F415203

General Info

Members Datasets Scaffolds Average Seq Length
342 203 684 138

Family's Representative Sequence

Representative Sequence 3300027695|Ga0209966_1024745|Ga0209966_10247452
Length 170
Sequence LRNSKFQLLFIGRRCQIGFKDGEYIDTMTTETMNDCVFCRIVARQIPATVVHEDEHTLAFMDLGQVNPGHVLVAVKAHAENLYALNDAQAGAVLRAAARVARAIRDAFKPEGLSVYQANGKAAGQTVFHYHVHLVPRHEGDGMALSWPVKNPARDKLEEYAALIRASLPG

Samples

Sample ID Description Type Environment
1 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
131 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
139 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
140 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
141 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
142 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
161 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
162 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
163 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
187 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
188 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
189 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2932422444 Comamonas sp. 4034 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0.58
Rhizosphere 98.54
Stem 0
Stem Tuber 0
Unclassified 4.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209966_1024745 3300027695 Bacteria 1188
2 Ga0070683_100097814 3300005329 Bacteria 2761
3 Ga0070683_100117058 3300005329 Bacteria 2516
4 Ga0070690_100027221 3300005330 Bacteria 3533
5 Ga0070690_100633879 3300005330 Bacteria 815
6 Ga0070690_100901145 3300005330 Bacteria 692
7 Ga0070677_10664900 3300005333 Unclassified 583
8 Ga0068869_100105086 3300005334 Bacteria 2141
9 Ga0068869_100294986 3300005334 Bacteria 1307
10 Ga0070680_100080240 3300005336 Bacteria 2691
11 Ga0070680_100113442 3300005336 Bacteria 2257
12 Ga0070689_100627227 3300005340 Bacteria 933
13 Ga0070689_101704829 3300005340 Bacteria 573
14 Ga0070691_10052836 3300005341 Bacteria 1943
15 Ga0070687_100009500 3300005343 Bacteria 4171
16 Ga0070687_100089683 3300005343 Bacteria 1698
17 Ga0070692_10004243 3300005345 Bacteria 5950
18 Ga0070668_100096148 3300005347 Bacteria 2341
19 Ga0070675_100023862 3300005354 Bacteria 4896
20 Ga0070673_100699476 3300005364 Bacteria 931
21 Ga0070673_100769936 3300005364 Bacteria 887
22 Ga0070688_100331522 3300005365 Bacteria 1109
23 Ga0070710_10051994 3300005437 Bacteria 2303
24 Ga0070701_10390343 3300005438 Bacteria 879
25 Ga0070701_10966704 3300005438 Bacteria 592
26 Ga0070711_100641825 3300005439 Bacteria 889
27 Ga0070705_101427549 3300005440 Bacteria 578
28 Ga0070700_100003335 3300005441 Bacteria 8278
29 Ga0070700_100121428 3300005441 Bacteria 1751
30 Ga0070694_100191201 3300005444 Bacteria 1520
31 Ga0070694_100265361 3300005444 Bacteria 1304
32 Ga0070694_100265488 3300005444 Bacteria 1303
33 Ga0070694_100618071 3300005444 Bacteria 874
34 Ga0070681_10139321 3300005458 Bacteria 2356
35 Ga0068867_100000126 3300005459 Bacteria 49231
36 Ga0068867_100390902 3300005459 Bacteria 1171
37 Ga0068867_100821077 3300005459 Bacteria 831
38 Ga0070685_10076022 3300005466 Bacteria 2002
39 Ga0070697_100043101 3300005536 Bacteria 3653
40 Ga0070672_101020028 3300005543 Bacteria 734
41 Ga0070686_100005201 3300005544 Bacteria 7189
42 Ga0070695_100039124 3300005545 Bacteria 2996
43 Ga0070695_100043013 3300005545 Bacteria 2871
44 Ga0070695_100780728 3300005545 Bacteria 764
45 Ga0070695_100995125 3300005545 Bacteria 682
46 Ga0070696_100057276 3300005546 Bacteria 2719
47 Ga0070696_100291332 3300005546 Bacteria 1247
48 Ga0070696_100339782 3300005546 Bacteria 1160
49 Ga0070693_100719645 3300005547 Bacteria 733
50 Ga0070704_100276620 3300005549 Bacteria 1389
51 Ga0070704_100337609 3300005549 Bacteria 1268
52 Ga0070704_100531563 3300005549 Bacteria 1025
53 Ga0070704_101175638 3300005549 Unclassified 699
54 Ga0068857_101025948 3300005577 Bacteria 795
55 Ga0068856_100653472 3300005614 Bacteria 1072
56 Ga0070702_100045834 3300005615 Bacteria 2476
57 Ga0070702_100062668 3300005615 Bacteria 2169
58 Ga0070702_100129681 3300005615 Bacteria 1591
59 Ga0068859_101477302 3300005617 Bacteria 750
60 Ga0068866_10093532 3300005718 Bacteria 1643
61 Ga0068866_10232326 3300005718 Bacteria 1119
62 Ga0068861_100005473 3300005719 Bacteria 8605
63 Ga0068851_11017054 3300005834 Unclassified 523
64 Ga0068870_10923769 3300005840 Bacteria 618
65 Ga0068860_100372283 3300005843 Bacteria 1409
66 Ga0068862_100001111 3300005844 Bacteria 25519
67 Ga0068862_100028276 3300005844 Bacteria 4720
68 Ga0075432_10368319 3300006058 Bacteria 613
69 Ga0097621_100012717 3300006237 Bacteria 6252
70 Ga0097621_100358658 3300006237 Bacteria 1298
71 Ga0068871_100002111 3300006358 Bacteria 13456
72 Ga0075428_100089347 3300006844 Bacteria 3360
73 Ga0075428_100325429 3300006844 Bacteria 1651
74 Ga0075428_101065684 3300006844 Bacteria 854
75 Ga0075430_100010766 3300006846 Bacteria 7752
76 Ga0075430_100013654 3300006846 Bacteria 6925
77 Ga0075430_100022100 3300006846 Bacteria 5407
78 Ga0075430_100160018 3300006846 Bacteria 1874
79 Ga0075430_100229146 3300006846 Bacteria 1541
80 Ga0075430_100876785 3300006846 Bacteria 739
81 Ga0075431_100078600 3300006847 Bacteria 3405
82 Ga0075431_100120121 3300006847 Bacteria 2711
83 Ga0075431_100410589 3300006847 Bacteria 1354
84 Ga0075431_100509999 3300006847 Bacteria 1193
85 Ga0075431_100833055 3300006847 Bacteria 894
86 Ga0075433_10035913 3300006852 Bacteria 4266
87 Ga0075434_100458035 3300006871 Bacteria 1296
88 Ga0075429_100073753 3300006880 Bacteria 2972
89 Ga0075429_100172901 3300006880 Bacteria 1892
90 Ga0068865_100004646 3300006881 Bacteria 8294
91 Ga0068865_100956391 3300006881 Bacteria 748
92 Ga0097620_100138238 3300006931 Bacteria 2510
93 Ga0097620_101477711 3300006931 Bacteria 750
94 Ga0075435_100002009 3300007076 Bacteria 13315
95 Ga0111539_10051444 3300009094 Bacteria 4906
96 Ga0111539_10089085 3300009094 Bacteria 3626
97 Ga0111539_10786982 3300009094 Bacteria 1107
98 Ga0114129_10047107 3300009147 Bacteria 6059
99 Ga0114129_10519740 3300009147 Bacteria 1552
100 Ga0114129_11518188 3300009147 Bacteria 823
101 Ga0114129_11646288 3300009147 Bacteria 784
102 Ga0105243_10007352 3300009148 Bacteria 8468
103 Ga0105243_10570997 3300009148 Bacteria 1084
104 Ga0105243_11825628 3300009148 Bacteria 639
105 Ga0105249_10002649 3300009553 Bacteria 15482
106 Ga0157369_12229716 3300013105 Unclassified 555
107 Ga0157378_11476375 3300013297 Bacteria 724
108 Ga0163162_10926994 3300013306 Bacteria 983
109 Ga0157375_12887360 3300013308 Unclassified 574
110 Ga0157380_10019493 3300014326 Bacteria 5055
111 Ga0157380_10080050 3300014326 Bacteria 2670
112 Ga0157376_10035724 3300014969 Bacteria 4021
113 Ga0207653_10090920 3300025885 Bacteria 1069
114 Ga0207642_10071426 3300025899 Bacteria 1653
115 Ga0207688_10120724 3300025901 Bacteria 1529
116 Ga0207643_10039128 3300025908 Bacteria 2667
117 Ga0207643_10586777 3300025908 Bacteria 717
118 Ga0207707_10102799 3300025912 Bacteria 2498
119 Ga0207660_10035591 3300025917 Bacteria 3458
120 Ga0207660_10243105 3300025917 Bacteria 1418
121 Ga0207662_10014684 3300025918 Bacteria 4397
122 Ga0207681_10002154 3300025923 Bacteria 12555
123 Ga0207659_10051869 3300025926 Bacteria 2920
124 Ga0207687_10123646 3300025927 Bacteria 1939
125 Ga0207706_10309258 3300025933 Bacteria 1376
126 Ga0207686_10076859 3300025934 Bacteria 2166
127 Ga0207709_10003870 3300025935 Bacteria 8765
128 Ga0207670_10029057 3300025936 Bacteria 3518
129 Ga0207670_10553446 3300025936 Bacteria 940
130 Ga0207670_10775188 3300025936 Unclassified 798
131 Ga0207669_10072284 3300025937 Bacteria 2171
132 Ga0207704_10002073 3300025938 Bacteria 8974
133 Ga0207704_10953390 3300025938 Bacteria 724
134 Ga0207689_10088089 3300025942 Bacteria 2550
135 Ga0207661_10021729 3300025944 Bacteria 4814
136 Ga0207661_10131843 3300025944 Bacteria 2142
137 Ga0207651_11915905 3300025960 Unclassified 533
138 Ga0207712_10029505 3300025961 Bacteria 3680
139 Ga0207668_10002434 3300025972 Bacteria 10869
140 Ga0207640_10042937 3300025981 Bacteria 2886
141 Ga0207703_11240879 3300026035 Bacteria 717
142 Ga0207708_10000697 3300026075 Bacteria 25504
143 Ga0207708_10131433 3300026075 Bacteria 1957
144 Ga0207708_10865888 3300026075 Bacteria 781
145 Ga0207702_12332315 3300026078 Bacteria 523
146 Ga0207648_10000352 3300026089 Bacteria 50550
147 Ga0207648_10403058 3300026089 Bacteria 1240
148 Ga0207648_10464954 3300026089 Bacteria 1154
149 Ga0207674_10293618 3300026116 Bacteria 1574
150 Ga0207675_100000802 3300026118 Bacteria 31217
151 Ga0207675_101004599 3300026118 Bacteria 853
152 Ga0207675_101352278 3300026118 Bacteria 733
153 Ga0207683_10440892 3300026121 Bacteria 1200
154 Ga0209967_1004059 3300027364 Bacteria 1935
155 Ga0209981_1034747 3300027378 Bacteria 745
156 Ga0209996_1005164 3300027395 Bacteria 1672
157 Ga0209996_1032100 3300027395 Bacteria 765
158 Ga0210000_1008309 3300027462 Bacteria 1522
159 Ga0210000_1076259 3300027462 Bacteria 548
160 Ga0209999_1006650 3300027543 Bacteria 2078
161 Ga0209982_1040350 3300027552 Unclassified 744
162 Ga0209970_1025322 3300027614 Unclassified 1016
163 Ga0209588_1034880 3300027671 Bacteria 1617
164 Ga0209588_1085154 3300027671 Bacteria 1020
165 Ga0209971_1004315 3300027682 Bacteria 3376
166 Ga0209966_1001220 3300027695 Bacteria 4577
167 Ga0209966_1006984 3300027695 Bacteria 1972
168 Ga0207428_10037383 3300027907 Bacteria 3949
169 Ga0207428_10080322 3300027907 Bacteria 2548
170 Ga0207428_10441813 3300027907 Bacteria 949
171 Ga0268265_10000579 3300028380 Bacteria 37090
172 Ga0268265_10428516 3300028380 Bacteria 1230
173 Ga0268265_10529187 3300028380 Bacteria 1115
174 Ga0307408_100037749 3300031548 Bacteria 3404
175 Ga0307408_100112710 3300031548 Bacteria 2092
176 Ga0307408_100137091 3300031548 Bacteria 1916
177 Ga0307408_100425850 3300031548 Bacteria 1146
178 Ga0307405_10400165 3300031731 Bacteria 1075
179 Ga0307413_11155477 3300031824 Bacteria 671
180 Ga0307407_10669378 3300031903 Bacteria 779
181 Ga0307407_10868593 3300031903 Bacteria 690
182 Ga0307412_10462506 3300031911 Bacteria 1048
183 Ga0307412_10776030 3300031911 Bacteria 830
184 Ga0307412_10824726 3300031911 Bacteria 807
185 Ga0307412_10998217 3300031911 Bacteria 739
186 Ga0307409_100533682 3300031995 Bacteria 1149
187 Ga0307416_100054926 3300032002 Bacteria 3204
188 Ga0307416_100326638 3300032002 Bacteria 1539
189 Ga0307416_100546209 3300032002 Bacteria 1231
190 Ga0307416_101068332 3300032002 Bacteria 911
191 Ga0307416_101750174 3300032002 Bacteria 726
192 Ga0307414_11226778 3300032004 Unclassified 695
193 Ga0307411_10242315 3300032005 Bacteria 1412
194 Ga0307411_10421878 3300032005 Bacteria 1108
195 Ga0307411_10589426 3300032005 Bacteria 954
196 Ga0307415_100417066 3300032126 Bacteria 1151
197 Ga0373952_0108237 3300035092 Bacteria 741
198 Ga0373936_0022800 3300035113 Bacteria 2438
199 Ga0373939_0423087 3300035114 Bacteria 556
200 Ga0373953_0013284 3300035117 Bacteria 2938
201 Ga0373954_0000002 3300035118 Bacteria 147478
202 Ga0373956_0078151 3300035119 Bacteria 1515
203 Ga0373957_0010630 3300035120 Bacteria 3049
204 Ga0373960_0104244 3300035121 Bacteria 923
205 Ga0373960_0454580 3300035121 Bacteria 502
206 Ga0373943_0195449 3300035170 Bacteria 1118
207 Ga0373955_0033665 3300035172 Bacteria 2700
208 Ga0373955_0184626 3300035172 Bacteria 1238
209 Ga0373955_0818121 3300035172 Bacteria 573
210 Ga0373924_0008535 3300035410 Bacteria 3728
211 Ga0373924_0150660 3300035410 Bacteria 1017
212 Ga0373931_0452180 3300035691 Bacteria 822
213 Ga0373935_0013781 3300035692 Bacteria 4882
214 Ga0373927_0005113 3300035695 Bacteria 9079
215 Ga0373933_0012205 3300035724 Bacteria 4746
216 Ga0373933_0039451 3300035724 Bacteria 2778
217 Ga0373937_0000646 3300036401 Bacteria 30603
218 Ga0373937_0011507 3300036401 Bacteria 7767
219 Ga0373937_0036233 3300036401 Bacteria 4494
220 Ga0373937_0371967 3300036401 Bacteria 1355
221 Ga0373925_0012337 3300037068 Bacteria 6186
222 Ga0242420_067489 3300038996 Bacteria 722
223 Ga0439453_0000573 3300041408 Bacteria 4125
224 Ga0439465_0289764 3300041413 Bacteria 611
225 Ga0451798_1082355 3300041458 Bacteria 1407
226 Ga0451807_1191213 3300041486 Bacteria 2527
227 Ga0451845_0619485 3300041501 Bacteria 568
228 Ga0451853_0805059 3300041512 Bacteria 1238
229 Ga0439441_000493 3300042001 Bacteria 4293
230 Ga0439443_000903 3300042003 Bacteria 3006
231 Ga0439443_003895 3300042003 Bacteria 1913
232 Ga0439451_045599 3300042009 Bacteria 878
233 Ga0439454_050183 3300042011 Unclassified 703
234 Ga0439456_024016 3300042013 Bacteria 1293
235 Ga0439456_052025 3300042013 Bacteria 895
236 Ga0439463_169642 3300042016 Bacteria 566
237 Ga0450923_103487 3300042125 Bacteria 659
238 Ga0450910_025390 3300042147 Bacteria 912
239 Ga0450910_107868 3300042147 Bacteria 504
240 Ga0439435_0001413 3300042436 Bacteria 4425
241 Ga0439435_0003902 3300042436 Bacteria 3157
242 Ga0439435_0121462 3300042436 Bacteria 819
243 Ga0439444_0000450 3300042437 Bacteria 4594
244 Ga0439444_0000972 3300042437 Bacteria 3525
245 Ga0439460_0000389 3300042461 Bacteria 9321
246 Ga0450893_0005797 3300042532 Bacteria 1990
247 Ga0495651_0245731 3300046462 Bacteria 1225
248 Ga0495664_0118593 3300046477 Bacteria 1600
249 Ga0495630_1416631 3300046517 Bacteria 522
250 Ga0495652_0455925 3300046529 Bacteria 894
251 Ga0495587_0090304 3300046536 Bacteria 1770
252 Ga0495621_0057150 3300046539 Bacteria 1408
253 Ga0495621_0138807 3300046539 Bacteria 950
254 Ga0495621_0285706 3300046539 Unclassified 681
255 Ga0495659_0401004 3300046664 Bacteria 592
256 Ga0495599_0327153 3300046678 Bacteria 922
257 Ga0495599_0616394 3300046678 Bacteria 631
258 Ga0495674_1287413 3300047319 Bacteria 549
259 Ga0495680_0136212 3300047322 Bacteria 1800
260 Ga0495675_0443439 3300047444 Bacteria 752
261 Ga0501292_026668 3300049515 Bacteria 956
262 Ga0501296_047457 3300049519 Bacteria 621
263 Ga0501298_006808 3300049521 Bacteria 1881
264 Ga0501299_019249 3300049522 Bacteria 1234
265 Ga0501299_088518 3300049522 Bacteria 700
266 Ga0501031_0001000 3300049568 Bacteria 17145
267 Ga0501033_0309773 3300049570 Bacteria 1110
268 Ga0501036_1730202 3300049572 Bacteria 504
269 Ga0501037_0128649 3300049573 Bacteria 1817
270 Ga0501037_0767390 3300049573 Bacteria 638
271 Ga0501039_0013197 3300049575 Bacteria 6314
272 Ga0501039_0095417 3300049575 Bacteria 2319
273 Ga0501039_0266355 3300049575 Bacteria 1347
274 Ga0501040_0163007 3300049576 Bacteria 1576
275 Ga0501040_0653296 3300049576 Bacteria 760
276 Ga0501041_0021683 3300049577 Bacteria 3847
277 Ga0501041_0154728 3300049577 Bacteria 1432
278 Ga0501041_0249029 3300049577 Bacteria 1117
279 Ga0501041_0331123 3300049577 Bacteria 961
280 Ga0501041_0492079 3300049577 Bacteria 780
281 Ga0501042_0028368 3300049578 Bacteria 3943
282 Ga0501046_0085624 3300049580 Bacteria 2430
283 Ga0501046_0538221 3300049580 Bacteria 834
284 Ga0501048_0042413 3300049582 Bacteria 3258
285 Ga0501048_0057851 3300049582 Bacteria 2749
286 Ga0501048_0386478 3300049582 Bacteria 1000
287 Ga0501048_0543646 3300049582 Bacteria 833
288 Ga0501048_1171240 3300049582 Bacteria 553
289 Ga0501068_0046749 3300049584 Bacteria 2610
290 Ga0501071_0023908 3300049587 Bacteria 4271
291 Ga0501071_0105869 3300049587 Bacteria 2076
292 Ga0501071_0414919 3300049587 Bacteria 1029
293 Ga0501072_0503615 3300049588 Bacteria 958
294 Ga0501073_0502384 3300049589 Bacteria 838
295 Ga0501073_0760326 3300049589 Unclassified 668
296 Ga0501075_0067126 3300049591 Bacteria 2708
297 Ga0501075_0136665 3300049591 Bacteria 1867
298 Ga0501077_0331823 3300049593 Bacteria 970
299 Ga0501217_091253 3300049661 Bacteria 855
300 Ga0501217_262296 3300049661 Bacteria 560
301 Ga0501221_059740 3300049704 Bacteria 879
302 Ga0501221_150287 3300049704 Bacteria 617
303 Ga0501225_0111664 3300049705 Bacteria 806
304 Ga0501229_086812 3300049706 Bacteria 507
305 Ga0501080_0006292 3300049742 Bacteria 10656
306 Ga0501081_0755270 3300049743 Bacteria 731
307 Ga0501081_1112935 3300049743 Bacteria 598
308 Ga0501081_1231667 3300049743 Bacteria 567
309 Ga0501273_098942 3300049770 Bacteria 504
310 Ga0501279_068556 3300049775 Bacteria 593
311 Ga0501280_001366 3300049776 Bacteria 4598
312 Ga0501282_020366 3300049778 Bacteria 728
313 Ga0501035_1323143 3300049822 Bacteria 555
314 Ga0501045_0308334 3300049824 Bacteria 1178
315 nmdc:mga0k408_189545_c1 3300050493 Bacteria 1227
316 nmdc:mga05p37_1262776_c1 3300050507 Bacteria 756
317 nmdc:mga05p37_1833774_c1 3300050507 Bacteria 583
318 nmdc:mga05p37_756632_c1 3300050507 Bacteria 1070
319 nmdc:mga09592_235057_c1 3300050508 Bacteria 1588
320 nmdc:mga09592_373877_c1 3300050508 Bacteria 1233
321 nmdc:mga09592_4737_c1 3300050508 Bacteria 11019
322 nmdc:mga0qj67_173215_c1 3300050509 Bacteria 1753
323 nmdc:mga0qj67_17435_c1 3300050509 Bacteria 5459
324 nmdc:mga0qj67_222749_c1 3300050509 Bacteria 1531
325 nmdc:mga0qj67_57838_c1 3300050509 Bacteria 3074
326 nmdc:mga06r32_1366549_c1 3300050510 Bacteria 651
327 nmdc:mga06r32_138706_c1 3300050510 Bacteria 2407
328 nmdc:mga06r32_396776_c1 3300050510 Bacteria 1362
329 nmdc:mga06r32_505168_c1 3300050510 Bacteria 1186
330 nmdc:mga06r32_72912_c1 3300050510 Bacteria 3325
331 nmdc:mga08y16_129436_c1 3300050511 Bacteria 2626
332 nmdc:mga08y16_398617_c1 3300050511 Bacteria 1409
333 nmdc:mga08y16_51328_c1 3300050511 Bacteria 4315
334 nmdc:mga08y16_775089_c1 3300050511 Bacteria 954
335 nmdc:mga0rr50_51020_c1 3300050513 Bacteria 3068
336 nmdc:mga0a205_35630_c1 3300050515 Bacteria 4778
337 Ga0495619_0349644 3300053085 Bacteria 1023
338 Ga0501084_1233035 3300054114 Unclassified 627
339 Ga0501084_1418539 3300054114 Bacteria 582
340 Ga0530510_0286376 3300061734 Bacteria 1231
341 Ga0530510_0612845 3300061734 Bacteria 828
342 2932425295 2932422444 Bacteria 4678430
343 Ga0209966_1024745
344 Ga0070683_100097814
345 Ga0070683_100117058
346 Ga0070690_100027221
347 Ga0070690_100633879
348 Ga0070690_100901145
349 Ga0070677_10664900
350 Ga0068869_100105086
351 Ga0068869_100294986
352 Ga0070680_100080240
353 Ga0070680_100113442
354 Ga0070689_100627227
355 Ga0070689_101704829
356 Ga0070691_10052836
357 Ga0070687_100009500
358 Ga0070687_100089683
359 Ga0070692_10004243
360 Ga0070668_100096148
361 Ga0070675_100023862
362 Ga0070673_100699476
363 Ga0070673_100769936
364 Ga0070688_100331522
365 Ga0070710_10051994
366 Ga0070701_10390343
367 Ga0070701_10966704
368 Ga0070711_100641825
369 Ga0070705_101427549
370 Ga0070700_100003335
371 Ga0070700_100121428
372 Ga0070694_100191201
373 Ga0070694_100265361
374 Ga0070694_100265488
375 Ga0070694_100618071
376 Ga0070681_10139321
377 Ga0068867_100000126
378 Ga0068867_100390902
379 Ga0068867_100821077
380 Ga0070685_10076022
381 Ga0070697_100043101
382 Ga0070672_101020028
383 Ga0070686_100005201
384 Ga0070695_100039124
385 Ga0070695_100043013
386 Ga0070695_100780728
387 Ga0070695_100995125
388 Ga0070696_100057276
389 Ga0070696_100291332
390 Ga0070696_100339782
391 Ga0070693_100719645
392 Ga0070704_100276620
393 Ga0070704_100337609
394 Ga0070704_100531563
395 Ga0070704_101175638
396 Ga0068857_101025948
397 Ga0068856_100653472
398 Ga0070702_100045834
399 Ga0070702_100062668
400 Ga0070702_100129681
401 Ga0068859_101477302
402 Ga0068866_10093532
403 Ga0068866_10232326
404 Ga0068861_100005473
405 Ga0068851_11017054
406 Ga0068870_10923769
407 Ga0068860_100372283
408 Ga0068862_100001111
409 Ga0068862_100028276
410 Ga0075432_10368319
411 Ga0097621_100012717
412 Ga0097621_100358658
413 Ga0068871_100002111
414 Ga0075428_100089347
415 Ga0075428_100325429
416 Ga0075428_101065684
417 Ga0075430_100010766
418 Ga0075430_100013654
419 Ga0075430_100022100
420 Ga0075430_100160018
421 Ga0075430_100229146
422 Ga0075430_100876785
423 Ga0075431_100078600
424 Ga0075431_100120121
425 Ga0075431_100410589
426 Ga0075431_100509999
427 Ga0075431_100833055
428 Ga0075433_10035913
429 Ga0075434_100458035
430 Ga0075429_100073753
431 Ga0075429_100172901
432 Ga0068865_100004646
433 Ga0068865_100956391
434 Ga0097620_100138238
435 Ga0097620_101477711
436 Ga0075435_100002009
437 Ga0111539_10051444
438 Ga0111539_10089085
439 Ga0111539_10786982
440 Ga0114129_10047107
441 Ga0114129_10519740
442 Ga0114129_11518188
443 Ga0114129_11646288
444 Ga0105243_10007352
445 Ga0105243_10570997
446 Ga0105243_11825628
447 Ga0105249_10002649
448 Ga0157369_12229716
449 Ga0157378_11476375
450 Ga0163162_10926994
451 Ga0157375_12887360
452 Ga0157380_10019493
453 Ga0157380_10080050
454 Ga0157376_10035724
455 Ga0207653_10090920
456 Ga0207642_10071426
457 Ga0207688_10120724
458 Ga0207643_10039128
459 Ga0207643_10586777
460 Ga0207707_10102799
461 Ga0207660_10035591
462 Ga0207660_10243105
463 Ga0207662_10014684
464 Ga0207681_10002154
465 Ga0207659_10051869
466 Ga0207687_10123646
467 Ga0207706_10309258
468 Ga0207686_10076859
469 Ga0207709_10003870
470 Ga0207670_10029057
471 Ga0207670_10553446
472 Ga0207670_10775188
473 Ga0207669_10072284
474 Ga0207704_10002073
475 Ga0207704_10953390
476 Ga0207689_10088089
477 Ga0207661_10021729
478 Ga0207661_10131843
479 Ga0207651_11915905
480 Ga0207712_10029505
481 Ga0207668_10002434
482 Ga0207640_10042937
483 Ga0207703_11240879
484 Ga0207708_10000697
485 Ga0207708_10131433
486 Ga0207708_10865888
487 Ga0207702_12332315
488 Ga0207648_10000352
489 Ga0207648_10403058
490 Ga0207648_10464954
491 Ga0207674_10293618
492 Ga0207675_100000802
493 Ga0207675_101004599
494 Ga0207675_101352278
495 Ga0207683_10440892
496 Ga0209967_1004059
497 Ga0209981_1034747
498 Ga0209996_1005164
499 Ga0209996_1032100
500 Ga0210000_1008309
501 Ga0210000_1076259
502 Ga0209999_1006650
503 Ga0209982_1040350
504 Ga0209970_1025322
505 Ga0209588_1034880
506 Ga0209588_1085154
507 Ga0209971_1004315
508 Ga0209966_1001220
509 Ga0209966_1006984
510 Ga0207428_10037383
511 Ga0207428_10080322
512 Ga0207428_10441813
513 Ga0268265_10000579
514 Ga0268265_10428516
515 Ga0268265_10529187
516 Ga0307408_100037749
517 Ga0307408_100112710
518 Ga0307408_100137091
519 Ga0307408_100425850
520 Ga0307405_10400165
521 Ga0307413_11155477
522 Ga0307407_10669378
523 Ga0307407_10868593
524 Ga0307412_10462506
525 Ga0307412_10776030
526 Ga0307412_10824726
527 Ga0307412_10998217
528 Ga0307409_100533682
529 Ga0307416_100054926
530 Ga0307416_100326638
531 Ga0307416_100546209
532 Ga0307416_101068332
533 Ga0307416_101750174
534 Ga0307414_11226778
535 Ga0307411_10242315
536 Ga0307411_10421878
537 Ga0307411_10589426
538 Ga0307415_100417066
539 Ga0373952_0108237
540 Ga0373936_0022800
541 Ga0373939_0423087
542 Ga0373953_0013284
543 Ga0373954_0000002
544 Ga0373956_0078151
545 Ga0373957_0010630
546 Ga0373960_0104244
547 Ga0373960_0454580
548 Ga0373943_0195449
549 Ga0373955_0033665
550 Ga0373955_0184626
551 Ga0373955_0818121
552 Ga0373924_0008535
553 Ga0373924_0150660
554 Ga0373931_0452180
555 Ga0373935_0013781
556 Ga0373927_0005113
557 Ga0373933_0012205
558 Ga0373933_0039451
559 Ga0373937_0000646
560 Ga0373937_0011507
561 Ga0373937_0036233
562 Ga0373937_0371967
563 Ga0373925_0012337
564 Ga0242420_067489
565 Ga0439453_0000573
566 Ga0439465_0289764
567 Ga0451798_1082355
568 Ga0451807_1191213
569 Ga0451845_0619485
570 Ga0451853_0805059
571 Ga0439441_000493
572 Ga0439443_000903
573 Ga0439443_003895
574 Ga0439451_045599
575 Ga0439454_050183
576 Ga0439456_024016
577 Ga0439456_052025
578 Ga0439463_169642
579 Ga0450923_103487
580 Ga0450910_025390
581 Ga0450910_107868
582 Ga0439435_0001413
583 Ga0439435_0003902
584 Ga0439435_0121462
585 Ga0439444_0000450
586 Ga0439444_0000972
587 Ga0439460_0000389
588 Ga0450893_0005797
589 Ga0495651_0245731
590 Ga0495664_0118593
591 Ga0495630_1416631
592 Ga0495652_0455925
593 Ga0495587_0090304
594 Ga0495621_0057150
595 Ga0495621_0138807
596 Ga0495621_0285706
597 Ga0495659_0401004
598 Ga0495599_0327153
599 Ga0495599_0616394
600 Ga0495674_1287413
601 Ga0495680_0136212
602 Ga0495675_0443439
603 Ga0501292_026668
604 Ga0501296_047457
605 Ga0501298_006808
606 Ga0501299_019249
607 Ga0501299_088518
608 Ga0501031_0001000
609 Ga0501033_0309773
610 Ga0501036_1730202
611 Ga0501037_0128649
612 Ga0501037_0767390
613 Ga0501039_0013197
614 Ga0501039_0095417
615 Ga0501039_0266355
616 Ga0501040_0163007
617 Ga0501040_0653296
618 Ga0501041_0021683
619 Ga0501041_0154728
620 Ga0501041_0249029
621 Ga0501041_0331123
622 Ga0501041_0492079
623 Ga0501042_0028368
624 Ga0501046_0085624
625 Ga0501046_0538221
626 Ga0501048_0042413
627 Ga0501048_0057851
628 Ga0501048_0386478
629 Ga0501048_0543646
630 Ga0501048_1171240
631 Ga0501068_0046749
632 Ga0501071_0023908
633 Ga0501071_0105869
634 Ga0501071_0414919
635 Ga0501072_0503615
636 Ga0501073_0502384
637 Ga0501073_0760326
638 Ga0501075_0067126
639 Ga0501075_0136665
640 Ga0501077_0331823
641 Ga0501217_091253
642 Ga0501217_262296
643 Ga0501221_059740
644 Ga0501221_150287
645 Ga0501225_0111664
646 Ga0501229_086812
647 Ga0501080_0006292
648 Ga0501081_0755270
649 Ga0501081_1112935
650 Ga0501081_1231667
651 Ga0501273_098942
652 Ga0501279_068556
653 Ga0501280_001366
654 Ga0501282_020366
655 Ga0501035_1323143
656 Ga0501045_0308334
657 nmdc:mga0k408_189545_c1
658 nmdc:mga05p37_1262776_c1
659 nmdc:mga05p37_1833774_c1
660 nmdc:mga05p37_756632_c1
661 nmdc:mga09592_235057_c1
662 nmdc:mga09592_373877_c1
663 nmdc:mga09592_4737_c1
664 nmdc:mga0qj67_173215_c1
665 nmdc:mga0qj67_17435_c1
666 nmdc:mga0qj67_222749_c1
667 nmdc:mga0qj67_57838_c1
668 nmdc:mga06r32_1366549_c1
669 nmdc:mga06r32_138706_c1
670 nmdc:mga06r32_396776_c1
671 nmdc:mga06r32_505168_c1
672 nmdc:mga06r32_72912_c1
673 nmdc:mga08y16_129436_c1
674 nmdc:mga08y16_398617_c1
675 nmdc:mga08y16_51328_c1
676 nmdc:mga08y16_775089_c1
677 nmdc:mga0rr50_51020_c1
678 nmdc:mga0a205_35630_c1
679 Ga0495619_0349644
680 Ga0501084_1233035
681 Ga0501084_1418539
682 Ga0530510_0286376
683 Ga0530510_0612845
684 2932425295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

43

140

0.98

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

35

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.846 1 136
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8375 1 136
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8288 1 136
2eo4-assembly1.cif.gz_A-2 crystal structure of hypothetical histidine triad nucleotide-binding protein st2152 from sulfolobus tokodaii strain7 0.828 4 134
7mqw-assembly1.cif.gz_B histidine triad protein 0.8259 5 134
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8736 17 103 3.30.428.10
af_P9WML3_1_133_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8487 5 134 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8288 1 136 3.30.428.10
2eo4A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.828 4 134 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8253 2 109 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A2M7BCX8-F1-model_v4 HIT family protein 0.922 1 102 GO:0003824
GO:0009117
AF-A0A535STC7-F1-model_v4 HIT family protein 0.9171 5 105 GO:0003824
GO:0009117
AF-A0A1G2VE80-F1-model_v4 HIT domain-containing protein 0.9143 4 112 GO:0003824
GO:0009117
AF-A0A1F2X1A4-F1-model_v4 HIT family hydrolase 0.9131 1 99 GO:0009117
GO:0016787
AF-A0A6M4IR07-F1-model_v4 HIT family protein 0.9067 4 103 GO:0003824
GO:0009117

Map