F415301

General Info

Members Datasets Scaffolds Average Seq Length
342 180 684 279

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0024070|Ga0495580_0024070_3047_3988
Length 313
Sequence VTLGFDVILTRSEAIRACPKLVEGILRAAIRSLRPHSRYDLHVKPTAPEGRLRLIEGRHNALVKDLRRAFARSEPTSDGCVAIEGVRIIEEAIRSGLRFRAIFFSASAENRAQRLLPQLGSHVETVMLPDKLFASAVSSEGPQGVAALVHLKERKLEDIFNRLESGPVVILAGLQDPGNLGTILRSAEAFGAAGVLLGEGTVSALNSKAMRASAGSGFRLSVLHQNLSSALPALRERGVRVLATSSHKGTPLPEANLAGPLAVLLGNEGAGVPRDLMAQVDETIAIPHSPQVESLNAGIAASIILYEAARQRK

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
152 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.09
Rhizosphere 95.03
Stem 0
Stem Tuber 0
Unclassified 10.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0024070 3300046472 Bacteria 4463
2 MBSR1b_contig_12892957 2162886012 Unclassified 1911
3 JGI24751J29686_10001757 3300002459 Bacteria 4457
4 rootL2_10123468 3300003322 Bacteria 5222
5 rootH1_10220092 3300003323 Bacteria 2957
6 Ga0070676_10035848 3300005328 Bacteria 2855
7 Ga0070683_100003077 3300005329 Bacteria 13433
8 Ga0070683_100035299 3300005329 Bacteria 4571
9 Ga0070690_100021065 3300005330 Bacteria 3977
10 Ga0070670_100015604 3300005331 Bacteria 6524
11 Ga0068869_100100783 3300005334 Bacteria 2184
12 Ga0070682_100011564 3300005337 Bacteria 5047
13 Ga0070682_100039464 3300005337 Bacteria 2901
14 Ga0068868_100031795 3300005338 Bacteria 4058
15 Ga0068868_100244819 3300005338 Bacteria 1508
16 Ga0070689_100004451 3300005340 Bacteria 9471
17 Ga0070661_100018070 3300005344 Bacteria 5009
18 Ga0070675_100025908 3300005354 Bacteria 4703
19 Ga0070673_100001572 3300005364 Bacteria 13451
20 Ga0070688_100005169 3300005365 Bacteria 6848
21 Ga0070659_100004505 3300005366 Bacteria 9950
22 Ga0070714_100003563 3300005435 Bacteria 11639
23 Ga0070714_100038412 3300005435 Bacteria 4024
24 Ga0070714_100051484 3300005435 Bacteria 3510
25 Ga0070714_100121099 3300005435 Bacteria 2328
26 Ga0070713_100007696 3300005436 Bacteria 7582
27 Ga0070713_100579450 3300005436 Bacteria 1064
28 Ga0070710_10159338 3300005437 Unclassified 1398
29 Ga0070701_10019275 3300005438 Bacteria 3220
30 Ga0070711_100025962 3300005439 Bacteria 3836
31 Ga0070711_100240803 3300005439 Unclassified 1414
32 Ga0070708_100000418 3300005445 Bacteria 31903
33 Ga0070708_100001358 3300005445 Bacteria 18662
34 Ga0070708_100014079 3300005445 Bacteria 6573
35 Ga0070708_100040560 3300005445 Bacteria 4077
36 Ga0070708_100079044 3300005445 Bacteria 2975
37 Ga0070678_100393430 3300005456 Unclassified 1202
38 Ga0070662_100014657 3300005457 Bacteria 5240
39 Ga0070681_10000055 3300005458 Bacteria 80179
40 Ga0070681_10123330 3300005458 Bacteria 2524
41 Ga0070681_10186583 3300005458 Bacteria 1994
42 Ga0068867_100017425 3300005459 Bacteria 5103
43 Ga0070685_10003177 3300005466 Bacteria 8356
44 Ga0070706_100000173 3300005467 Bacteria 81500
45 Ga0070706_100036457 3300005467 Bacteria 4542
46 Ga0070706_100051368 3300005467 Bacteria 3805
47 Ga0070706_100107823 3300005467 Bacteria 2591
48 Ga0070706_100307377 3300005467 Bacteria 1479
49 Ga0070707_100000091 3300005468 Bacteria 81794
50 Ga0070707_100000719 3300005468 Bacteria 33081
51 Ga0070707_100005562 3300005468 Bacteria 11770
52 Ga0070707_100145297 3300005468 Bacteria 2309
53 Ga0070707_100434209 3300005468 Bacteria 1273
54 Ga0070698_100000162 3300005471 Bacteria 61345
55 Ga0070698_100009093 3300005471 Bacteria 10680
56 Ga0070699_100000032 3300005518 Bacteria 136937
57 Ga0070699_100001170 3300005518 Bacteria 24337
58 Ga0070699_100002540 3300005518 Bacteria 16392
59 Ga0070699_100031513 3300005518 Bacteria 4578
60 Ga0070699_100379098 3300005518 Bacteria 1277
61 Ga0070679_100134284 3300005530 Bacteria 2456
62 Ga0070679_100178315 3300005530 Bacteria 2098
63 Ga0070684_100010728 3300005535 Bacteria 7272
64 Ga0070697_100000138 3300005536 Bacteria 58927
65 Ga0070697_100000554 3300005536 Bacteria 28090
66 Ga0070697_100007958 3300005536 Bacteria 8261
67 Ga0070697_100013390 3300005536 Bacteria 6432
68 Ga0070672_100013361 3300005543 Bacteria 5798
69 Ga0070686_100005348 3300005544 Bacteria 7102
70 Ga0068855_100004676 3300005563 Bacteria 16724
71 Ga0068855_100005055 3300005563 Bacteria 16097
72 Ga0068855_100041356 3300005563 Bacteria 5463
73 Ga0068855_100059753 3300005563 Bacteria 4459
74 Ga0068855_100150064 3300005563 Bacteria 2650
75 Ga0070664_100020627 3300005564 Bacteria 5428
76 Ga0070664_100041836 3300005564 Bacteria 3867
77 Ga0070664_100110204 3300005564 Bacteria 2402
78 Ga0068857_100001831 3300005577 Bacteria 17108
79 Ga0068857_100009427 3300005577 Bacteria 8472
80 Ga0068857_100165254 3300005577 Bacteria 2010
81 Ga0068856_100002231 3300005614 Bacteria 20017
82 Ga0068856_100003398 3300005614 Bacteria 16113
83 Ga0068856_100039040 3300005614 Bacteria 4661
84 Ga0068852_100009082 3300005616 Bacteria 7360
85 Ga0068852_100020898 3300005616 Bacteria 5212
86 Ga0068859_100009881 3300005617 Bacteria 9636
87 Ga0068859_100022702 3300005617 Bacteria 6291
88 Ga0068864_100008839 3300005618 Bacteria 8305
89 Ga0068864_100009181 3300005618 Bacteria 8153
90 Ga0068866_10001284 3300005718 Bacteria 10871
91 Ga0068866_10086935 3300005718 Bacteria 1693
92 Ga0068870_10004874 3300005840 Bacteria 5806
93 Ga0068863_100015122 3300005841 Bacteria 7413
94 Ga0068863_100046712 3300005841 Bacteria 4110
95 Ga0068863_100124378 3300005841 Unclassified 2461
96 Ga0068858_100006202 3300005842 Bacteria 11656
97 Ga0068860_100008337 3300005843 Bacteria 10315
98 Ga0068860_100095169 3300005843 Bacteria 2839
99 Ga0068860_100123893 3300005843 Bacteria 2477
100 Ga0068862_100032243 3300005844 Unclassified 4426
101 Ga0081540_1025127 3300005983 Bacteria 3438
102 Ga0070717_10002172 3300006028 Bacteria 13753
103 Ga0070717_10013246 3300006028 Bacteria 6311
104 Ga0070717_10013813 3300006028 Bacteria 6200
105 Ga0070717_10176387 3300006028 Bacteria 1861
106 Ga0070715_10008430 3300006163 Bacteria 3592
107 Ga0070716_100000245 3300006173 Bacteria 21690
108 Ga0070716_100162621 3300006173 Bacteria 1448
109 Ga0070712_100008118 3300006175 Bacteria 6591
110 Ga0097621_100000990 3300006237 Bacteria 19959
111 Ga0097621_100001471 3300006237 Bacteria 16119
112 Ga0068871_100000631 3300006358 Bacteria 24196
113 Ga0068871_100002904 3300006358 Bacteria 11754
114 Ga0075434_100001193 3300006871 Bacteria 21564
115 Ga0068865_100006013 3300006881 Bacteria 7394
116 Ga0068865_100032132 3300006881 Bacteria 3504
117 Ga0075436_100001413 3300006914 Bacteria 16326
118 Ga0097620_100009881 3300006931 Bacteria 9636
119 Ga0097620_100022702 3300006931 Bacteria 6291
120 Ga0075435_100075355 3300007076 Bacteria 2763
121 Ga0099795_10180090 3300007788 Unclassified 882
122 Ga0105250_10019442 3300009092 Bacteria 2746
123 Ga0105240_10010206 3300009093 Bacteria 13218
124 Ga0105240_10023316 3300009093 Bacteria 8190
125 Ga0105240_10058500 3300009093 Bacteria 4812
126 Ga0105240_10102847 3300009093 Bacteria 3471
127 Ga0105240_10166381 3300009093 Bacteria 2615
128 Ga0105240_10388577 3300009093 Bacteria 1574
129 Ga0105240_10407153 3300009093 Bacteria 1531
130 Ga0105245_10023423 3300009098 Bacteria 5420
131 Ga0105245_10233080 3300009098 Bacteria 1781
132 Ga0105247_10004129 3300009101 Bacteria 9322
133 Ga0105247_10044242 3300009101 Bacteria 2730
134 Ga0105241_10022956 3300009174 Bacteria 4625
135 Ga0105242_10069940 3300009176 Bacteria 2909
136 Ga0105242_10157106 3300009176 Unclassified 1987
137 Ga0105242_10450117 3300009176 Bacteria 1214
138 Ga0105248_10023339 3300009177 Bacteria 6871
139 Ga0105248_10193786 3300009177 Unclassified 2290
140 Ga0105237_10008468 3300009545 Bacteria 11130
141 Ga0105237_10050034 3300009545 Bacteria 4200
142 Ga0105237_10070129 3300009545 Bacteria 3500
143 Ga0105237_10162119 3300009545 Bacteria 2235
144 Ga0105237_10620222 3300009545 Unclassified 1088
145 Ga0105238_10000533 3300009551 Bacteria 39822
146 Ga0105238_10048988 3300009551 Bacteria 4256
147 Ga0105238_10145641 3300009551 Bacteria 2345
148 Ga0105238_10231530 3300009551 Bacteria 1824
149 Ga0105249_10009792 3300009553 Bacteria 8397
150 Ga0105249_10212288 3300009553 Bacteria 1900
151 Ga0105239_10044199 3300010375 Bacteria 4883
152 Ga0105246_10020504 3300011119 Unclassified 4240
153 Ga0105246_10406360 3300011119 Unclassified 1132
154 Ga0157373_10024972 3300013100 Bacteria 4326
155 Ga0157371_10009218 3300013102 Bacteria 7787
156 Ga0157371_10060117 3300013102 Bacteria 2694
157 Ga0157370_10013252 3300013104 Bacteria 8496
158 Ga0157369_10000170 3300013105 Bacteria 91583
159 Ga0157369_10001450 3300013105 Bacteria 29095
160 Ga0157369_10009295 3300013105 Bacteria 11244
161 Ga0157369_10028986 3300013105 Bacteria 6122
162 Ga0157369_10125546 3300013105 Bacteria 2721
163 Ga0157369_10272925 3300013105 Bacteria 1762
164 Ga0157374_10001028 3300013296 Bacteria 24226
165 Ga0157374_10019562 3300013296 Bacteria 5994
166 Ga0157374_10032051 3300013296 Bacteria 4783
167 Ga0157374_10053087 3300013296 Bacteria 3777
168 Ga0157378_10000085 3300013297 Bacteria 87651
169 Ga0157378_10020919 3300013297 Bacteria 5756
170 Ga0157378_10037964 3300013297 Bacteria 4268
171 Ga0157378_10525411 3300013297 Bacteria 1185
172 Ga0163162_10015629 3300013306 Bacteria 7417
173 Ga0157372_10001051 3300013307 Bacteria 30170
174 Ga0157372_10005586 3300013307 Bacteria 13369
175 Ga0157372_10014530 3300013307 Bacteria 8425
176 Ga0157372_10016900 3300013307 Bacteria 7833
177 Ga0157372_10017422 3300013307 Bacteria 7709
178 Ga0157372_10031370 3300013307 Bacteria 5819
179 Ga0157372_10384410 3300013307 Bacteria 1635
180 Ga0157372_10981295 3300013307 Bacteria 979
181 Ga0157375_10018555 3300013308 Bacteria 6311
182 Ga0157375_10048483 3300013308 Bacteria 4155
183 Ga0163163_10023669 3300014325 Bacteria 5832
184 Ga0163163_10103289 3300014325 Bacteria 2875
185 Ga0163163_10103801 3300014325 Bacteria 2867
186 Ga0182008_10004708 3300014497 Bacteria 7913
187 Ga0157377_10000650 3300014745 Bacteria 14510
188 Ga0157376_10017765 3300014969 Bacteria 5435
189 Ga0157376_10115831 3300014969 Unclassified 2367
190 Ga0157376_10185235 3300014969 Bacteria 1906
191 Ga0157376_10212466 3300014969 Unclassified 1787
192 Ga0157376_10272640 3300014969 Bacteria 1590
193 Ga0163161_10022848 3300017792 Unclassified 4406
194 Ga0224570_100342 3300022730 Unclassified 3594
195 Ga0228598_1002236 3300024227 Unclassified 4234
196 Ga0228598_1002838 3300024227 Bacteria 3759
197 Ga0228598_1015227 3300024227 Bacteria 1519
198 Ga0207697_10010696 3300025315 Bacteria 3913
199 Ga0207692_10131581 3300025898 Unclassified 1413
200 Ga0207642_10007792 3300025899 Bacteria 3633
201 Ga0207710_10003632 3300025900 Bacteria 6840
202 Ga0207647_10005527 3300025904 Bacteria 9254
203 Ga0207647_10005628 3300025904 Bacteria 9149
204 Ga0207685_10004681 3300025905 Bacteria 3515
205 Ga0207699_10228115 3300025906 Bacteria 1274
206 Ga0207645_10003610 3300025907 Bacteria 11708
207 Ga0207643_10003846 3300025908 Bacteria 8078
208 Ga0207684_10000238 3300025910 Bacteria 83165
209 Ga0207684_10000267 3300025910 Bacteria 77172
210 Ga0207684_10075595 3300025910 Bacteria 2863
211 Ga0207684_10189100 3300025910 Unclassified 1776
212 Ga0207684_10220496 3300025910 Bacteria 1637
213 Ga0207707_10002932 3300025912 Bacteria 15197
214 Ga0207707_10447770 3300025912 Unclassified 1105
215 Ga0207695_10011271 3300025913 Bacteria 10839
216 Ga0207695_10026452 3300025913 Bacteria 6476
217 Ga0207695_10115120 3300025913 Bacteria 2663
218 Ga0207695_10135834 3300025913 Bacteria 2412
219 Ga0207695_10244774 3300025913 Bacteria 1694
220 Ga0207695_10542146 3300025913 Bacteria 1045
221 Ga0207671_10044414 3300025914 Bacteria 3287
222 Ga0207671_10093354 3300025914 Bacteria 2270
223 Ga0207693_10003665 3300025915 Bacteria 13111
224 Ga0207693_10025014 3300025915 Bacteria 4736
225 Ga0207693_10102196 3300025915 Bacteria 2248
226 Ga0207663_10011038 3300025916 Bacteria 4833
227 Ga0207663_10106291 3300025916 Bacteria 1897
228 Ga0207663_10246326 3300025916 Bacteria 1313
229 Ga0207662_10000619 3300025918 Bacteria 15920
230 Ga0207657_10001795 3300025919 Bacteria 23148
231 Ga0207657_10027877 3300025919 Bacteria 5164
232 Ga0207649_10000344 3300025920 Bacteria 35179
233 Ga0207652_10089641 3300025921 Unclassified 2701
234 Ga0207652_10101032 3300025921 Bacteria 2547
235 Ga0207646_10000073 3300025922 Bacteria 140267
236 Ga0207646_10000296 3300025922 Bacteria 67683
237 Ga0207646_10124057 3300025922 Bacteria 2322
238 Ga0207646_10199504 3300025922 Bacteria 1807
239 Ga0207681_10016157 3300025923 Bacteria 4663
240 Ga0207694_10003097 3300025924 Bacteria 13305
241 Ga0207694_10070066 3300025924 Bacteria 2739
242 Ga0207694_10570439 3300025924 Bacteria 951
243 Ga0207650_10000058 3300025925 Bacteria 153056
244 Ga0207687_10167295 3300025927 Bacteria 1693
245 Ga0207700_10011105 3300025928 Bacteria 5728
246 Ga0207700_10035317 3300025928 Bacteria 3599
247 Ga0207700_10039304 3300025928 Bacteria 3443
248 Ga0207700_10107711 3300025928 Unclassified 2236
249 Ga0207664_10004289 3300025929 Bacteria 9653
250 Ga0207664_10077114 3300025929 Bacteria 2700
251 Ga0207690_10080103 3300025932 Bacteria 2278
252 Ga0207706_10000732 3300025933 Bacteria 34191
253 Ga0207686_10132118 3300025934 Bacteria 1714
254 Ga0207670_10014752 3300025936 Bacteria 4649
255 Ga0207669_10032873 3300025937 Bacteria 2920
256 Ga0207704_10098732 3300025938 Bacteria 1940
257 Ga0207665_10000049 3300025939 Bacteria 76350
258 Ga0207691_10003257 3300025940 Bacteria 15809
259 Ga0207711_10022596 3300025941 Bacteria 5262
260 Ga0207689_10001556 3300025942 Bacteria 21755
261 Ga0207689_10003330 3300025942 Bacteria 14717
262 Ga0207661_10338926 3300025944 Bacteria 1354
263 Ga0207679_10000141 3300025945 Bacteria 59703
264 Ga0207679_10043384 3300025945 Bacteria 3238
265 Ga0207667_10001390 3300025949 Bacteria 30343
266 Ga0207667_10003723 3300025949 Bacteria 18800
267 Ga0207667_10369812 3300025949 Unclassified 1461
268 Ga0207667_10415296 3300025949 Bacteria 1369
269 Ga0207651_10001206 3300025960 Bacteria 11571
270 Ga0207640_10013997 3300025981 Bacteria 4608
271 Ga0207677_10006797 3300026023 Bacteria 6279
272 Ga0207703_10003518 3300026035 Bacteria 13098
273 Ga0207703_10546356 3300026035 Unclassified 1092
274 Ga0207639_10119143 3300026041 Bacteria 2166
275 Ga0207678_10000143 3300026067 Bacteria 58580
276 Ga0207702_10000089 3300026078 Bacteria 105440
277 Ga0207702_10006262 3300026078 Bacteria 10283
278 Ga0207641_10000323 3300026088 Bacteria 58693
279 Ga0207641_10016566 3300026088 Bacteria 6035
280 Ga0207641_10039558 3300026088 Bacteria 3945
281 Ga0207641_10096456 3300026088 Bacteria 2597
282 Ga0207648_10000870 3300026089 Bacteria 34025
283 Ga0207648_10024060 3300026089 Bacteria 5444
284 Ga0207676_10001926 3300026095 Bacteria 15155
285 Ga0207676_10003334 3300026095 Bacteria 11384
286 Ga0207674_10008508 3300026116 Bacteria 11847
287 Ga0207674_10030135 3300026116 Bacteria 5707
288 Ga0207675_100527997 3300026118 Unclassified 1177
289 Ga0207683_10000493 3300026121 Bacteria 36475
290 Ga0265356_1005725 3300028017 Unclassified 1472
291 Ga0268266_10016009 3300028379 Bacteria 6413
292 Ga0268265_10009683 3300028380 Bacteria 6504
293 Ga0268264_10115618 3300028381 Bacteria 2357
294 Ga0268264_10232381 3300028381 Bacteria 1704
295 Ga0265336_10006333 3300028666 Bacteria 4275
296 Ga0265338_10005895 3300028800 Bacteria 15803
297 Ga0265324_10023117 3300029957 Bacteria 2217
298 Ga0265762_1001299 3300030760 Unclassified 4544
299 Ga0265760_10008373 3300031090 Bacteria 2958
300 Ga0265331_10079325 3300031250 Bacteria 1528
301 Ga0265316_10001490 3300031344 Bacteria 25094
302 Ga0265316_10089575 3300031344 Bacteria 2348
303 Ga0265314_10108302 3300031711 Bacteria 1771
304 Ga0316212_1000568 3300033547 Unclassified 4596
305 Ga0373936_0002523 3300035113 Bacteria 6866
306 Ga0373935_0314293 3300035692 Unclassified 1110
307 Ga0373933_0035919 3300035724 Unclassified 2898
308 Ga0373925_0002703 3300037068 Bacteria 14059
309 Ga0373925_0176713 3300037068 Unclassified 1688
310 Ga0466970_0281067 3300044765 Bacteria 936
311 Ga0466959_0166142 3300045049 Bacteria 1550
312 Ga0466959_0254505 3300045049 Bacteria 1211
313 Ga0451576_0394040 3300045051 Unclassified 1452
314 Ga0466967_0001644 3300045976 Bacteria 13213
315 Ga0495629_0040325 3300046459 Unclassified 3284
316 Ga0495580_0001003 3300046472 Bacteria 24839
317 Ga0495580_0006723 3300046472 Bacteria 9336
318 Ga0495580_0019254 3300046472 Bacteria 5072
319 Ga0495580_0071875 3300046472 Bacteria 2417
320 Ga0495580_0105162 3300046472 Unclassified 1961
321 Ga0495606_0015485 3300046507 Bacteria 5871
322 Ga0495623_0149322 3300046679 Bacteria 1383
323 Ga0495669_0024381 3300046684 Unclassified 2635
324 Ga0495669_0036397 3300046684 Unclassified 2175
325 Ga0495602_0144742 3300048088 Bacteria 1877
326 Ga0496103_0240700 3300048906 Unclassified 1164
327 Ga0496104_0047773 3300048907 Bacteria 4035
328 Ga0496104_0194238 3300048907 Bacteria 1942
329 Ga0496108_0000444 3300048911 Bacteria 33175
330 Ga0496109_0000177 3300048912 Bacteria 63414
331 Ga0496109_0530245 3300048912 Bacteria 1111
332 Ga0496110_0001872 3300048913 Bacteria 15534
333 Ga0496112_0000060 3300048915 Bacteria 74795
334 Ga0496112_0000372 3300048915 Bacteria 29345
335 Ga0496112_0003809 3300048915 Bacteria 12604
336 Ga0496112_0030272 3300048915 Bacteria 5237
337 Ga0496113_0002914 3300048916 Bacteria 10095
338 Ga0496113_0025637 3300048916 Bacteria 4206
339 Ga0496113_0417643 3300048916 Bacteria 1077
340 nmdc:mga0n895_560_c1 3300050512 Bacteria 25527
341 nmdc:mga0rr50_15588_c1 3300050513 Bacteria 5020
342 nmdc:mga08x19_49286_c1 3300050514 Bacteria 2701
343 Ga0495580_0024070
344 MBSR1b_contig_12892957
345 JGI24751J29686_10001757
346 rootL2_10123468
347 rootH1_10220092
348 Ga0070676_10035848
349 Ga0070683_100003077
350 Ga0070683_100035299
351 Ga0070690_100021065
352 Ga0070670_100015604
353 Ga0068869_100100783
354 Ga0070682_100011564
355 Ga0070682_100039464
356 Ga0068868_100031795
357 Ga0068868_100244819
358 Ga0070689_100004451
359 Ga0070661_100018070
360 Ga0070675_100025908
361 Ga0070673_100001572
362 Ga0070688_100005169
363 Ga0070659_100004505
364 Ga0070714_100003563
365 Ga0070714_100038412
366 Ga0070714_100051484
367 Ga0070714_100121099
368 Ga0070713_100007696
369 Ga0070713_100579450
370 Ga0070710_10159338
371 Ga0070701_10019275
372 Ga0070711_100025962
373 Ga0070711_100240803
374 Ga0070708_100000418
375 Ga0070708_100001358
376 Ga0070708_100014079
377 Ga0070708_100040560
378 Ga0070708_100079044
379 Ga0070678_100393430
380 Ga0070662_100014657
381 Ga0070681_10000055
382 Ga0070681_10123330
383 Ga0070681_10186583
384 Ga0068867_100017425
385 Ga0070685_10003177
386 Ga0070706_100000173
387 Ga0070706_100036457
388 Ga0070706_100051368
389 Ga0070706_100107823
390 Ga0070706_100307377
391 Ga0070707_100000091
392 Ga0070707_100000719
393 Ga0070707_100005562
394 Ga0070707_100145297
395 Ga0070707_100434209
396 Ga0070698_100000162
397 Ga0070698_100009093
398 Ga0070699_100000032
399 Ga0070699_100001170
400 Ga0070699_100002540
401 Ga0070699_100031513
402 Ga0070699_100379098
403 Ga0070679_100134284
404 Ga0070679_100178315
405 Ga0070684_100010728
406 Ga0070697_100000138
407 Ga0070697_100000554
408 Ga0070697_100007958
409 Ga0070697_100013390
410 Ga0070672_100013361
411 Ga0070686_100005348
412 Ga0068855_100004676
413 Ga0068855_100005055
414 Ga0068855_100041356
415 Ga0068855_100059753
416 Ga0068855_100150064
417 Ga0070664_100020627
418 Ga0070664_100041836
419 Ga0070664_100110204
420 Ga0068857_100001831
421 Ga0068857_100009427
422 Ga0068857_100165254
423 Ga0068856_100002231
424 Ga0068856_100003398
425 Ga0068856_100039040
426 Ga0068852_100009082
427 Ga0068852_100020898
428 Ga0068859_100009881
429 Ga0068859_100022702
430 Ga0068864_100008839
431 Ga0068864_100009181
432 Ga0068866_10001284
433 Ga0068866_10086935
434 Ga0068870_10004874
435 Ga0068863_100015122
436 Ga0068863_100046712
437 Ga0068863_100124378
438 Ga0068858_100006202
439 Ga0068860_100008337
440 Ga0068860_100095169
441 Ga0068860_100123893
442 Ga0068862_100032243
443 Ga0081540_1025127
444 Ga0070717_10002172
445 Ga0070717_10013246
446 Ga0070717_10013813
447 Ga0070717_10176387
448 Ga0070715_10008430
449 Ga0070716_100000245
450 Ga0070716_100162621
451 Ga0070712_100008118
452 Ga0097621_100000990
453 Ga0097621_100001471
454 Ga0068871_100000631
455 Ga0068871_100002904
456 Ga0075434_100001193
457 Ga0068865_100006013
458 Ga0068865_100032132
459 Ga0075436_100001413
460 Ga0097620_100009881
461 Ga0097620_100022702
462 Ga0075435_100075355
463 Ga0099795_10180090
464 Ga0105250_10019442
465 Ga0105240_10010206
466 Ga0105240_10023316
467 Ga0105240_10058500
468 Ga0105240_10102847
469 Ga0105240_10166381
470 Ga0105240_10388577
471 Ga0105240_10407153
472 Ga0105245_10023423
473 Ga0105245_10233080
474 Ga0105247_10004129
475 Ga0105247_10044242
476 Ga0105241_10022956
477 Ga0105242_10069940
478 Ga0105242_10157106
479 Ga0105242_10450117
480 Ga0105248_10023339
481 Ga0105248_10193786
482 Ga0105237_10008468
483 Ga0105237_10050034
484 Ga0105237_10070129
485 Ga0105237_10162119
486 Ga0105237_10620222
487 Ga0105238_10000533
488 Ga0105238_10048988
489 Ga0105238_10145641
490 Ga0105238_10231530
491 Ga0105249_10009792
492 Ga0105249_10212288
493 Ga0105239_10044199
494 Ga0105246_10020504
495 Ga0105246_10406360
496 Ga0157373_10024972
497 Ga0157371_10009218
498 Ga0157371_10060117
499 Ga0157370_10013252
500 Ga0157369_10000170
501 Ga0157369_10001450
502 Ga0157369_10009295
503 Ga0157369_10028986
504 Ga0157369_10125546
505 Ga0157369_10272925
506 Ga0157374_10001028
507 Ga0157374_10019562
508 Ga0157374_10032051
509 Ga0157374_10053087
510 Ga0157378_10000085
511 Ga0157378_10020919
512 Ga0157378_10037964
513 Ga0157378_10525411
514 Ga0163162_10015629
515 Ga0157372_10001051
516 Ga0157372_10005586
517 Ga0157372_10014530
518 Ga0157372_10016900
519 Ga0157372_10017422
520 Ga0157372_10031370
521 Ga0157372_10384410
522 Ga0157372_10981295
523 Ga0157375_10018555
524 Ga0157375_10048483
525 Ga0163163_10023669
526 Ga0163163_10103289
527 Ga0163163_10103801
528 Ga0182008_10004708
529 Ga0157377_10000650
530 Ga0157376_10017765
531 Ga0157376_10115831
532 Ga0157376_10185235
533 Ga0157376_10212466
534 Ga0157376_10272640
535 Ga0163161_10022848
536 Ga0224570_100342
537 Ga0228598_1002236
538 Ga0228598_1002838
539 Ga0228598_1015227
540 Ga0207697_10010696
541 Ga0207692_10131581
542 Ga0207642_10007792
543 Ga0207710_10003632
544 Ga0207647_10005527
545 Ga0207647_10005628
546 Ga0207685_10004681
547 Ga0207699_10228115
548 Ga0207645_10003610
549 Ga0207643_10003846
550 Ga0207684_10000238
551 Ga0207684_10000267
552 Ga0207684_10075595
553 Ga0207684_10189100
554 Ga0207684_10220496
555 Ga0207707_10002932
556 Ga0207707_10447770
557 Ga0207695_10011271
558 Ga0207695_10026452
559 Ga0207695_10115120
560 Ga0207695_10135834
561 Ga0207695_10244774
562 Ga0207695_10542146
563 Ga0207671_10044414
564 Ga0207671_10093354
565 Ga0207693_10003665
566 Ga0207693_10025014
567 Ga0207693_10102196
568 Ga0207663_10011038
569 Ga0207663_10106291
570 Ga0207663_10246326
571 Ga0207662_10000619
572 Ga0207657_10001795
573 Ga0207657_10027877
574 Ga0207649_10000344
575 Ga0207652_10089641
576 Ga0207652_10101032
577 Ga0207646_10000073
578 Ga0207646_10000296
579 Ga0207646_10124057
580 Ga0207646_10199504
581 Ga0207681_10016157
582 Ga0207694_10003097
583 Ga0207694_10070066
584 Ga0207694_10570439
585 Ga0207650_10000058
586 Ga0207687_10167295
587 Ga0207700_10011105
588 Ga0207700_10035317
589 Ga0207700_10039304
590 Ga0207700_10107711
591 Ga0207664_10004289
592 Ga0207664_10077114
593 Ga0207690_10080103
594 Ga0207706_10000732
595 Ga0207686_10132118
596 Ga0207670_10014752
597 Ga0207669_10032873
598 Ga0207704_10098732
599 Ga0207665_10000049
600 Ga0207691_10003257
601 Ga0207711_10022596
602 Ga0207689_10001556
603 Ga0207689_10003330
604 Ga0207661_10338926
605 Ga0207679_10000141
606 Ga0207679_10043384
607 Ga0207667_10001390
608 Ga0207667_10003723
609 Ga0207667_10369812
610 Ga0207667_10415296
611 Ga0207651_10001206
612 Ga0207640_10013997
613 Ga0207677_10006797
614 Ga0207703_10003518
615 Ga0207703_10546356
616 Ga0207639_10119143
617 Ga0207678_10000143
618 Ga0207702_10000089
619 Ga0207702_10006262
620 Ga0207641_10000323
621 Ga0207641_10016566
622 Ga0207641_10039558
623 Ga0207641_10096456
624 Ga0207648_10000870
625 Ga0207648_10024060
626 Ga0207676_10001926
627 Ga0207676_10003334
628 Ga0207674_10008508
629 Ga0207674_10030135
630 Ga0207675_100527997
631 Ga0207683_10000493
632 Ga0265356_1005725
633 Ga0268266_10016009
634 Ga0268265_10009683
635 Ga0268264_10115618
636 Ga0268264_10232381
637 Ga0265336_10006333
638 Ga0265338_10005895
639 Ga0265324_10023117
640 Ga0265762_1001299
641 Ga0265760_10008373
642 Ga0265331_10079325
643 Ga0265316_10001490
644 Ga0265316_10089575
645 Ga0265314_10108302
646 Ga0316212_1000568
647 Ga0373936_0002523
648 Ga0373935_0314293
649 Ga0373933_0035919
650 Ga0373925_0002703
651 Ga0373925_0176713
652 Ga0466970_0281067
653 Ga0466959_0166142
654 Ga0466959_0254505
655 Ga0451576_0394040
656 Ga0466967_0001644
657 Ga0495629_0040325
658 Ga0495580_0001003
659 Ga0495580_0006723
660 Ga0495580_0019254
661 Ga0495580_0071875
662 Ga0495580_0105162
663 Ga0495606_0015485
664 Ga0495623_0149322
665 Ga0495669_0024381
666 Ga0495669_0036397
667 Ga0495602_0144742
668 Ga0496103_0240700
669 Ga0496104_0047773
670 Ga0496104_0194238
671 Ga0496108_0000444
672 Ga0496109_0000177
673 Ga0496109_0530245
674 Ga0496110_0001872
675 Ga0496112_0000060
676 Ga0496112_0000372
677 Ga0496112_0003809
678 Ga0496112_0030272
679 Ga0496113_0002914
680 Ga0496113_0025637
681 Ga0496113_0417643
682 nmdc:mga0n895_560_c1
683 nmdc:mga0rr50_15588_c1
684 nmdc:mga08x19_49286_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

166

306

0.98

PF22435

MRM3-like_sub_bind

MRM3-like substrate binding domain

60

147

0.9

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

82

155

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9257 118 279
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.9089 17 275
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.8993 118 279
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.8986 17 275
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8855 130 277
ID Description Score Start End Superfamily
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9428 120 279 3.40.1280.10
5l0zB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.934 130 277 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9324 130 275 3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.93 122 278 3.40.1280.10
af_P9WFY3_121_283_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9299 121 279 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A7C3DNX2-F1-model_v4 RNA methyltransferase 0.9618 131 278 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A0M3CBX5-F1-model_v4 deleted 0.9534 138 277
AF-A0A3D1MDE4-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9525 147 278 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-M6KM91-F1-model_v4 RNA methyltransferase, TrmH family 0.9512 132 279 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A1F9D5I0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.951 134 277 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Map