F415288

General Info

Members Datasets Scaffolds Average Seq Length
342 214 684 125

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0303568|Ga0466960_0303568_43_399
Length 118
Sequence MSGDRIRREVLGDEHVDAAIERTTAFTEPFQEFITRYAWGDVWARPGLGRRERSMITLALLTALRSDELAMHVRAALRNGVTRDEIAEVLLHSALYAGLPAANRAFSIAQRVLEEEEG

Samples

Sample ID Description Type Environment
1 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
84 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
177 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
178 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
179 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
180 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
181 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
204 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
205 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
206 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
207 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
208 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
209 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
210 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
211 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
212 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
213 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
214 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 96.49
Metatranscriptomes 0
Isolates 3.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 5.56
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466960_0303568 3300044901 Bacteria 900
2 ARcpr5yngRDRAFT_c014650 3300000043 Bacteria 658
3 ARSoilOldRDRAFT_c001976 3300000044 Bacteria 1865
4 JGI25407J50210_10003966 3300003373 Bacteria 3585
5 JGI25407J50210_10031565 3300003373 Bacteria 1371
6 JGI25407J50210_10056914 3300003373 Bacteria 985
7 JGI25407J50210_10110546 3300003373 Bacteria 678
8 Ga0058692_1000159 3300003856 Bacteria 42231
9 Ga0065703_1000333 3300005272 Bacteria 12286
10 Ga0070683_100154264 3300005329 Bacteria 2178
11 Ga0070666_10605985 3300005335 Bacteria 799
12 Ga0070661_100094043 3300005344 Bacteria 2221
13 Ga0070659_100015986 3300005366 Bacteria 5628
14 Ga0070709_10044032 3300005434 Unclassified 2763
15 Ga0070714_102119040 3300005435 Bacteria 548
16 Ga0070663_100480174 3300005455 Bacteria 1029
17 Ga0070662_100029482 3300005457 Bacteria 3830
18 Ga0070681_10000747 3300005458 Bacteria 26992
19 Ga0070681_10026049 3300005458 Bacteria 5880
20 Ga0070706_100335939 3300005467 Bacteria 1409
21 Ga0070698_102052928 3300005471 Bacteria 525
22 Ga0070679_100033468 3300005530 Bacteria 5090
23 Ga0070684_101402514 3300005535 Bacteria 658
24 Ga0068853_100079846 3300005539 Bacteria 2862
25 Ga0068855_100281629 3300005563 Bacteria 1846
26 Ga0070664_100380708 3300005564 Bacteria 1288
27 Ga0068851_10751592 3300005834 Bacteria 603
28 Ga0081455_10495357 3300005937 Bacteria 822
29 Ga0081538_10000730 3300005981 Bacteria 35887
30 Ga0081538_10004866 3300005981 Bacteria 12230
31 Ga0081538_10008505 3300005981 Bacteria 8697
32 Ga0081538_10013730 3300005981 Bacteria 6398
33 Ga0081538_10024607 3300005981 Bacteria 4284
34 Ga0081538_10028513 3300005981 Unclassified 3837
35 Ga0081538_10111032 3300005981 Bacteria 1346
36 Ga0081538_10339399 3300005981 Bacteria 545
37 Ga0081539_10142448 3300005985 Bacteria 1163
38 Ga0070717_10043781 3300006028 Bacteria 3654
39 Ga0075364_10142483 3300006051 Bacteria 1613
40 Ga0075364_10151209 3300006051 Bacteria 1564
41 Ga0070712_100866633 3300006175 Bacteria 777
42 Ga0075362_10010503 3300006177 Bacteria 3617
43 Ga0075362_10117469 3300006177 Bacteria 1256
44 Ga0075428_100001587 3300006844 Bacteria 24365
45 Ga0075430_100046645 3300006846 Bacteria 3659
46 Ga0075433_10008695 3300006852 Bacteria 8101
47 Ga0075433_10237524 3300006852 Bacteria 1618
48 Ga0075429_100031294 3300006880 Bacteria 4624
49 Ga0075436_100107704 3300006914 Bacteria 1944
50 Ga0099795_10188437 3300007788 Bacteria 865
51 Ga0105251_10042772 3300009011 Bacteria 2196
52 Ga0105244_10000403 3300009036 Bacteria 40205
53 Ga0105244_10008698 3300009036 Bacteria 6317
54 Ga0105244_10009478 3300009036 Bacteria 5986
55 Ga0105244_10021036 3300009036 Bacteria 3616
56 Ga0105244_10112677 3300009036 Bacteria 1322
57 Ga0105250_10042541 3300009092 Bacteria 1820
58 Ga0105240_11165752 3300009093 Bacteria 817
59 Ga0111539_10071866 3300009094 Bacteria 4082
60 Ga0111539_10194845 3300009094 Bacteria 2363
61 Ga0105247_10002904 3300009101 Bacteria 11413
62 Ga0114129_10212560 3300009147 Bacteria 2614
63 Ga0114129_10234229 3300009147 Bacteria 2472
64 Ga0114129_10999119 3300009147 Bacteria 1054
65 Ga0105243_10000530 3300009148 Bacteria 38869
66 Ga0105241_10114681 3300009174 Bacteria 2162
67 Ga0105249_10000320 3300009553 Bacteria 48700
68 Ga0157316_1035851 3300012510 Bacteria 624
69 Ga0157373_10095334 3300013100 Bacteria 2094
70 Ga0157373_10296160 3300013100 Bacteria 1148
71 Ga0157371_10002500 3300013102 Bacteria 17479
72 Ga0157370_10476538 3300013104 Bacteria 1147
73 Ga0157372_10036336 3300013307 Bacteria 5429
74 Ga0157375_11180310 3300013308 Bacteria 897
75 Ga0157377_10023327 3300014745 Bacteria 3277
76 Ga0213872_10150528 3300021361 Unclassified 1017
77 Ga0213874_10023503 3300021377 Bacteria 1720
78 Ga0213875_10007464 3300021388 Bacteria 5640
79 Ga0213875_10097386 3300021388 Bacteria 1372
80 Ga0207696_1003954 3300025711 Bacteria 6533
81 Ga0207655_1000331 3300025728 Bacteria 69149
82 Ga0207655_1000575 3300025728 Bacteria 45532
83 Ga0207655_1007651 3300025728 Bacteria 6974
84 Ga0207655_1012106 3300025728 Bacteria 5071
85 Ga0207655_1069111 3300025728 Bacteria 1322
86 Ga0207713_1002100 3300025735 Bacteria 14861
87 Ga0207713_1084662 3300025735 Bacteria 1131
88 Ga0207710_10000257 3300025900 Bacteria 43901
89 Ga0207688_10006629 3300025901 Bacteria 6297
90 Ga0207654_10393824 3300025911 Bacteria 962
91 Ga0207707_10003521 3300025912 Bacteria 13865
92 Ga0207707_10026080 3300025912 Bacteria 5110
93 Ga0207693_10013338 3300025915 Bacteria 6625
94 Ga0207693_10228045 3300025915 Bacteria 1463
95 Ga0207663_10432342 3300025916 Bacteria 1012
96 Ga0207660_10155237 3300025917 Bacteria 1761
97 Ga0207649_10420014 3300025920 Bacteria 1004
98 Ga0207652_10036474 3300025921 Bacteria 4156
99 Ga0207700_11589449 3300025928 Bacteria 579
100 Ga0207706_10039166 3300025933 Bacteria 4202
101 Ga0207709_10000001 3300025935 Bacteria 2228154
102 Ga0207665_11501268 3300025939 Bacteria 535
103 Ga0207661_10094030 3300025944 Bacteria 2503
104 Ga0207679_10040528 3300025945 Bacteria 3335
105 Ga0207667_10910761 3300025949 Bacteria 871
106 Ga0207712_10000413 3300025961 Bacteria 36586
107 Ga0207639_10020277 3300026041 Bacteria 4756
108 Ga0207678_10705727 3300026067 Bacteria 888
109 Ga0207708_10069479 3300026075 Bacteria 2697
110 Ga0209371_1000008 3300027312 Bacteria 1024606
111 Ga0207428_10001150 3300027907 Bacteria 28649
112 Ga0207428_10007640 3300027907 Bacteria 9844
113 Ga0265319_1000015 3300028563 Bacteria 176382
114 Ga0265319_1282192 3300028563 Bacteria 505
115 Ga0265334_10313777 3300028573 Bacteria 537
116 Ga0265336_10041033 3300028666 Bacteria 1415
117 Ga0265336_10110348 3300028666 Bacteria 819
118 Ga0265338_10011058 3300028800 Bacteria 10472
119 Ga0265338_10156109 3300028800 Bacteria 1767
120 Ga0265338_10249415 3300028800 Bacteria 1310
121 Ga0268256_1000009 3300030500 Bacteria 1022625
122 Ga0316182_1076343 3300030745 Bacteria 903
123 Ga0265320_10016527 3300031240 Bacteria 4131
124 Ga0265320_10195179 3300031240 Bacteria 904
125 Ga0265320_10419814 3300031240 Bacteria 590
126 Ga0265325_10424137 3300031241 Bacteria 581
127 Ga0265339_10055342 3300031249 Bacteria 2152
128 Ga0265327_10111953 3300031251 Bacteria 1303
129 Ga0265316_10739365 3300031344 Bacteria 692
130 Ga0307408_100117402 3300031548 Bacteria 2055
131 Ga0307408_100339996 3300031548 Bacteria 1270
132 Ga0265342_10303112 3300031712 Bacteria 841
133 Ga0265342_10646725 3300031712 Bacteria 531
134 Ga0307405_10703116 3300031731 Bacteria 837
135 Ga0307413_10286749 3300031824 Bacteria 1241
136 Ga0307410_10045597 3300031852 Bacteria 2920
137 Ga0307410_10092666 3300031852 Bacteria 2148
138 Ga0307410_10190456 3300031852 Bacteria 1559
139 Ga0307410_12030014 3300031852 Bacteria 513
140 Ga0307406_10012037 3300031901 Bacteria 4922
141 Ga0307406_10060689 3300031901 Bacteria 2439
142 Ga0307406_10346326 3300031901 Bacteria 1159
143 Ga0307406_10368940 3300031901 Bacteria 1128
144 Ga0307406_10518098 3300031901 Bacteria 970
145 Ga0307407_10036369 3300031903 Bacteria 2713
146 Ga0307407_10165234 3300031903 Bacteria 1452
147 Ga0307407_10423800 3300031903 Bacteria 960
148 Ga0307412_10592191 3300031911 Bacteria 938
149 Ga0307412_10647002 3300031911 Bacteria 901
150 Ga0307412_10744597 3300031911 Bacteria 845
151 Ga0307412_12097871 3300031911 Unclassified 525
152 Ga0307409_100095795 3300031995 Bacteria 2446
153 Ga0307409_100194062 3300031995 Bacteria 1810
154 Ga0307409_100250724 3300031995 Bacteria 1618
155 Ga0307409_100812273 3300031995 Bacteria 943
156 Ga0307409_100976002 3300031995 Bacteria 864
157 Ga0307409_101109942 3300031995 Bacteria 812
158 Ga0307409_101769320 3300031995 Bacteria 647
159 Ga0307409_102174276 3300031995 Bacteria 584
160 Ga0307416_100126616 3300032002 Bacteria 2289
161 Ga0307416_101016356 3300032002 Bacteria 932
162 Ga0307416_101028652 3300032002 Bacteria 927
163 Ga0307416_103834066 3300032002 Bacteria 503
164 Ga0307414_11684431 3300032004 Bacteria 591
165 Ga0307414_11700790 3300032004 Bacteria 588
166 Ga0307415_100064116 3300032126 Bacteria 2556
167 Ga0307415_100540987 3300032126 Bacteria 1026
168 Ga0307415_100805276 3300032126 Bacteria 858
169 Ga0307415_102513416 3300032126 Bacteria 507
170 Ga0373943_0531940 3300035170 Bacteria 689
171 Ga0373931_0470853 3300035691 Bacteria 806
172 Ga0395899_0006056 3300037312 Bacteria 9389
173 Ga0395900_0011115 3300037418 Bacteria 9201
174 Ga0395900_0016457 3300037418 Bacteria 7540
175 Ga0395900_0168419 3300037418 Bacteria 2231
176 Ga0395900_0242276 3300037418 Bacteria 1808
177 Ga0395900_0282772 3300037418 Bacteria 1650
178 Ga0395900_0868235 3300037418 Bacteria 827
179 Ga0395898_0073684 3300037466 Bacteria 3298
180 Ga0395898_0112927 3300037466 Bacteria 2604
181 Ga0395898_0182709 3300037466 Bacteria 2004
182 Ga0395898_0189781 3300037466 Bacteria 1964
183 Ga0395898_0423941 3300037466 Bacteria 1268
184 Ga0395898_1216028 3300037466 Bacteria 684
185 Ga0395905_0023314 3300037471 Bacteria 5851
186 Ga0395905_0025435 3300037471 Bacteria 5583
187 Ga0395905_0061752 3300037471 Bacteria 3505
188 Ga0395905_0291451 3300037471 Bacteria 1519
189 Ga0395905_0351552 3300037471 Bacteria 1366
190 Ga0395905_0667306 3300037471 Bacteria 942
191 Ga0395905_1828481 3300037471 Bacteria 513
192 Ga0436364_0619995 3300037853 Bacteria 1348
193 Ga0436364_0969269 3300037853 Bacteria 9655
194 Ga0436364_1243675 3300037853 Bacteria 8992
195 Ga0436364_1290456 3300037853 Bacteria 5975
196 Ga0395901_0004848 3300038443 Bacteria 13581
197 Ga0395901_0015332 3300038443 Bacteria 7799
198 Ga0395901_0055251 3300038443 Bacteria 4129
199 Ga0395901_0057348 3300038443 Bacteria 4051
200 Ga0395901_0066119 3300038443 Bacteria 3766
201 Ga0395901_0117865 3300038443 Bacteria 2790
202 Ga0395901_0201929 3300038443 Bacteria 2084
203 Ga0436365_0378222 3300039437 Unclassified 810
204 Ga0436365_0567429 3300039437 Bacteria 876
205 Ga0436365_1076105 3300039437 Bacteria 2087
206 Ga0436361_0139370 3300039447 Bacteria 2139
207 Ga0436361_0174199 3300039447 Unclassified 2201
208 Ga0436363_1205441 3300039450 Bacteria 3529
209 Ga0436363_1457829 3300039450 Bacteria 1319
210 Ga0436362_0137632 3300039453 Bacteria 601
211 Ga0436362_0434190 3300039453 Bacteria 792
212 Ga0451807_1213754 3300041486 Bacteria 646
213 Ga0450915_002759 3300042119 Bacteria 946
214 Ga0439464_0186582 3300042439 Bacteria 658
215 Ga0439460_0085063 3300042461 Bacteria 998
216 Ga0466959_0318555 3300045049 Bacteria 1063
217 Ga0466958_0045352 3300045836 Bacteria 2651
218 Ga0466958_0286759 3300045836 Bacteria 1056
219 Ga0466967_0206567 3300045976 Bacteria 1862
220 Ga0466967_0371720 3300045976 Bacteria 1387
221 Ga0466967_0443923 3300045976 Bacteria 1267
222 Ga0495592_0507736 3300046454 Bacteria 747
223 Ga0495603_0016601 3300046455 Bacteria 4455
224 Ga0495651_0565184 3300046462 Bacteria 721
225 Ga0495580_0855067 3300046472 Bacteria 587
226 Ga0495582_0133977 3300046473 Bacteria 1401
227 Ga0495605_0390983 3300046474 Bacteria 579
228 Ga0495584_0092595 3300046491 Bacteria 1525
229 Ga0495594_0416259 3300046499 Bacteria 764
230 Ga0495596_0280999 3300046500 Bacteria 647
231 Ga0495618_0062790 3300046514 Bacteria 2358
232 Ga0495637_0177004 3300046520 Bacteria 793
233 Ga0495637_0226825 3300046520 Bacteria 678
234 Ga0495644_0109064 3300046523 Bacteria 1050
235 Ga0495663_0157351 3300046525 Bacteria 778
236 Ga0495663_0255247 3300046525 Bacteria 623
237 Ga0495640_0415726 3300046533 Bacteria 824
238 Ga0495598_0076040 3300046537 Bacteria 1068
239 Ga0495609_0100596 3300046538 Bacteria 1253
240 Ga0495656_0014393 3300046615 Bacteria 2965
241 Ga0495656_0338082 3300046615 Bacteria 778
242 Ga0495634_0099333 3300046642 Bacteria 1882
243 Ga0495635_0041292 3300046663 Bacteria 3187
244 Ga0495624_0286545 3300046690 Bacteria 994
245 Ga0495671_0398408 3300046692 Bacteria 659
246 Ga0495600_0297011 3300046809 Bacteria 1020
247 Ga0495604_0240501 3300047317 Bacteria 1238
248 Ga0495674_0360651 3300047319 Bacteria 1179
249 Ga0495684_0294543 3300047471 Bacteria 1167
250 Ga0496101_0218347 3300048904 Bacteria 1479
251 Ga0496104_0491818 3300048907 Bacteria 1138
252 Ga0496104_0972844 3300048907 Bacteria 753
253 Ga0496105_0387925 3300048908 Bacteria 1111
254 Ga0496108_0290266 3300048911 Bacteria 1424
255 Ga0496109_0424321 3300048912 Bacteria 1256
256 Ga0496109_0641551 3300048912 Bacteria 999
257 Ga0496110_0557035 3300048913 Bacteria 1042
258 Ga0496110_1214625 3300048913 Bacteria 663
259 Ga0496110_1365730 3300048913 Bacteria 618
260 Ga0496111_0192515 3300048914 Bacteria 1516
261 Ga0496111_0476566 3300048914 Bacteria 920
262 Ga0496111_0645872 3300048914 Bacteria 772
263 Ga0496112_0377132 3300048915 Bacteria 1360
264 Ga0496112_1908872 3300048915 Bacteria 505
265 Ga0496113_0485605 3300048916 Bacteria 992
266 Ga0496115_0451843 3300048918 Bacteria 1038
267 Ga0496115_1381550 3300048918 Bacteria 521
268 Ga0501033_1093494 3300049570 Bacteria 530
269 Ga0501036_0989602 3300049572 Bacteria 689
270 Ga0501039_0156793 3300049575 Bacteria 1789
271 Ga0501040_0158144 3300049576 Bacteria 1601
272 Ga0501042_0044891 3300049578 Bacteria 3149
273 Ga0501042_0152789 3300049578 Bacteria 1665
274 Ga0501042_0756306 3300049578 Bacteria 707
275 Ga0501042_1162126 3300049578 Bacteria 563
276 Ga0501043_0845961 3300049579 Bacteria 659
277 Ga0501046_0130711 3300049580 Bacteria 1905
278 Ga0501048_0853743 3300049582 Bacteria 654
279 Ga0501067_0374619 3300049583 Bacteria 794
280 Ga0501068_0657337 3300049584 Bacteria 684
281 Ga0501069_0263399 3300049585 Bacteria 1007
282 Ga0501070_0758927 3300049586 Bacteria 764
283 Ga0501071_0038355 3300049587 Bacteria 3424
284 Ga0501071_0573750 3300049587 Bacteria 867
285 Ga0501071_0622937 3300049587 Bacteria 830
286 Ga0501071_0717513 3300049587 Bacteria 770
287 Ga0501072_0079426 3300049588 Bacteria 2598
288 Ga0501072_0154336 3300049588 Bacteria 1831
289 Ga0501075_0939933 3300049591 Bacteria 657
290 Ga0501075_1226671 3300049591 Bacteria 569
291 Ga0501076_0058908 3300049592 Bacteria 3054
292 Ga0501076_0145657 3300049592 Bacteria 1926
293 Ga0501076_0275996 3300049592 Bacteria 1377
294 Ga0501077_0006534 3300049593 Bacteria 7156
295 Ga0501077_0849165 3300049593 Bacteria 587
296 Ga0501077_0877936 3300049593 Bacteria 577
297 Ga0501198_021408 3300049649 Bacteria 1030
298 Ga0501198_061069 3300049649 Bacteria 692
299 Ga0501201_052369 3300049651 Bacteria 512
300 Ga0501202_157000 3300049652 Bacteria 599
301 Ga0501209_075374 3300049656 Bacteria 966
302 Ga0501217_304161 3300049661 Bacteria 527
303 Ga0501246_013117 3300049676 Bacteria 785
304 Ga0501080_0145722 3300049742 Bacteria 2189
305 Ga0501083_0044212 3300049744 Bacteria 3015
306 Ga0501270_097022 3300049767 Bacteria 610
307 Ga0501035_0679213 3300049822 Bacteria 832
308 Ga0501045_0574809 3300049824 Bacteria 835
309 Ga0501045_0761258 3300049824 Bacteria 713
310 nmdc:mga0yw44_158920_c1 3300050492 Bacteria 1478
311 nmdc:mga05p37_117591_c1 3300050507 Bacteria 3267
312 nmdc:mga05p37_42924_c1 3300050507 Bacteria 5559
313 nmdc:mga09592_9431_c1 3300050508 Bacteria 7930
314 nmdc:mga0qj67_377738_c1 3300050509 Bacteria 1144
315 nmdc:mga0qj67_926643_c1 3300050509 Bacteria 686
316 nmdc:mga06r32_472313_c1 3300050510 Bacteria 1233
317 nmdc:mga08y16_12420_c1 3300050511 Bacteria 8961
318 nmdc:mga08x19_892518_c1 3300050514 Bacteria 631
319 nmdc:mga0a205_13349_c1 3300050515 Bacteria 7643
320 Ga0495601_0270917 3300053077 Bacteria 1108
321 Ga0495612_0454561 3300053078 Bacteria 585
322 Ga0495595_0193434 3300053084 Bacteria 1011
323 Ga0501084_0068401 3300054114 Bacteria 2973
324 Ga0501084_0287801 3300054114 Bacteria 1388
325 Ga0501084_0368555 3300054114 Bacteria 1214
326 Ga0590071_032418 3300059421 Bacteria 1247
327 Ga0590074_015236 3300059423 Bacteria 1305
328 Ga0590075_011959 3300059424 Bacteria 2103
329 Ga0530510_0274216 3300061734 Bacteria 1259
330 Ga0530510_0640613 3300061734 Bacteria 809
331 2552748896 2551306352 Bacteria 3873115
332 2640734513 2639762793 Bacteria 3943681
333 2644364139 2643221665 Bacteria 4699229
334 2678231425 2675903507 Bacteria 3737791
335 2745161353 2744054655 Bacteria 3552603
336 2774391597 2773857761 Bacteria 3837365
337 2774437131 2773857770 Bacteria 3911866
338 2916702369 2916699645 Bacteria 3568996
339 2919182649 2919182534 Bacteria 3907101
340 2919506802 2919506607 Bacteria 3392955
341 2928519671 2928515477 Bacteria 4448421
342 2984569517 2984568884 Bacteria 3884413
343 Ga0466960_0303568
344 ARcpr5yngRDRAFT_c014650
345 ARSoilOldRDRAFT_c001976
346 JGI25407J50210_10003966
347 JGI25407J50210_10031565
348 JGI25407J50210_10056914
349 JGI25407J50210_10110546
350 Ga0058692_1000159
351 Ga0065703_1000333
352 Ga0070683_100154264
353 Ga0070666_10605985
354 Ga0070661_100094043
355 Ga0070659_100015986
356 Ga0070709_10044032
357 Ga0070714_102119040
358 Ga0070663_100480174
359 Ga0070662_100029482
360 Ga0070681_10000747
361 Ga0070681_10026049
362 Ga0070706_100335939
363 Ga0070698_102052928
364 Ga0070679_100033468
365 Ga0070684_101402514
366 Ga0068853_100079846
367 Ga0068855_100281629
368 Ga0070664_100380708
369 Ga0068851_10751592
370 Ga0081455_10495357
371 Ga0081538_10000730
372 Ga0081538_10004866
373 Ga0081538_10008505
374 Ga0081538_10013730
375 Ga0081538_10024607
376 Ga0081538_10028513
377 Ga0081538_10111032
378 Ga0081538_10339399
379 Ga0081539_10142448
380 Ga0070717_10043781
381 Ga0075364_10142483
382 Ga0075364_10151209
383 Ga0070712_100866633
384 Ga0075362_10010503
385 Ga0075362_10117469
386 Ga0075428_100001587
387 Ga0075430_100046645
388 Ga0075433_10008695
389 Ga0075433_10237524
390 Ga0075429_100031294
391 Ga0075436_100107704
392 Ga0099795_10188437
393 Ga0105251_10042772
394 Ga0105244_10000403
395 Ga0105244_10008698
396 Ga0105244_10009478
397 Ga0105244_10021036
398 Ga0105244_10112677
399 Ga0105250_10042541
400 Ga0105240_11165752
401 Ga0111539_10071866
402 Ga0111539_10194845
403 Ga0105247_10002904
404 Ga0114129_10212560
405 Ga0114129_10234229
406 Ga0114129_10999119
407 Ga0105243_10000530
408 Ga0105241_10114681
409 Ga0105249_10000320
410 Ga0157316_1035851
411 Ga0157373_10095334
412 Ga0157373_10296160
413 Ga0157371_10002500
414 Ga0157370_10476538
415 Ga0157372_10036336
416 Ga0157375_11180310
417 Ga0157377_10023327
418 Ga0213872_10150528
419 Ga0213874_10023503
420 Ga0213875_10007464
421 Ga0213875_10097386
422 Ga0207696_1003954
423 Ga0207655_1000331
424 Ga0207655_1000575
425 Ga0207655_1007651
426 Ga0207655_1012106
427 Ga0207655_1069111
428 Ga0207713_1002100
429 Ga0207713_1084662
430 Ga0207710_10000257
431 Ga0207688_10006629
432 Ga0207654_10393824
433 Ga0207707_10003521
434 Ga0207707_10026080
435 Ga0207693_10013338
436 Ga0207693_10228045
437 Ga0207663_10432342
438 Ga0207660_10155237
439 Ga0207649_10420014
440 Ga0207652_10036474
441 Ga0207700_11589449
442 Ga0207706_10039166
443 Ga0207709_10000001
444 Ga0207665_11501268
445 Ga0207661_10094030
446 Ga0207679_10040528
447 Ga0207667_10910761
448 Ga0207712_10000413
449 Ga0207639_10020277
450 Ga0207678_10705727
451 Ga0207708_10069479
452 Ga0209371_1000008
453 Ga0207428_10001150
454 Ga0207428_10007640
455 Ga0265319_1000015
456 Ga0265319_1282192
457 Ga0265334_10313777
458 Ga0265336_10041033
459 Ga0265336_10110348
460 Ga0265338_10011058
461 Ga0265338_10156109
462 Ga0265338_10249415
463 Ga0268256_1000009
464 Ga0316182_1076343
465 Ga0265320_10016527
466 Ga0265320_10195179
467 Ga0265320_10419814
468 Ga0265325_10424137
469 Ga0265339_10055342
470 Ga0265327_10111953
471 Ga0265316_10739365
472 Ga0307408_100117402
473 Ga0307408_100339996
474 Ga0265342_10303112
475 Ga0265342_10646725
476 Ga0307405_10703116
477 Ga0307413_10286749
478 Ga0307410_10045597
479 Ga0307410_10092666
480 Ga0307410_10190456
481 Ga0307410_12030014
482 Ga0307406_10012037
483 Ga0307406_10060689
484 Ga0307406_10346326
485 Ga0307406_10368940
486 Ga0307406_10518098
487 Ga0307407_10036369
488 Ga0307407_10165234
489 Ga0307407_10423800
490 Ga0307412_10592191
491 Ga0307412_10647002
492 Ga0307412_10744597
493 Ga0307412_12097871
494 Ga0307409_100095795
495 Ga0307409_100194062
496 Ga0307409_100250724
497 Ga0307409_100812273
498 Ga0307409_100976002
499 Ga0307409_101109942
500 Ga0307409_101769320
501 Ga0307409_102174276
502 Ga0307416_100126616
503 Ga0307416_101016356
504 Ga0307416_101028652
505 Ga0307416_103834066
506 Ga0307414_11684431
507 Ga0307414_11700790
508 Ga0307415_100064116
509 Ga0307415_100540987
510 Ga0307415_100805276
511 Ga0307415_102513416
512 Ga0373943_0531940
513 Ga0373931_0470853
514 Ga0395899_0006056
515 Ga0395900_0011115
516 Ga0395900_0016457
517 Ga0395900_0168419
518 Ga0395900_0242276
519 Ga0395900_0282772
520 Ga0395900_0868235
521 Ga0395898_0073684
522 Ga0395898_0112927
523 Ga0395898_0182709
524 Ga0395898_0189781
525 Ga0395898_0423941
526 Ga0395898_1216028
527 Ga0395905_0023314
528 Ga0395905_0025435
529 Ga0395905_0061752
530 Ga0395905_0291451
531 Ga0395905_0351552
532 Ga0395905_0667306
533 Ga0395905_1828481
534 Ga0436364_0619995
535 Ga0436364_0969269
536 Ga0436364_1243675
537 Ga0436364_1290456
538 Ga0395901_0004848
539 Ga0395901_0015332
540 Ga0395901_0055251
541 Ga0395901_0057348
542 Ga0395901_0066119
543 Ga0395901_0117865
544 Ga0395901_0201929
545 Ga0436365_0378222
546 Ga0436365_0567429
547 Ga0436365_1076105
548 Ga0436361_0139370
549 Ga0436361_0174199
550 Ga0436363_1205441
551 Ga0436363_1457829
552 Ga0436362_0137632
553 Ga0436362_0434190
554 Ga0451807_1213754
555 Ga0450915_002759
556 Ga0439464_0186582
557 Ga0439460_0085063
558 Ga0466959_0318555
559 Ga0466958_0045352
560 Ga0466958_0286759
561 Ga0466967_0206567
562 Ga0466967_0371720
563 Ga0466967_0443923
564 Ga0495592_0507736
565 Ga0495603_0016601
566 Ga0495651_0565184
567 Ga0495580_0855067
568 Ga0495582_0133977
569 Ga0495605_0390983
570 Ga0495584_0092595
571 Ga0495594_0416259
572 Ga0495596_0280999
573 Ga0495618_0062790
574 Ga0495637_0177004
575 Ga0495637_0226825
576 Ga0495644_0109064
577 Ga0495663_0157351
578 Ga0495663_0255247
579 Ga0495640_0415726
580 Ga0495598_0076040
581 Ga0495609_0100596
582 Ga0495656_0014393
583 Ga0495656_0338082
584 Ga0495634_0099333
585 Ga0495635_0041292
586 Ga0495624_0286545
587 Ga0495671_0398408
588 Ga0495600_0297011
589 Ga0495604_0240501
590 Ga0495674_0360651
591 Ga0495684_0294543
592 Ga0496101_0218347
593 Ga0496104_0491818
594 Ga0496104_0972844
595 Ga0496105_0387925
596 Ga0496108_0290266
597 Ga0496109_0424321
598 Ga0496109_0641551
599 Ga0496110_0557035
600 Ga0496110_1214625
601 Ga0496110_1365730
602 Ga0496111_0192515
603 Ga0496111_0476566
604 Ga0496111_0645872
605 Ga0496112_0377132
606 Ga0496112_1908872
607 Ga0496113_0485605
608 Ga0496115_0451843
609 Ga0496115_1381550
610 Ga0501033_1093494
611 Ga0501036_0989602
612 Ga0501039_0156793
613 Ga0501040_0158144
614 Ga0501042_0044891
615 Ga0501042_0152789
616 Ga0501042_0756306
617 Ga0501042_1162126
618 Ga0501043_0845961
619 Ga0501046_0130711
620 Ga0501048_0853743
621 Ga0501067_0374619
622 Ga0501068_0657337
623 Ga0501069_0263399
624 Ga0501070_0758927
625 Ga0501071_0038355
626 Ga0501071_0573750
627 Ga0501071_0622937
628 Ga0501071_0717513
629 Ga0501072_0079426
630 Ga0501072_0154336
631 Ga0501075_0939933
632 Ga0501075_1226671
633 Ga0501076_0058908
634 Ga0501076_0145657
635 Ga0501076_0275996
636 Ga0501077_0006534
637 Ga0501077_0849165
638 Ga0501077_0877936
639 Ga0501198_021408
640 Ga0501198_061069
641 Ga0501201_052369
642 Ga0501202_157000
643 Ga0501209_075374
644 Ga0501217_304161
645 Ga0501246_013117
646 Ga0501080_0145722
647 Ga0501083_0044212
648 Ga0501270_097022
649 Ga0501035_0679213
650 Ga0501045_0574809
651 Ga0501045_0761258
652 nmdc:mga0yw44_158920_c1
653 nmdc:mga05p37_117591_c1
654 nmdc:mga05p37_42924_c1
655 nmdc:mga09592_9431_c1
656 nmdc:mga0qj67_377738_c1
657 nmdc:mga0qj67_926643_c1
658 nmdc:mga06r32_472313_c1
659 nmdc:mga08y16_12420_c1
660 nmdc:mga08x19_892518_c1
661 nmdc:mga0a205_13349_c1
662 Ga0495601_0270917
663 Ga0495612_0454561
664 Ga0495595_0193434
665 Ga0501084_0068401
666 Ga0501084_0287801
667 Ga0501084_0368555
668 Ga0590071_032418
669 Ga0590074_015236
670 Ga0590075_011959
671 Ga0530510_0274216
672 Ga0530510_0640613
673 2552748896
674 2640734513
675 2644364139
676 2678231425
677 2745161353
678 2774391597
679 2774437131
680 2916702369
681 2919182649
682 2919506802
683 2928519671
684 2984569517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

28

111

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.9175 6 120
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.9 4 120
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8714 4 120
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8663 6 120
3d7i-assembly1.cif.gz_B crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in oxygen detoxification (1591455) from methanococcus jannaschii at 1.75 a resolution 0.849 32 118
ID Description Score Start End Superfamily
af_Q8IIN7_541_638_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.9322 57 101 1.20.272.10
2af7G00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9166 6 120 1.20.1290.10
2af7F00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9035 6 120 1.20.1290.10
af_Q5A3K0_131_323_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8902 5 104 1.20.1290.10
af_Q5A3J2_12_323_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8788 4 96 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7W3J8K0-F1-model_v4 4-carboxymuconolactone decarboxylase 1.002 5 124 GO:0051920
AF-K6WN73-F1-model_v4 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase 1.001 5 128 GO:0016787
GO:0051920
AF-D3DAK6-F1-model_v4 4-carboxymuconolactone decarboxylase 1.001 4 125 GO:0051920
AF-A0A7U9PW89-F1-model_v4 3-oxoadipate enol-lactonase 1.001 5 126 GO:0051920
AF-D6K790-F1-model_v4 4-carboxymuconolactone decarboxylase 1.001 5 127 GO:0051920

Map