2048
6 Ga0070676_10065073 3300005328 Bacteria 2176
7 Ga0070683_100056120 3300005329 Bacteria 3657
8 Ga0070690_100002262 3300005330 Bacteria 10321
9 Ga0070670_100001163 3300005331 Bacteria 20894
10 Ga0070670_100002964 3300005331 Bacteria 14060
11 Ga0070670_100054928 3300005331 Bacteria 3419
12 Ga0070670_100175752 3300005331 Bacteria 1858
13 Ga0070677_10035943 3300005333 Bacteria 1923
14 Ga0070666_10000415 3300005335 Bacteria 26514
15 Ga0070666_10023503 3300005335 Bacteria 4013
16 Ga0070666_10038142 3300005335 Bacteria 3196
17 Ga0070680_100057207 3300005336 Bacteria 3188
18 Ga0070680_100064898 3300005336 Bacteria 2992
19 Ga0070680_100098034 3300005336 Bacteria 2431
20 Ga0068868_100000422 3300005338 Bacteria 28550
21 Ga0068868_100001497 3300005338 Bacteria 16125
22 Ga0070660_100007252 3300005339 Bacteria 7717
23 Ga0070660_100013537 3300005339 Bacteria 5854
24 Ga0070660_100014106 3300005339 Bacteria 5753
25 Ga0070660_100023818 3300005339 Bacteria 4538
26 Ga0070660_100052355 3300005339 Bacteria 3147
27 Ga0070661_100004015 3300005344 Bacteria 10115
28 Ga0070661_100021659 3300005344 Bacteria 4594
29 Ga0070661_100024601 3300005344 Bacteria 4319
30 Ga0070661_100063588 3300005344 Bacteria 2711
31 Ga0070661_100067628 3300005344 Bacteria 2625
32 Ga0070675_100016044 3300005354 Bacteria 5935
33 Ga0070675_100018671 3300005354 Bacteria 5520
34 Ga0070675_100045187 3300005354 Bacteria 3603
35 Ga0070671_100000793 3300005355 Bacteria 22759
36 Ga0070671_100000972 3300005355 Bacteria 20998
37 Ga0070671_100003799 3300005355 Bacteria 11849
38 Ga0070671_100004515 3300005355 Bacteria 11016
39 Ga0070671_100027398 3300005355 Bacteria 4691
40 Ga0070671_100097871 3300005355 Bacteria 2461
41 Ga0070674_100037339 3300005356 Bacteria 3267
42 Ga0070674_100110220 3300005356 Bacteria 2020
43 Ga0070673_100001888 3300005364 Bacteria 12565
44 Ga0070673_100002090 3300005364 Bacteria 12058
45 Ga0070659_100008541 3300005366 Bacteria 7484
46 Ga0070659_100014473 3300005366 Bacteria 5895
47 Ga0070659_100032416 3300005366 Bacteria 4052
48 Ga0070659_100078274 3300005366 Bacteria 2637
49 Ga0070659_100091454 3300005366 Bacteria 2439
50 Ga0070667_100000839 3300005367 Bacteria 28510
51 Ga0070667_100046858 3300005367 Bacteria 3637
52 Ga0070667_100147058 3300005367 Bacteria 2067
53 Ga0070714_100027365 3300005435 Bacteria 4721
54 Ga0070714_100049107 3300005435 Bacteria 3591
55 Ga0070713_100047407 3300005436 Bacteria 3531
56 Ga0070713_100111776 3300005436 Bacteria 2383
57 Ga0070663_100063817 3300005455 Bacteria 2661
58 Ga0070663_100090897 3300005455 Bacteria 2261
59 Ga0070678_100002943 3300005456 Bacteria 9437
60 Ga0070678_100004841 3300005456 Bacteria 7690
61 Ga0070678_100179113 3300005456 Bacteria 1733
62 Ga0070662_100008474 3300005457 Bacteria 6707
63 Ga0070662_100008891 3300005457 Bacteria 6548
64 Ga0070662_100022000 3300005457 Bacteria 4359
65 Ga0070681_10007172 3300005458 Bacteria 10857
66 Ga0070681_10114877 3300005458 Bacteria 2630
67 Ga0068867_100022263 3300005459 Bacteria 4530
68 Ga0068867_100138473 3300005459 Bacteria 1900
69 Ga0070679_100069792 3300005530 Bacteria 3505
70 Ga0070684_100005653 3300005535 Bacteria 9606
71 Ga0070684_100037770 3300005535 Bacteria 4145
72 Ga0068853_100004267 3300005539 Bacteria 11040
73 Ga0068853_100009256 3300005539 Bacteria 7940
74 Ga0068853_100042931 3300005539 Bacteria 3868
75 Ga0070672_100005547 3300005543 Bacteria 8380
76 Ga0070672_100089453 3300005543 Bacteria 2481
77 Ga0070672_100156959 3300005543 Bacteria 1885
78 Ga0070693_100105511 3300005547 Bacteria 1724
79 Ga0070665_100006465 3300005548 Bacteria 11928
80 Ga0070665_100015898 3300005548 Bacteria 7553
81 Ga0070665_100055144 3300005548 Bacteria 3986
82 Ga0068855_100032229 3300005563 Bacteria 6257
83 Ga0068855_100059294 3300005563 Bacteria 4478
84 Ga0070664_100030779 3300005564 Bacteria 4479
85 Ga0070664_100053340 3300005564 Bacteria 3427
86 Ga0070664_100055539 3300005564 Bacteria 3362
87 Ga0070664_100122650 3300005564 Bacteria 2277
88 Ga0068857_100002945 3300005577 Bacteria 14026
89 Ga0068857_100013108 3300005577 Bacteria 7224
90 Ga0068857_100129837 3300005577 Bacteria 2272
91 Ga0068854_100022349 3300005578 Bacteria 4307
92 Ga0068852_100019099 3300005616 Bacteria 5416
93 Ga0068852_100094783 3300005616 Bacteria 2679
94 Ga0068852_100162079 3300005616 Bacteria 2089
95 Ga0068859_100017890 3300005617 Bacteria 7125
96 Ga0068859_100237185 3300005617 Bacteria 1913
97 Ga0068864_100002647 3300005618 Bacteria 14784
98 Ga0068864_100033431 3300005618 Bacteria 4372
99 Ga0068864_100061483 3300005618 Bacteria 3253
100 Ga0068866_10006572 3300005718 Bacteria 4848
101 Ga0068861_100091162 3300005719 Bacteria 2406
102 Ga0068863_100003826 3300005841 Bacteria 14875
103 Ga0068863_100013454 3300005841 Bacteria 7891
104 Ga0068863_100045248 3300005841 Bacteria 4177
105 Ga0068863_100181895 3300005841 Bacteria 2018
106 Ga0068858_100002839 3300005842 Bacteria 17420
107 Ga0068858_100021025 3300005842 Bacteria 6096
108 Ga0068858_100044996 3300005842 Bacteria 4090
109 Ga0068862_100010517 3300005844 Bacteria 7644
110 Ga0070717_10015183 3300006028 Bacteria 5942
111 Ga0097621_100029577 3300006237 Bacteria 4328
112 Ga0068871_100010746 3300006358 Bacteria 6695
113 Ga0068871_100110396 3300006358 Bacteria 2313
114 Ga0068865_100071728 3300006881 Bacteria 2458
115 Ga0097620_100017889 3300006931 Bacteria 7125
116 Ga0097620_100237173 3300006931 Bacteria 1913
117 Ga0105240_10045206 3300009093 Bacteria 5588
118 Ga0105240_10285413 3300009093 Bacteria 1895
119 Ga0105245_10164404 3300009098 Bacteria 2108
120 Ga0105248_10001057 3300009177 Bacteria 30519
121 Ga0105248_10005810 3300009177 Bacteria 13563
122 Ga0105248_10010048 3300009177 Bacteria 10423
123 Ga0105248_10018337 3300009177 Bacteria 7729
124 Ga0105248_10051179 3300009177 Bacteria 4635
125 Ga0105238_10012193 3300009551 Bacteria 8664
126 Ga0157373_10005671 3300013100 Bacteria 9353
127 Ga0157373_10012132 3300013100 Bacteria 6334
128 Ga0157373_10063023 3300013100 Bacteria 2626
129 Ga0157371_10026352 3300013102 Bacteria 4227
130 Ga0157371_10027174 3300013102 Bacteria 4152
131 Ga0157369_10011443 3300013105 Bacteria 10076
132 Ga0157369_10046822 3300013105 Bacteria 4699
133 Ga0157369_10119233 3300013105 Bacteria 2800
134 Ga0157374_10010518 3300013296 Bacteria 7963
135 Ga0157378_10004520 3300013297 Bacteria 12204
136 Ga0163162_10136175 3300013306 Bacteria 2567
137 Ga0163162_10313340 3300013306 Bacteria 1702
138 Ga0157372_10008388 3300013307 Bacteria 10979
139 Ga0157372_10053290 3300013307 Bacteria 4508
140 Ga0157375_10002274 3300013308 Bacteria 16621
141 Ga0163163_10015289 3300014325 Bacteria 7092
142 Ga0207680_10001418 3300025903 Bacteria 11355
143 Ga0207680_10002741 3300025903 Bacteria 8243
144 Ga0207647_10006862 3300025904 Bacteria 8258
145 Ga0207705_10005981 3300025909 Bacteria 9052
146 Ga0207705_10025577 3300025909 Bacteria 4211
147 Ga0207707_10008599 3300025912 Bacteria 8851
148 Ga0207657_10001862 3300025919 Bacteria 22804
149 Ga0207657_10006116 3300025919 Bacteria 12512
150 Ga0207657_10007208 3300025919 Bacteria 11416
151 Ga0207657_10018691 3300025919 Bacteria 6604
152 Ga0207657_10036733 3300025919 Bacteria 4382
153 Ga0207657_10046162 3300025919 Bacteria 3817
154 Ga0207657_10060461 3300025919 Bacteria 3251
155 Ga0207649_10001822 3300025920 Bacteria 12167
156 Ga0207649_10116897 3300025920 Bacteria 1792
157 Ga0207652_10063872 3300025921 Bacteria 3185
158 Ga0207681_10075167 3300025923 Bacteria 2369
159 Ga0207650_10007458 3300025925 Bacteria 7455
160 Ga0207650_10029165 3300025925 Bacteria 3963
161 Ga0207650_10061670 3300025925 Bacteria 2800
162 Ga0207650_10097937 3300025925 Bacteria 2252
163 Ga0207659_10115641 3300025926 Bacteria 2047
164 Ga0207700_10009950 3300025928 Bacteria 5971
165 Ga0207644_10000151 3300025931 Bacteria 49728
166 Ga0207644_10000649 3300025931 Bacteria 21990
167 Ga0207644_10001389 3300025931 Bacteria 15624
168 Ga0207644_10030859 3300025931 Bacteria 3730
169 Ga0207644_10093127 3300025931 Bacteria 2249
170 Ga0207690_10002490 3300025932 Bacteria 11130
171 Ga0207690_10016732 3300025932 Bacteria 4468
172 Ga0207690_10018310 3300025932 Bacteria 4294
173 Ga0207690_10020466 3300025932 Bacteria 4089
174 Ga0207690_10047306 3300025932 Bacteria 2853
175 Ga0207706_10004393 3300025933 Bacteria 13254
176 Ga0207706_10005360 3300025933 Bacteria 11954
177 Ga0207706_10008821 3300025933 Bacteria 9280
178 Ga0207706_10017447 3300025933 Bacteria 6467
179 Ga0207706_10055223 3300025933 Bacteria 3503
180 Ga0207669_10009588 3300025937 Bacteria 4623
181 Ga0207704_10006443 3300025938 Bacteria 5479
182 Ga0207691_10001996 3300025940 Bacteria 19962
183 Ga0207691_10066394 3300025940 Bacteria 3264
184 Ga0207691_10072344 3300025940 Bacteria 3110
185 Ga0207691_10100935 3300025940 Bacteria 2575
186 Ga0207691_10191578 3300025940 Bacteria 1783
187 Ga0207711_10000372 3300025941 Bacteria 47656
188 Ga0207711_10026434 3300025941 Bacteria 4870
189 Ga0207711_10037093 3300025941 Bacteria 4138
190 Ga0207661_10008381 3300025944 Bacteria 7383
191 Ga0207679_10005784 3300025945 Bacteria 7762
192 Ga0207679_10041033 3300025945 Bacteria 3317
193 Ga0207679_10049456 3300025945 Bacteria 3067
194 Ga0207679_10062722 3300025945 Bacteria 2771
195 Ga0207667_10007293 3300025949 Bacteria 13323
196 Ga0207651_10003650 3300025960 Bacteria 7592
197 Ga0207651_10007905 3300025960 Bacteria 5697
198 Ga0207651_10009146 3300025960 Bacteria 5397
199 Ga0207640_10001487 3300025981 Bacteria 12633
200 Ga0207640_10128460 3300025981 Bacteria 1828
201 Ga0207658_10041103 3300025986 Bacteria 3346
202 Ga0207677_10001036 3300026023 Bacteria 15297
203 Ga0207677_10003316 3300026023 Bacteria 8519
204 Ga0207703_10002334 3300026035 Bacteria 16550
205 Ga0207703_10011355 3300026035 Bacteria 6930
206 Ga0207639_10006754 3300026041 Bacteria 7806
207 Ga0207639_10038701 3300026041 Bacteria 3549
208 Ga0207639_10064639 3300026041 Bacteria 2837
209 Ga0207678_10002357 3300026067 Bacteria 17136
210 Ga0207678_10003157 3300026067 Bacteria 14905
211 Ga0207678_10027593 3300026067 Bacteria 4954
212 Ga0207678_10057418 3300026067 Bacteria 3349
213 Ga0207678_10084624 3300026067 Bacteria 2712
214 Ga0207678_10163663 3300026067 Bacteria 1900
215 Ga0207702_10018039 3300026078 Bacteria 5840
216 Ga0207702_10074200 3300026078 Bacteria 2936
217 Ga0207641_10004390 3300026088 Bacteria 12225
218 Ga0207641_10141709 3300026088 Bacteria 2170
219 Ga0207648_10003598 3300026089 Bacteria 16209
220 Ga0207648_10198533 3300026089 Bacteria 1779
221 Ga0207676_10010603 3300026095 Bacteria 6568
222 Ga0207674_10000271 3300026116 Bacteria 65366
223 Ga0207674_10002348 3300026116 Bacteria 23924
224 Ga0207674_10003100 3300026116 Bacteria 20520
225 Ga0207674_10004321 3300026116 Bacteria 17130
226 Ga0207674_10007396 3300026116 Bacteria 12796
227 Ga0207674_10017182 3300026116 Bacteria 7896
228 Ga0207675_100079426 3300026118 Bacteria 3074
229 Ga0207683_10001537 3300026121 Bacteria 20804
230 Ga0207683_10011713 3300026121 Bacteria 7486
231 Ga0207683_10044085 3300026121 Bacteria 3899
232 Ga0207683_10055457 3300026121 Bacteria 3475
233 Ga0207698_10001098 3300026142 Bacteria 15752
234 Ga0207698_10009892 3300026142 Bacteria 6098
235 Ga0207698_10042339 3300026142 Bacteria 3401
236 Ga0207698_10060309 3300026142 Bacteria 2950
237 Ga0207698_10115372 3300026142 Bacteria 2261
238 Ga0207698_10139170 3300026142 Bacteria 2088
239 Ga0207698_10219872 3300026142 Bacteria 1716
240 Ga0268264_10017142 3300028381 Bacteria 5932
241 Ga0307405_10039547 3300031731 Bacteria 2851
242 Ga0307410_10016242 3300031852 Bacteria 4436
243 Ga0307407_10015175 3300031903 Bacteria 3798
244 Ga0307407_10025630 3300031903 Bacteria 3110
245 Ga0307412_10019409 3300031911 Bacteria 4117
246 Ga0307409_100024442 3300031995 Bacteria 4214
247 Ga0307409_100035859 3300031995 Bacteria 3638
248 Ga0307416_100013954 3300032002 Bacteria 5481
249 Ga0307416_100082878 3300032002 Bacteria 2718
250 Ga0307414_10070788 3300032004 Bacteria 2513
251 Ga0307411_10049321 3300032005 Bacteria 2735
252 Ga0373931_0110220 3300035691 Bacteria 1561
253 Ga0373935_0008624 3300035692 Bacteria 6102
254 Ga0395899_0000224 3300037312 Bacteria 76706
255 Ga0395899_0001507 3300037312 Bacteria 19766
256 Ga0395899_0001939 3300037312 Bacteria 17035
257 Ga0395899_0012487 3300037312 Bacteria 6507
258 Ga0395899_0015520 3300037312 Bacteria 5808
259 Ga0395899_0018641 3300037312 Bacteria 5273
260 Ga0395899_0032369 3300037312 Bacteria 3927
261 Ga0395899_0057163 3300037312 Bacteria 2881
262 Ga0395899_0070761 3300037312 Bacteria 2553
263 Ga0395899_0099130 3300037312 Bacteria 2105
264 Ga0395900_0000294 3300037418 Bacteria 75260
265 Ga0395900_0001134 3300037418 Bacteria 33662
266 Ga0395900_0001825 3300037418 Bacteria 24311
267 Ga0395900_0006054 3300037418 Bacteria 12616
268 Ga0395900_0006995 3300037418 Bacteria 11687
269 Ga0395900_0009264 3300037418 Bacteria 10093
270 Ga0395900_0013611 3300037418 Bacteria 8309
271 Ga0395900_0018427 3300037418 Bacteria 7120
272 Ga0395900_0024203 3300037418 Bacteria 6217
273 Ga0395900_0034344 3300037418 Bacteria 5221
274 Ga0395900_0039005 3300037418 Bacteria 4896
275 Ga0395900_0063319 3300037418 Bacteria 3801
276 Ga0395900_0151210 3300037418 Bacteria 2371
277 Ga0395900_0209684 3300037418 Bacteria 1968
278 Ga0395898_0000192 3300037466 Bacteria 156121
279 Ga0395898_0014210 3300037466 Bacteria 8187
280 Ga0395898_0027215 3300037466 Bacteria 5742
281 Ga0395898_0080574 3300037466 Bacteria 3139
282 Ga0395905_0000066 3300037471 Bacteria 183121
283 Ga0395905_0000128 3300037471 Bacteria 124305
284 Ga0395905_0000358 3300037471 Bacteria 64883
285 Ga0395905_0001563 3300037471 Bacteria 27336
286 Ga0395905_0001888 3300037471 Bacteria 24158
287 Ga0395905_0002566 3300037471 Bacteria 20009
288 Ga0395905_0004430 3300037471 Bacteria 14592
289 Ga0395905_0008910 3300037471 Bacteria 9853
290 Ga0395905_0009612 3300037471 Bacteria 9441
291 Ga0395905_0018538 3300037471 Bacteria 6605
292 Ga0395905_0019492 3300037471 Bacteria 6429
293 Ga0395905_0025444 3300037471 Bacteria 5582
294 Ga0395905_0033571 3300037471 Bacteria 4819
295 Ga0395905_0043331 3300037471 Bacteria 4222
296 Ga0395905_0062723 3300037471 Bacteria 3476
297 Ga0395905_0064570 3300037471 Bacteria 3426
298 Ga0395905_0082877 3300037471 Bacteria 3005
299 Ga0395901_0001222 3300038443 Bacteria 27379
300 Ga0395901_0002896 3300038443 Bacteria 17322
301 Ga0395901_0007314 3300038443 Bacteria 11145
302 Ga0395901_0007334 3300038443 Bacteria 11129
303 Ga0395901_0007475 3300038443 Bacteria 11032
304 Ga0395901_0011351 3300038443 Bacteria 9027
305 Ga0395901_0031525 3300038443 Bacteria 5466
306 Ga0395901_0186680 3300038443 Bacteria 2174
307 Ga0436365_0451685 3300039437 Bacteria 11482
308 Ga0439458_0003327 3300042157 Bacteria 3782
309 Ga0466969_0040353 3300044656 Bacteria 2338
310 Ga0466965_0055435 3300044683 Bacteria 1973
311 Ga0466966_0006529 3300044684 Bacteria 7718
312 Ga0466966_0066091 3300044684 Bacteria 2273
313 Ga0466966_0069536 3300044684 Bacteria 2208
314 Ga0466966_0134637 3300044684 Bacteria 1512
315 Ga0466963_0040702 3300044694 Bacteria 3046
316 Ga0466957_0006974 3300044842 Bacteria 6386
317 Ga0466958_0004049 3300045836 Bacteria 7684
318 Ga0466967_0002033 3300045976 Bacteria 12337
319 Ga0466967_0013379 3300045976 Bacteria 6337
320 Ga0466967_0022711 3300045976 Bacteria 5126
321 Ga0466967_0032864 3300045976 Bacteria 4386
322 Ga0466967_0228187 3300045976 Bacteria 1772
323 Ga0495621_0001404 3300046539 Bacteria 6237
324 Ga0495633_0023856 3300046558 Bacteria 3027
325 Ga0495669_0001085 3300046684 Bacteria 11270
326 Ga0495669_0001756 3300046684 Bacteria 8850
327 Ga0495669_0003643 3300046684 Bacteria 6343
328 Ga0495670_0000431 3300046691 Bacteria 20088
329 Ga0495677_0001724 3300047445 Bacteria 8775
330 Ga0495677_0035389 3300047445 Bacteria 1822
331 Ga0496107_0018516 3300048910 Bacteria 4905
332 Ga0496108_0002625 3300048911 Bacteria 14400
333 Ga0496108_0033736 3300048911 Bacteria 4251
334 Ga0496109_0016123 3300048912 Bacteria 6530
335 Ga0496112_0013940 3300048915 Bacteria 7436
336 Ga0496112_0027102 3300048915 Bacteria 5523
337 Ga0496112_0070191 3300048915 Bacteria 3462
338 Ga0496112_0131328 3300048915 Bacteria 2475
339 Ga0496113_0015615 3300048916 Bacteria 5227
340 Ga0496113_0024836 3300048916 Bacteria 4265
341 Ga0496114_0055976 3300048917 Bacteria 3290
342 Ga0466962_0033125 3300061719 Bacteria 2472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0040702 Ga0466963_0040702_17_1402 460
2 3300037418 Ga0395900_0024203 Ga0395900_0024203_1085_2596 476
3 3300037471 Ga0395905_0008910 Ga0395905_0008910_6527_8038 476
4 3300037312 Ga0395899_0018641 Ga0395899_0018641_1887_3401 477
5 3300037471 Ga0395905_0064570 Ga0395905_0064570_1357_2871 477
6 3300005366 Ga0070659_100032416 Ga0070659_1000324162 480
7 3300005564 Ga0070664_100053340 Ga0070664_1000533404 480
8 3300005577 Ga0068857_100002945 Ga0068857_10000294515 480
9 3300005841 Ga0068863_100003826 Ga0068863_1000038268 480
10 3300025919 Ga0207657_10007208 Ga0207657_1000720812 480
11 3300025925 Ga0207650_10061670 Ga0207650_100616702 480
12 3300025932 Ga0207690_10016732 Ga0207690_100167322 480
13 3300025945 Ga0207679_10041033 Ga0207679_100410332 480
14 3300026067 Ga0207678_10002357 Ga0207678_100023576 480
15 3300026116 Ga0207674_10000271 Ga0207674_1000027154 480
16 3300005327 Ga0070658_10013180 Ga0070658_100131804 483
17 3300005366 Ga0070659_100014473 Ga0070659_1000144733 483
18 3300005539 Ga0068853_100009256 Ga0068853_1000092565 483
19 3300005539 Ga0068853_100042931 Ga0068853_1000429312 483
20 3300005563 Ga0068855_100032229 Ga0068855_1000322296 483
21 3300005578 Ga0068854_100022349 Ga0068854_1000223493 483
22 3300005616 Ga0068852_100019099 Ga0068852_1000190993 483
23 3300009093 Ga0105240_10045206 Ga0105240_100452062 483
24 3300013105 Ga0157369_10011443 Ga0157369_100114436 483
25 3300013296 Ga0157374_10010518 Ga0157374_100105187 483
26 3300025920 Ga0207649_10001822 Ga0207649_1000182211 483
27 3300026041 Ga0207639_10006754 Ga0207639_100067545 483
28 3300026116 Ga0207674_10017182 Ga0207674_100171826 483
29 3300026142 Ga0207698_10001098 Ga0207698_100010986 483
30 3300026142 Ga0207698_10009892 Ga0207698_100098922 483
31 3300037418 Ga0395900_0006995 Ga0395900_0006995_9777_11420 483
32 3300037466 Ga0395898_0014210 Ga0395898_0014210_598_2241 483
33 3300037471 Ga0395905_0009612 Ga0395905_0009612_3138_4781 483
34 3300038443 Ga0395901_0011351 Ga0395901_0011351_1438_3081 483
35 3300045976 Ga0466967_0032864 Ga0466967_0032864_545_2122 483
36 3300037471 Ga0395905_0082877 Ga0395905_0082877_648_2162 484
37 3300044684 Ga0466966_0134637 Ga0466966_0134637_20_1498 484
38 3300045976 Ga0466967_0228187 Ga0466967_0228187_34_1563 484
39 3300005355 Ga0070671_100004515 Ga0070671_10000451514 485
40 3300005564 Ga0070664_100122650 Ga0070664_1001226501 485
41 3300005616 Ga0068852_100094783 Ga0068852_1000947833 485
42 3300005618 Ga0068864_100033431 Ga0068864_1000334314 485
43 3300006358 Ga0068871_100110396 Ga0068871_1001103962 485
44 3300025909 Ga0207705_10025577 Ga0207705_100255774 485
45 3300044684 Ga0466966_0069536 Ga0466966_0069536_265_1779 485
46 3300048915 Ga0496112_0131328 Ga0496112_0131328_277_1791 485
47 3300005617 Ga0068859_100237185 Ga0068859_1002371851 486
48 3300006931 Ga0097620_100237173 Ga0097620_1002371731 486
49 3300009177 Ga0105248_10051179 Ga0105248_100511792 486
50 3300025941 Ga0207711_10026434 Ga0207711_100264342 486
51 3300031995 Ga0307409_100024442 Ga0307409_1000244424 486
52 3300045976 Ga0466967_0002033 Ga0466967_0002033_3751_5265 486
53 3300045976 Ga0466967_0022711 Ga0466967_0022711_3492_5006 486
54 3300005366 Ga0070659_100078274 Ga0070659_1000782742 488
55 3300048911 Ga0496108_0002625 Ga0496108_0002625_381_1895 488
56 3300026116 Ga0207674_10007396 Ga0207674_1000739612 489
57 3300037312 Ga0395899_0057163 Ga0395899_0057163_1105_2619 489
58 3300037418 Ga0395900_0001134 Ga0395900_0001134_9037_10551 489
59 3300037471 Ga0395905_0002566 Ga0395905_0002566_10873_12387 489
60 3300005457 Ga0070662_100008891 Ga0070662_1000088913 490
61 3300013100 Ga0157373_10012132 Ga0157373_100121321 490
62 3300025919 Ga0207657_10006116 Ga0207657_100061166 490
63 3300025933 Ga0207706_10008821 Ga0207706_100088212 490
64 3300025945 Ga0207679_10049456 Ga0207679_100494562 490
65 3300005356 Ga0070674_100110220 Ga0070674_1001102201 492
66 3300005457 Ga0070662_100022000 Ga0070662_1000220002 492
67 3300005543 Ga0070672_100089453 Ga0070672_1000894531 492
68 3300005577 Ga0068857_100013108 Ga0068857_1000131085 492
69 3300005617 Ga0068859_100017890 Ga0068859_1000178904 492
70 3300005618 Ga0068864_100061483 Ga0068864_1000614833 492
71 3300005719 Ga0068861_100091162 Ga0068861_1000911622 492
72 3300005841 Ga0068863_100045248 Ga0068863_1000452481 492
73 3300005842 Ga0068858_100021025 Ga0068858_1000210255 492
74 3300005844 Ga0068862_100010517 Ga0068862_1000105177 492
75 3300006881 Ga0068865_100071728 Ga0068865_1000717282 492
76 3300006931 Ga0097620_100017889 Ga0097620_1000178894 492
77 3300025940 Ga0207691_10100935 Ga0207691_101009352 492
78 3300025945 Ga0207679_10005784 Ga0207679_100057847 492
79 3300026067 Ga0207678_10057418 Ga0207678_100574183 492
80 3300026095 Ga0207676_10010603 Ga0207676_100106034 492
81 3300026116 Ga0207674_10002348 Ga0207674_1000234810 492
82 3300026118 Ga0207675_100079426 Ga0207675_1000794263 492
83 3300026121 Ga0207683_10044085 Ga0207683_100440852 492
84 3300028381 Ga0268264_10017142 Ga0268264_100171423 492
85 3300044683 Ga0466965_0055435 Ga0466965_0055435_251_1765 492
86 3300047445 Ga0495677_0001724 Ga0495677_0001724_5376_6890 492
87 3300035691 Ga0373931_0110220 Ga0373931_0110220_16_1530 493
88 3300048915 Ga0496112_0070191 Ga0496112_0070191_745_2259 493
89 3300005331 Ga0070670_100054928 Ga0070670_1000549284 495
90 3300005355 Ga0070671_100003799 Ga0070671_10000379911 495
91 3300005618 Ga0068864_100002647 Ga0068864_1000026476 495
92 3300005841 Ga0068863_100013454 Ga0068863_1000134547 495
93 3300009177 Ga0105248_10010048 Ga0105248_100100488 495
94 3300037312 Ga0395899_0001939 Ga0395899_0001939_13440_14954 495
95 3300037418 Ga0395900_0034344 Ga0395900_0034344_3343_4857 495
96 3300037471 Ga0395905_0001888 Ga0395905_0001888_8377_9891 495
97 3300038443 Ga0395901_0007334 Ga0395901_0007334_4646_6160 495
98 3300048915 Ga0496112_0013940 Ga0496112_0013940_757_2271 495
99 3300048916 Ga0496113_0024836 Ga0496113_0024836_211_1725 495
100 3300037312 Ga0395899_0099130 Ga0395899_0099130_68_1582 496
101 3300037418 Ga0395900_0018427 Ga0395900_0018427_927_2441 496
102 3300038443 Ga0395901_0186680 Ga0395901_0186680_273_1787 496
103 3300037418 Ga0395900_0001825 Ga0395900_0001825_16799_18319 497
104 3300037471 Ga0395905_0000128 Ga0395905_0000128_80124_81644 497
105 3300038443 Ga0395901_0002896 Ga0395901_0002896_3334_4854 497
106 3300032005 Ga0307411_10049321 Ga0307411_100493212 499
107 3300025925 Ga0207650_10097937 Ga0207650_100979372 501
108 3300031852 Ga0307410_10016242 Ga0307410_100162424 501
109 3300032002 Ga0307416_100082878 Ga0307416_1000828782 501
110 3300005327 Ga0070658_10136310 Ga0070658_101363102 502
111 3300005330 Ga0070690_100002262 Ga0070690_1000022628 502
112 3300005335 Ga0070666_10000415 Ga0070666_1000041523 502
113 3300005336 Ga0070680_100057207 Ga0070680_1000572071 502
114 3300005338 Ga0068868_100000422 Ga0068868_10000042216 502
115 3300005339 Ga0070660_100052355 Ga0070660_1000523552 502
116 3300005344 Ga0070661_100063588 Ga0070661_1000635883 502
117 3300005355 Ga0070671_100027398 Ga0070671_1000273985 502
118 3300005356 Ga0070674_100037339 Ga0070674_1000373392 502
119 3300005367 Ga0070667_100000839 Ga0070667_10000083924 502
120 3300005458 Ga0070681_10114877 Ga0070681_101148773 502
121 3300005459 Ga0068867_100138473 Ga0068867_1001384731 502
122 3300005543 Ga0070672_100156959 Ga0070672_1001569592 502
123 3300005616 Ga0068852_100162079 Ga0068852_1001620791 502
124 3300005842 Ga0068858_100002839 Ga0068858_10000283918 502
125 3300009098 Ga0105245_10164404 Ga0105245_101644041 502
126 3300009177 Ga0105248_10001057 Ga0105248_100010575 502
127 3300013306 Ga0163162_10313340 Ga0163162_103133401 502
128 3300025903 Ga0207680_10001418 Ga0207680_100014185 502
129 3300025904 Ga0207647_10006862 Ga0207647_1000686212 502
130 3300025919 Ga0207657_10036733 Ga0207657_100367335 502
131 3300025931 Ga0207644_10093127 Ga0207644_100931272 502
132 3300025937 Ga0207669_10009588 Ga0207669_100095882 502
133 3300025941 Ga0207711_10000372 Ga0207711_1000037217 502
134 3300025986 Ga0207658_10041103 Ga0207658_100411032 502
135 3300026023 Ga0207677_10001036 Ga0207677_100010365 502
136 3300026035 Ga0207703_10002334 Ga0207703_1000233416 502
137 3300026041 Ga0207639_10064639 Ga0207639_100646392 502
138 3300026089 Ga0207648_10198533 Ga0207648_101985331 502
139 3300026142 Ga0207698_10115372 Ga0207698_101153722 502
140 3300026142 Ga0207698_10139170 Ga0207698_101391701 502
141 3300031903 Ga0307407_10025630 Ga0307407_100256302 502
142 3300037471 Ga0395905_0018538 Ga0395905_0018538_1284_2795 502
143 3300037471 Ga0395905_0025444 Ga0395905_0025444_1793_3304 502
144 3300046539 Ga0495621_0001404 Ga0495621_0001404_2484_3998 502
145 3300046558 Ga0495633_0023856 Ga0495633_0023856_202_1716 502
146 3300046684 Ga0495669_0001756 Ga0495669_0001756_3787_5301 502
147 3300046691 Ga0495670_0000431 Ga0495670_0000431_14540_16054 502
148 3300002077 JGI24744J21845_10000764 JGI24744J21845_100007645 503
149 3300005327 Ga0070658_10027077 Ga0070658_100270774 503
150 3300005327 Ga0070658_10071322 Ga0070658_100713222 503
151 3300005328 Ga0070676_10065073 Ga0070676_100650731 503
152 3300005329 Ga0070683_100056120 Ga0070683_1000561202 503
153 3300005331 Ga0070670_100001163 Ga0070670_10000116315 503
154 3300005331 Ga0070670_100002964 Ga0070670_1000029649 503
155 3300005331 Ga0070670_100175752 Ga0070670_1001757521 503
156 3300005333 Ga0070677_10035943 Ga0070677_100359432 503
157 3300005335 Ga0070666_10023503 Ga0070666_100235032 503
158 3300005335 Ga0070666_10038142 Ga0070666_100381423 503
159 3300005336 Ga0070680_100064898 Ga0070680_1000648982 503
160 3300005336 Ga0070680_100098034 Ga0070680_1000980343 503
161 3300005338 Ga0068868_100001497 Ga0068868_1000014973 503
162 3300005339 Ga0070660_100007252 Ga0070660_1000072524 503
163 3300005339 Ga0070660_100013537 Ga0070660_1000135373 503
164 3300005339 Ga0070660_100014106 Ga0070660_1000141066 503
165 3300005339 Ga0070660_100023818 Ga0070660_1000238185 503
166 3300005344 Ga0070661_100004015 Ga0070661_10000401513 503
167 3300005344 Ga0070661_100021659 Ga0070661_1000216592 503
168 3300005344 Ga0070661_100024601 Ga0070661_1000246012 503
169 3300005344 Ga0070661_100067628 Ga0070661_1000676281 503
170 3300005354 Ga0070675_100016044 Ga0070675_1000160445 503
171 3300005354 Ga0070675_100018671 Ga0070675_1000186712 503
172 3300005354 Ga0070675_100045187 Ga0070675_1000451871 503
173 3300005355 Ga0070671_100000793 Ga0070671_1000007936 503
174 3300005355 Ga0070671_100000972 Ga0070671_10000097214 503
175 3300005355 Ga0070671_100097871 Ga0070671_1000978712 503
176 3300005364 Ga0070673_100001888 Ga0070673_10000188812 503
177 3300005364 Ga0070673_100002090 Ga0070673_10000209015 503
178 3300005366 Ga0070659_100008541 Ga0070659_1000085415 503
179 3300005366 Ga0070659_100091454 Ga0070659_1000914542 503
180 3300005367 Ga0070667_100046858 Ga0070667_1000468582 503
181 3300005367 Ga0070667_100147058 Ga0070667_1001470581 503
182 3300005435 Ga0070714_100027365 Ga0070714_1000273654 503
183 3300005435 Ga0070714_100049107 Ga0070714_1000491073 503
184 3300005436 Ga0070713_100047407 Ga0070713_1000474072 503
185 3300005436 Ga0070713_100111776 Ga0070713_1001117763 503
186 3300005455 Ga0070663_100063817 Ga0070663_1000638173 503
187 3300005455 Ga0070663_100090897 Ga0070663_1000908972 503
188 3300005456 Ga0070678_100002943 Ga0070678_1000029437 503
189 3300005456 Ga0070678_100004841 Ga0070678_1000048417 503
190 3300005456 Ga0070678_100179113 Ga0070678_1001791131 503
191 3300005457 Ga0070662_100008474 Ga0070662_1000084742 503
192 3300005458 Ga0070681_10007172 Ga0070681_100071725 503
193 3300005459 Ga0068867_100022263 Ga0068867_1000222635 503
194 3300005530 Ga0070679_100069792 Ga0070679_1000697922 503
195 3300005535 Ga0070684_100005653 Ga0070684_10000565312 503
196 3300005535 Ga0070684_100037770 Ga0070684_1000377705 503
197 3300005539 Ga0068853_100004267 Ga0068853_10000426713 503
198 3300005543 Ga0070672_100005547 Ga0070672_1000055475 503
199 3300005547 Ga0070693_100105511 Ga0070693_1001055111 503
200 3300005548 Ga0070665_100006465 Ga0070665_10000646515 503
201 3300005548 Ga0070665_100015898 Ga0070665_1000158984 503
202 3300005548 Ga0070665_100055144 Ga0070665_1000551443 503
203 3300005563 Ga0068855_100059294 Ga0068855_1000592945 503
204 3300005564 Ga0070664_100030779 Ga0070664_1000307795 503
205 3300005564 Ga0070664_100055539 Ga0070664_1000555392 503
206 3300005577 Ga0068857_100129837 Ga0068857_1001298372 503
207 3300005718 Ga0068866_10006572 Ga0068866_100065721 503
208 3300005841 Ga0068863_100181895 Ga0068863_1001818952 503
209 3300005842 Ga0068858_100044996 Ga0068858_1000449965 503
210 3300006028 Ga0070717_10015183 Ga0070717_100151836 503
211 3300006237 Ga0097621_100029577 Ga0097621_1000295772 503
212 3300006358 Ga0068871_100010746 Ga0068871_1000107466 503
213 3300009093 Ga0105240_10285413 Ga0105240_102854131 503
214 3300009177 Ga0105248_10005810 Ga0105248_1000581015 503
215 3300009177 Ga0105248_10018337 Ga0105248_100183373 503
216 3300009551 Ga0105238_10012193 Ga0105238_100121931 503
217 3300013100 Ga0157373_10005671 Ga0157373_100056712 503
218 3300013100 Ga0157373_10063023 Ga0157373_100630232 503
219 3300013102 Ga0157371_10026352 Ga0157371_100263522 503
220 3300013102 Ga0157371_10027174 Ga0157371_100271742 503
221 3300013105 Ga0157369_10046822 Ga0157369_100468224 503
222 3300013105 Ga0157369_10119233 Ga0157369_101192332 503
223 3300013297 Ga0157378_10004520 Ga0157378_100045201 503
224 3300013306 Ga0163162_10136175 Ga0163162_101361752 503
225 3300013307 Ga0157372_10008388 Ga0157372_100083884 503
226 3300013307 Ga0157372_10053290 Ga0157372_100532905 503
227 3300013308 Ga0157375_10002274 Ga0157375_100022742 503
228 3300014325 Ga0163163_10015289 Ga0163163_100152898 503
229 3300025903 Ga0207680_10002741 Ga0207680_100027413 503
230 3300025909 Ga0207705_10005981 Ga0207705_1000598112 503
231 3300025912 Ga0207707_10008599 Ga0207707_100085996 503
232 3300025919 Ga0207657_10001862 Ga0207657_1000186214 503
233 3300025919 Ga0207657_10018691 Ga0207657_100186917 503
234 3300025919 Ga0207657_10046162 Ga0207657_100461622 503
235 3300025919 Ga0207657_10060461 Ga0207657_100604613 503
236 3300025920 Ga0207649_10116897 Ga0207649_101168972 503
237 3300025921 Ga0207652_10063872 Ga0207652_100638723 503
238 3300025923 Ga0207681_10075167 Ga0207681_100751672 503
239 3300025925 Ga0207650_10007458 Ga0207650_100074588 503
240 3300025925 Ga0207650_10029165 Ga0207650_100291652 503
241 3300025926 Ga0207659_10115641 Ga0207659_101156412 503
242 3300025928 Ga0207700_10009950 Ga0207700_100099507 503
243 3300025931 Ga0207644_10000151 Ga0207644_1000015142 503
244 3300025931 Ga0207644_10000649 Ga0207644_100006499 503
245 3300025931 Ga0207644_10001389 Ga0207644_100013893 503
246 3300025931 Ga0207644_10030859 Ga0207644_100308593 503
247 3300025932 Ga0207690_10002490 Ga0207690_100024904 503
248 3300025932 Ga0207690_10018310 Ga0207690_100183104 503
249 3300025932 Ga0207690_10020466 Ga0207690_100204664 503
250 3300025932 Ga0207690_10047306 Ga0207690_100473062 503
251 3300025933 Ga0207706_10004393 Ga0207706_100043935 503
252 3300025933 Ga0207706_10005360 Ga0207706_100053609 503
253 3300025933 Ga0207706_10017447 Ga0207706_100174472 503
254 3300025933 Ga0207706_10055223 Ga0207706_100552232 503
255 3300025938 Ga0207704_10006443 Ga0207704_100064435 503
256 3300025940 Ga0207691_10001996 Ga0207691_1000199616 503
257 3300025940 Ga0207691_10066394 Ga0207691_100663942 503
258 3300025940 Ga0207691_10072344 Ga0207691_100723442 503
259 3300025940 Ga0207691_10191578 Ga0207691_101915781 503
260 3300025941 Ga0207711_10037093 Ga0207711_100370934 503
261 3300025944 Ga0207661_10008381 Ga0207661_100083819 503
262 3300025945 Ga0207679_10062722 Ga0207679_100627222 503
263 3300025949 Ga0207667_10007293 Ga0207667_1000729311 503
264 3300025960 Ga0207651_10003650 Ga0207651_100036503 503
265 3300025960 Ga0207651_10007905 Ga0207651_100079054 503
266 3300025960 Ga0207651_10009146 Ga0207651_100091465 503
267 3300025981 Ga0207640_10001487 Ga0207640_1000148710 503
268 3300025981 Ga0207640_10128460 Ga0207640_101284601 503
269 3300026023 Ga0207677_10003316 Ga0207677_100033167 503
270 3300026035 Ga0207703_10011355 Ga0207703_100113555 503
271 3300026041 Ga0207639_10038701 Ga0207639_100387013 503
272 3300026067 Ga0207678_10003157 Ga0207678_1000315713 503
273 3300026067 Ga0207678_10027593 Ga0207678_100275934 503
274 3300026067 Ga0207678_10084624 Ga0207678_100846243 503
275 3300026067 Ga0207678_10163663 Ga0207678_101636632 503
276 3300026078 Ga0207702_10018039 Ga0207702_100180395 503
277 3300026078 Ga0207702_10074200 Ga0207702_100742001 503
278 3300026088 Ga0207641_10004390 Ga0207641_1000439011 503
279 3300026088 Ga0207641_10141709 Ga0207641_101417092 503
280 3300026089 Ga0207648_10003598 Ga0207648_1000359816 503
281 3300026116 Ga0207674_10003100 Ga0207674_1000310018 503
282 3300026116 Ga0207674_10004321 Ga0207674_1000432122 503
283 3300026121 Ga0207683_10001537 Ga0207683_1000153724 503
284 3300026121 Ga0207683_10011713 Ga0207683_100117138 503
285 3300026121 Ga0207683_10055457 Ga0207683_100554573 503
286 3300026142 Ga0207698_10042339 Ga0207698_100423392 503
287 3300026142 Ga0207698_10060309 Ga0207698_100603094 503
288 3300026142 Ga0207698_10219872 Ga0207698_102198722 503
289 3300031731 Ga0307405_10039547 Ga0307405_100395472 503
290 3300031903 Ga0307407_10015175 Ga0307407_100151753 503
291 3300031911 Ga0307412_10019409 Ga0307412_100194093 503
292 3300031995 Ga0307409_100035859 Ga0307409_1000358593 503
293 3300032002 Ga0307416_100013954 Ga0307416_1000139545 503
294 3300032004 Ga0307414_10070788 Ga0307414_100707882 503
295 3300035692 Ga0373935_0008624 Ga0373935_0008624_2368_3882 503
296 3300037312 Ga0395899_0000224 Ga0395899_0000224_43375_44889 503
297 3300037312 Ga0395899_0001507 Ga0395899_0001507_10935_12449 503
298 3300037312 Ga0395899_0012487 Ga0395899_0012487_1451_2965 503
299 3300037312 Ga0395899_0015520 Ga0395899_0015520_1886_3400 503
300 3300037312 Ga0395899_0032369 Ga0395899_0032369_996_2510 503
301 3300037312 Ga0395899_0070761 Ga0395899_0070761_370_1884 503
302 3300037418 Ga0395900_0000294 Ga0395900_0000294_56163_57677 503
303 3300037418 Ga0395900_0006054 Ga0395900_0006054_3712_5226 503
304 3300037418 Ga0395900_0009264 Ga0395900_0009264_2110_3624 503
305 3300037418 Ga0395900_0013611 Ga0395900_0013611_1944_3458 503
306 3300037418 Ga0395900_0039005 Ga0395900_0039005_3237_4751 503
307 3300037418 Ga0395900_0063319 Ga0395900_0063319_1291_2805 503
308 3300037418 Ga0395900_0151210 Ga0395900_0151210_141_1655 503
309 3300037418 Ga0395900_0209684 Ga0395900_0209684_326_1840 503
310 3300037466 Ga0395898_0000192 Ga0395898_0000192_125401_126915 503
311 3300037466 Ga0395898_0027215 Ga0395898_0027215_523_2037 503
312 3300037466 Ga0395898_0080574 Ga0395898_0080574_983_2497 503
313 3300037471 Ga0395905_0000066 Ga0395905_0000066_125445_126959 503
314 3300037471 Ga0395905_0000358 Ga0395905_0000358_50914_52428 503
315 3300037471 Ga0395905_0001563 Ga0395905_0001563_5609_7123 503
316 3300037471 Ga0395905_0004430 Ga0395905_0004430_4903_6417 503
317 3300037471 Ga0395905_0019492 Ga0395905_0019492_2207_3721 503
318 3300037471 Ga0395905_0033571 Ga0395905_0033571_2662_4176 503
319 3300037471 Ga0395905_0043331 Ga0395905_0043331_2218_3822 503
320 3300037471 Ga0395905_0062723 Ga0395905_0062723_964_2478 503
321 3300038443 Ga0395901_0001222 Ga0395901_0001222_20724_22238 503
322 3300038443 Ga0395901_0007314 Ga0395901_0007314_997_2511 503
323 3300038443 Ga0395901_0007475 Ga0395901_0007475_3700_5214 503
324 3300038443 Ga0395901_0031525 Ga0395901_0031525_61_1575 503
325 3300039437 Ga0436365_0451685 Ga0436365_0451685_19_1533 503
326 3300042157 Ga0439458_0003327 Ga0439458_0003327_224_1738 503
327 3300044656 Ga0466969_0040353 Ga0466969_0040353_469_1983 503
328 3300044684 Ga0466966_0006529 Ga0466966_0006529_2160_3674 503
329 3300044684 Ga0466966_0066091 Ga0466966_0066091_167_1681 503
330 3300044842 Ga0466957_0006974 Ga0466957_0006974_1556_3070 503
331 3300045836 Ga0466958_0004049 Ga0466958_0004049_423_1937 503
332 3300045976 Ga0466967_0013379 Ga0466967_0013379_3341_4855 503
333 3300046684 Ga0495669_0001085 Ga0495669_0001085_2395_3909 503
334 3300046684 Ga0495669_0003643 Ga0495669_0003643_1104_2618 503
335 3300047445 Ga0495677_0035389 Ga0495677_0035389_286_1800 503
336 3300048910 Ga0496107_0018516 Ga0496107_0018516_2278_3792 503
337 3300048911 Ga0496108_0033736 Ga0496108_0033736_1692_3206 503
338 3300048912 Ga0496109_0016123 Ga0496109_0016123_3899_5413 503
339 3300048915 Ga0496112_0027102 Ga0496112_0027102_611_2125 503
340 3300048916 Ga0496113_0015615 Ga0496113_0015615_1142_2656 503
341 3300048917 Ga0496114_0055976 Ga0496114_0055976_271_1785 503
342 3300061719 Ga0466962_0033125 Ga0466962_0033125_420_1934 503

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20154

LNT_N

Apolipoprotein N-acyltransferase N-terminal domain

10

172

0.93

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

211

470

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nwr-assembly1.cif.gz_A thioester acyl-intermediate of apolipoprotein n-acyltransferase (lnt) 0.8417 2 498
8aq3-assembly1.cif.gz_A in surfo structure of the membrane integral lipoprotein n-acyltransferase lnt from e. coli in complex with pe 0.8383 3 499
5n6h-assembly2.cif.gz_B structure of the membrane integral lipoprotein n-acyltransferase lnt from e. coli 0.8383 3 499
5n6m-assembly1.cif.gz_A structure of the membrane integral lipoprotein n-acyltransferase lnt from p. aeruginosa 0.8383 1 503
5n6h-assembly1.cif.gz_A structure of the membrane integral lipoprotein n-acyltransferase lnt from e. coli 0.838 2 499
ID Description Score Start End Superfamily
af_O53493_232_506_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7654 204 478 3.60.110.10
af_O53493_232_506_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7553 204 478 3.60.110.10
af_P23930_215_482_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7523 203 474 3.60.110.10
af_P23930_215_482_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.7497 203 474 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.6642 208 466 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A520HPN2-F1-model_v4 Apolipoprotein N-acyltransferase 0.9413 4 147 GO:0016020
GO:0016410
GO:0042158
AF-A0A4R6FAW3-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.941 4 503 GO:0005886
GO:0016410
GO:0042158
AF-A0A2A2SEU7-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9371 1 503 GO:0005886
GO:0016410
GO:0042158
AF-A0A2A2SEU7-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9353 1 503 GO:0005886
GO:0016410
GO:0042158
AF-A0A4R6FAW3-F1-model_v4 Apolipoprotein N-acyltransferase (ALP N-acyltransferase) (EC 2.3.1.269) 0.9337 4 503 GO:0005886
GO:0016410
GO:0042158

Feature Viewer

pLDDT pTM Quality
84.14 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map