F415334

General Info

Members Datasets Scaffolds Average Seq Length
342 212 686 242

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0005383|Ga0496122_0005383_10324_11118
Length 264
Sequence VSICEKQLVKLVFNKNYLCFMNQNTNKTVLILGANSDVAKQCIKQYVEKGFSVIAASRNTTSLNDFIESNNLDGSKVMVMYFDAADFDSHHEFYSSLSVKPHIVVYAAGFLVDNQKALTDFKGAKQMIEVNYMGGVSILSMIAMDRSNTNLERIIGLSSLSGVRGRKSNFVYGSTKAAFTQFLAGLRQELASRKIIVNALVIGYIRTKINEGLELNESLIMEPDYVAKFIVNAGSSFTIVPNFEWKIIYHILRLLPESLAAKLP

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
152 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
153 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
156 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
157 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
158 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
159 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
160 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
165 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
168 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
169 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
170 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
171 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
172 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
173 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
174 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
175 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
176 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
177 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
178 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
179 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
180 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
181 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
182 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
183 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
184 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
185 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
186 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
187 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
188 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
189 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
190 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
191 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
192 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
193 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
194 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
195 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
196 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
197 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
198 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
199 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
200 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
201 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
202 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
203 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
204 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
205 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
206 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
207 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
208 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
209 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
210 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
211 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
212 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.13
Metatranscriptomes 0
Isolates 12.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 7.6
Nodule 0.29
Rhizoplane 0.58
Rhizosphere 73.1
Stem 0
Stem Tuber 0
Unclassified 14.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0005383 3300048925 Bacteria 15279
2 SwRhRL2b_contig_1389943 2162886007 Bacteria 823
3 SwRhRL2b_contig_753927 2162886007 Bacteria 1279
4 JGI24736J21556_1011898 3300001904 Bacteria 1412
5 JGI24741J21665_1000699 3300001915 Bacteria 10128
6 rootH1_10000428 3300003316 Bacteria 39625
7 rootH2_10006124 3300003320 Bacteria 45135
8 rootH2_10008379 3300003320 Bacteria 3566
9 rootH2_10010920 3300003320 Bacteria 23104
10 rootH2_10020079 3300003320 Bacteria 39210
11 rootH2_10104731 3300003320 Bacteria 11033
12 rootH2_10139933 3300003320 Bacteria 5119
13 rootL2_10000931 3300003322 Bacteria 12413
14 rootL2_10029102 3300003322 Bacteria 14496
15 rootL2_10044184 3300003322 Bacteria 5930
16 rootL2_10050740 3300003322 Bacteria 18783
17 rootL2_10065433 3300003322 Bacteria 23193
18 rootL2_10253090 3300003322 Unclassified 1284
19 rootL2_10293138 3300003322 Bacteria 3660
20 rootH1_10000888 3300003323 Bacteria 41861
21 rootH1_10025715 3300003316 Bacteria 1790
22 rootH1_10025715 3300003323 Bacteria 1550
23 rootH1_10025716 3300003323 Bacteria 14191
24 rootH1_10056533 3300003323 Bacteria 4339
25 rootH1_10075457 3300003323 Bacteria 9626
26 rootH1_10095951 3300003323 Bacteria 1271
27 rootH1_10099913 3300003323 Bacteria 5014
28 rootH1_10112543 3300003316 Bacteria 1213
29 rootH1_10112543 3300003323 Bacteria 2965
30 rootH1_10265201 3300003323 Bacteria 5475
31 JGI25160J50197_1012042 3300003354 Bacteria 3030
32 Ga0055535_1004257 3300003761 Bacteria 3567
33 Ga0055534_1007368 3300003784 Bacteria 2628
34 Ga0055530_10007572 3300003791 Bacteria 4544
35 Ga0065165_1001654 3300005262 Bacteria 22603
36 Ga0065165_1004229 3300005262 Bacteria 9127
37 Ga0065714_10075715 3300005288 Bacteria 2874
38 Ga0065704_10075150 3300005289 Bacteria 5766
39 Ga0065704_10106346 3300005289 Bacteria 2085
40 Ga0065712_10135311 3300005290 Bacteria 1504
41 Ga0070683_100001309 3300005329 Bacteria 18987
42 Ga0070683_100004590 3300005329 Bacteria 11400
43 Ga0070683_100049052 3300005329 Bacteria 3904
44 Ga0070683_101047264 3300005329 Bacteria 783
45 Ga0070670_100016897 3300005331 Bacteria 6264
46 Ga0070670_100594511 3300005331 Bacteria 990
47 Ga0070670_100601169 3300005331 Bacteria 984
48 Ga0070666_10042901 3300005335 Unclassified 3027
49 Ga0070666_10428558 3300005335 Bacteria 953
50 Ga0070682_100000187 3300005337 Bacteria 46443
51 Ga0068868_100065765 3300005338 Bacteria 2881
52 Ga0070660_100041518 3300005339 Bacteria 3507
53 Ga0070691_10008899 3300005341 Bacteria 4596
54 Ga0070661_100065188 3300005344 Unclassified 2677
55 Ga0070668_100040170 3300005347 Bacteria 3580
56 Ga0070668_100362504 3300005347 Bacteria 1229
57 Ga0070671_100140474 3300005355 Unclassified 2038
58 Ga0070673_100378257 3300005364 Bacteria 1262
59 Ga0070673_100685903 3300005364 Bacteria 940
60 Ga0070659_100035764 3300005366 Bacteria 3869
61 Ga0070659_100379492 3300005366 Bacteria 1190
62 Ga0070684_100003969 3300005535 Bacteria 11209
63 Ga0070684_100226852 3300005535 Unclassified 1705
64 Ga0070684_100282632 3300005535 Bacteria 1520
65 Ga0068853_100065775 3300005539 Bacteria 3146
66 Ga0068853_100499499 3300005539 Bacteria 1148
67 Ga0070672_100056265 3300005543 Bacteria 3084
68 Ga0068855_100006583 3300005563 Bacteria 14123
69 Ga0070664_100017474 3300005564 Bacteria 5890
70 Ga0070664_100052182 3300005564 Bacteria 3463
71 Ga0068857_100745738 3300005577 Bacteria 932
72 Ga0068854_100041370 3300005578 Unclassified 3256
73 Ga0068854_100117017 3300005578 Bacteria 2018
74 Ga0068856_100067587 3300005614 Unclassified 3532
75 Ga0068856_100296079 3300005614 Bacteria 1635
76 Ga0068852_100004016 3300005616 Bacteria 10346
77 Ga0068852_100083601 3300005616 Bacteria 2839
78 Ga0068852_100120868 3300005616 Bacteria 2398
79 Ga0068852_100128173 3300005616 Unclassified 2333
80 Ga0068852_100189729 3300005616 Unclassified 1938
81 Ga0068852_100388674 3300005616 Unclassified 1370
82 Ga0068852_100395997 3300005616 Bacteria 1357
83 Ga0068852_100494509 3300005616 Bacteria 1217
84 Ga0068864_100223036 3300005618 Bacteria 1740
85 Ga0068864_100374172 3300005618 Unclassified 1349
86 Ga0068851_10110134 3300005834 Unclassified 1469
87 Ga0068851_10288279 3300005834 Bacteria 941
88 Ga0081540_1002851 3300005983 Bacteria 13999
89 Ga0105244_10000001 3300009036 Bacteria 1034899
90 Ga0105240_10000160 3300009093 Bacteria 137390
91 Ga0105240_10000846 3300009093 Bacteria 55115
92 Ga0105240_10002203 3300009093 Bacteria 31766
93 Ga0105240_10112820 3300009093 Bacteria 3285
94 Ga0105243_10000447 3300009148 Bacteria 43040
95 Ga0105243_10078954 3300009148 Bacteria 2681
96 Ga0105241_10000604 3300009174 Bacteria 27074
97 Ga0105237_10005255 3300009545 Bacteria 14654
98 Ga0105237_10007307 3300009545 Bacteria 12114
99 Ga0105237_10009649 3300009545 Bacteria 10330
100 Ga0105237_10032304 3300009545 Bacteria 5300
101 Ga0105237_10057406 3300009545 Unclassified 3896
102 Ga0105237_10117476 3300009545 Unclassified 2654
103 Ga0105238_10004074 3300009551 Bacteria 14490
104 Ga0105238_10141812 3300009551 Unclassified 2379
105 Ga0105238_10184100 3300009551 Unclassified 2065
106 Ga0105239_10002380 3300010375 Bacteria 23985
107 Ga0105239_10005620 3300010375 Bacteria 14658
108 Ga0105239_10008598 3300010375 Bacteria 11574
109 Ga0105239_10064280 3300010375 Bacteria 4029
110 Ga0105239_10222237 3300010375 Bacteria 2118
111 Ga0105239_10229544 3300010375 Unclassified 2083
112 Ga0157373_10048976 3300013100 Unclassified 3012
113 Ga0157373_10144645 3300013100 Bacteria 1672
114 Ga0157371_10007547 3300013102 Bacteria 8794
115 Ga0157371_10020574 3300013102 Bacteria 4856
116 Ga0157371_10339868 3300013102 Bacteria 1092
117 Ga0157370_10002065 3300013104 Bacteria 24606
118 Ga0157370_10006322 3300013104 Bacteria 13087
119 Ga0157370_10057767 3300013104 Bacteria 3688
120 Ga0157369_10014957 3300013105 Bacteria 8758
121 Ga0157369_10032724 3300013105 Bacteria 5714
122 Ga0157369_10678734 3300013105 Bacteria 1061
123 Ga0157374_10000004 3300013296 Bacteria 759774
124 Ga0157374_10048159 3300013296 Bacteria 3955
125 Ga0157374_10748305 3300013296 Unclassified 992
126 Ga0157378_10072205 3300013297 Unclassified 3101
127 Ga0163162_10536478 3300013306 Bacteria 1299
128 Ga0157372_10001393 3300013307 Bacteria 26053
129 Ga0157372_10001615 3300013307 Bacteria 24488
130 Ga0157372_10048220 3300013307 Bacteria 4735
131 Ga0157372_10052642 3300013307 Bacteria 4534
132 Ga0157372_10119872 3300013307 Bacteria 3020
133 Ga0157372_10128965 3300013307 Unclassified 2909
134 Ga0157372_10135353 3300013307 Bacteria 2837
135 Ga0157372_10146580 3300013307 Bacteria 2722
136 Ga0157372_10192615 3300013307 Bacteria 2361
137 Ga0157372_10235901 3300013307 Bacteria 2122
138 Ga0157372_10595751 3300013307 Bacteria 1288
139 Ga0157372_10674151 3300013307 Bacteria 1204
140 Ga0157375_10001396 3300013308 Bacteria 20834
141 Ga0157375_10413719 3300013308 Bacteria 1515
142 Ga0163163_10006249 3300014325 Bacteria 10395
143 Ga0157377_10055665 3300014745 Unclassified 2243
144 Ga0157376_10094103 3300014969 Bacteria 2603
145 Ga0182006_1000003 3300015261 Bacteria 826681
146 Ga0182007_10043861 3300015262 Bacteria 1485
147 Ga0163161_10096579 3300017792 Bacteria 2193
148 Ga0163161_10132120 3300017792 Bacteria 1884
149 Ga0209258_100156 3300025242 Bacteria 156926
150 Ga0209646_1000009 3300025246 Bacteria 652154
151 Ga0209026_1000133 3300025250 Bacteria 117872
152 Ga0209148_1000427 3300025254 Bacteria 46722
153 Ga0209675_1000059 3300025291 Bacteria 184781
154 Ga0209050_1000526 3300025298 Bacteria 63612
155 Ga0207426_1000104 3300025302 Bacteria 249464
156 Ga0207656_10155283 3300025321 Bacteria 1086
157 Ga0207655_1000018 3300025728 Bacteria 537129
158 Ga0207680_10041823 3300025903 Unclassified 2677
159 Ga0207647_10004322 3300025904 Bacteria 10532
160 Ga0207654_10003906 3300025911 Bacteria 7507
161 Ga0207695_10000027 3300025913 Bacteria 612456
162 Ga0207695_10000076 3300025913 Bacteria 307969
163 Ga0207695_10000090 3300025913 Bacteria 272143
164 Ga0207695_10000687 3300025913 Bacteria 66305
165 Ga0207695_10066895 3300025913 Unclassified 3688
166 Ga0207671_10002245 3300025914 Bacteria 20915
167 Ga0207671_10011030 3300025914 Bacteria 7397
168 Ga0207671_10091124 3300025914 Bacteria 2297
169 Ga0207671_10194543 3300025914 Bacteria 1582
170 Ga0207671_10262566 3300025914 Unclassified 1359
171 Ga0207671_10337662 3300025914 Bacteria 1193
172 Ga0207657_10198317 3300025919 Bacteria 1616
173 Ga0207649_10074767 3300025920 Unclassified 2175
174 Ga0207694_10007575 3300025924 Bacteria 8229
175 Ga0207694_10367104 3300025924 Unclassified 1193
176 Ga0207650_10003309 3300025925 Bacteria 11091
177 Ga0207659_10140425 3300025926 Unclassified 1875
178 Ga0207690_10129896 3300025932 Unclassified 1842
179 Ga0207690_10137465 3300025932 Bacteria 1796
180 Ga0207709_10000691 3300025935 Bacteria 27175
181 Ga0207709_10201231 3300025935 Bacteria 1422
182 Ga0207691_10137235 3300025940 Bacteria 2156
183 Ga0207691_10425439 3300025940 Bacteria 1131
184 Ga0207661_10000698 3300025944 Bacteria 21784
185 Ga0207661_10038967 3300025944 Bacteria 3728
186 Ga0207679_10014970 3300025945 Bacteria 5112
187 Ga0207667_10000431 3300025949 Bacteria 56406
188 Ga0207667_10019665 3300025949 Bacteria 7528
189 Ga0207651_10237455 3300025960 Bacteria 1484
190 Ga0207668_10029624 3300025972 Bacteria 3589
191 Ga0207640_10011001 3300025981 Bacteria 5108
192 Ga0207677_10115506 3300026023 Unclassified 2008
193 Ga0207703_10548312 3300026035 Bacteria 1090
194 Ga0207639_10027849 3300026041 Bacteria 4120
195 Ga0207639_10755309 3300026041 Unclassified 904
196 Ga0207702_10072272 3300026078 Unclassified 2973
197 Ga0207702_10253288 3300026078 Bacteria 1654
198 Ga0207702_10372854 3300026078 Unclassified 1371
199 Ga0207674_10000549 3300026116 Bacteria 49221
200 Ga0207698_10034133 3300026142 Bacteria 3706
201 Ga0207698_10091607 3300026142 Bacteria 2489
202 Ga0207698_10355142 3300026142 Unclassified 1386
203 Ga0209995_1001482 3300027471 Unclassified 3622
204 Ga0209974_10121504 3300027876 Bacteria 926
205 Ga0268266_10000010 3300028379 Bacteria 1030233
206 Ga0268264_10000252 3300028381 Bacteria 99533
207 Ga0307515_10000003 3300028794 Bacteria 891317
208 Ga0307515_10223423 3300028794 Bacteria 1695
209 Ga0307513_10016334 3300031456 Bacteria 8961
210 Ga0307509_10043822 3300031507 Bacteria 4838
211 Ga0307509_10402485 3300031507 Unclassified 1075
212 Ga0307508_10001016 3300031616 Bacteria 32624
213 Ga0307405_10120803 3300031731 Bacteria 1793
214 Ga0307406_10120404 3300031901 Bacteria 1824
215 Ga0307412_10000275 3300031911 Bacteria 32752
216 Ga0307412_10000733 3300031911 Bacteria 18949
217 Ga0307412_10010855 3300031911 Bacteria 5258
218 Ga0307416_100000055 3300032002 Bacteria 107523
219 Ga0307414_10000047 3300032004 Bacteria 132863
220 Ga0307414_10019514 3300032004 Bacteria 4203
221 Ga0307414_10102006 3300032004 Bacteria 2162
222 Ga0307414_10344986 3300032004 Bacteria 1276
223 Ga0307414_10357589 3300032004 Bacteria 1255
224 Ga0307411_10493280 3300032005 Bacteria 1034
225 Ga0307510_10001662 3300033180 Bacteria 24661
226 Ga0395905_0002024 3300037471 Bacteria 23176
227 Ga0395905_0173509 3300037471 Bacteria 2025
228 Ga0439466_0075857 3300041411 Bacteria 1065
229 Ga0439465_0000041 3300041413 Bacteria 26200
230 Ga0439465_0012581 3300041413 Unclassified 2646
231 Ga0439465_0021151 3300041413 Unclassified 2040
232 Ga0439445_0014970 3300042004 Bacteria 1895
233 Ga0466982_0030704 3300044672 Bacteria 3180
234 Ga0466961_0044864 3300044693 Unclassified 2829
235 Ga0466964_0017712 3300044706 Unclassified 2728
236 Ga0466970_0092993 3300044765 Unclassified 1638
237 Ga0466959_0063916 3300045049 Unclassified 2672
238 Ga0495627_000335 3300046453 Bacteria 44545
239 Ga0495638_0250175 3300046460 Bacteria 977
240 Ga0495596_0002798 3300046500 Bacteria 9139
241 Ga0495610_0000006 3300046512 Bacteria 856822
242 Ga0495632_0005544 3300046519 Bacteria 8320
243 Ga0495643_0039768 3300046522 Bacteria 2571
244 Ga0495648_0001413 3300046524 Bacteria 23465
245 Ga0495663_0020538 3300046525 Bacteria 1896
246 Ga0495654_0000044 3300046530 Bacteria 158495
247 Ga0495633_0000569 3300046558 Bacteria 35878
248 Ga0495633_0000761 3300046558 Bacteria 28994
249 Ga0495668_0010720 3300046616 Bacteria 5536
250 Ga0495611_0000015 3300046648 Bacteria 129696
251 Ga0495625_0000987 3300046660 Bacteria 37719
252 Ga0495660_0178481 3300046810 Bacteria 1029
253 Ga0495672_0146960 3300047320 Bacteria 1226
254 Ga0495683_0214968 3300047323 Bacteria 860
255 Ga0495686_0000086 3300047472 Bacteria 197490
256 Ga0495686_0001844 3300047472 Bacteria 21271
257 Ga0495686_0005340 3300047472 Bacteria 10174
258 Ga0496102_0227410 3300048905 Bacteria 1759
259 Ga0496103_0029307 3300048906 Bacteria 3345
260 Ga0496116_0000144 3300048919 Bacteria 148276
261 Ga0496117_0000076 3300048920 Bacteria 232366
262 Ga0496118_0000496 3300048921 Bacteria 65131
263 Ga0496119_0000021 3300048922 Bacteria 277056
264 Ga0496121_0000007 3300048924 Bacteria 942516
265 Ga0496122_0000871 3300048925 Bacteria 56764
266 Ga0496122_0001609 3300048925 Bacteria 35313
267 Ga0496122_0002808 3300048925 Bacteria 23881
268 Ga0496122_0005681 3300048925 Bacteria 14725
269 Ga0496123_0002387 3300048926 Bacteria 23524
270 Ga0496123_0004486 3300048926 Bacteria 14639
271 Ga0496123_0010300 3300048926 Bacteria 8292
272 Ga0496125_0002012 3300048928 Bacteria 27563
273 Ga0496125_0012946 3300048928 Bacteria 8236
274 Ga0496126_0001385 3300048929 Bacteria 38358
275 Ga0501043_0274237 3300049579 Bacteria 1294
276 Ga0501202_012965 3300049652 Bacteria 1581
277 Ga0501217_001652 3300049661 Bacteria 4242
278 Ga0501247_013520 3300049677 Bacteria 1004
279 Ga0501250_008163 3300049680 Bacteria 1148
280 Ga0501251_002013 3300049681 Bacteria 1940
281 Ga0501257_006445 3300049686 Unclassified 2604
282 Ga0501241_002161 3300049758 Bacteria 3841
283 Ga0501241_051316 3300049758 Unclassified 815
284 Ga0501269_003815 3300049766 Bacteria 1814
285 Ga0501271_005922 3300049768 Bacteria 1203
286 Ga0500578_0318789 3300053086 Unclassified 917
287 Ga0500583_0001601 3300053092 Bacteria 6564
288 Ga0500583_0011360 3300053092 Bacteria 3351
289 Ga0500553_073008 3300053101 Bacteria 1570
290 Ga0500562_005256 3300053108 Bacteria 3254
291 Ga0500655_001299 3300053133 Unclassified 4740
292 Ga0500559_0017815 3300053136 Bacteria 3004
293 Ga0500588_0005610 3300053146 Unclassified 2796
294 Ga0500604_0006385 3300053151 Bacteria 3117
295 Ga0500622_0000031 3300053156 Bacteria 207165
296 Ga0500622_0000039 3300053156 Bacteria 170859
297 Ga0500622_0009661 3300053156 Bacteria 5331
298 Ga0500636_0089884 3300053177 Bacteria 1760
299 Ga0500637_0176247 3300053178 Unclassified 1227
300 Ga0500637_0359531 3300053178 Unclassified 771
301 2511234841 2511231000 Bacteria 4488346
302 2585142245 2582581278 Bacteria 5296881
303 2585156415 2582581281 Bacteria 4487904
304 2585160648 2582581282 Bacteria 4495830
305 2585426598 2582581873 Bacteria 3032664
306 2587678895 2585428045 Bacteria 5203023
307 2587747715 2585428060 Bacteria 5304711
308 2587751608 2585428061 Bacteria 3939663
309 2587941423 2585428115 Bacteria 4420269
310 2588210699 2585428182 Bacteria 5007281
311 2588214064 2585428183 Bacteria 5166119
312 2588221298 2585428184 Bacteria 4978681
313 2588221734 2585428185 Bacteria 4969476
314 2588232577 2585428187 Bacteria 4629388
315 2588443578 2588253712 Bacteria 5403181
316 2590601975 2588254255 Bacteria 5014294
317 2590613824 2588254257 Bacteria 5436094
318 2729200492 2728369107 Bacteria 5082720
319 2740059471 2739367874 Bacteria 4872888
320 2753673527 2751185877 Bacteria 4921427
321 2765574651 2765235839 Bacteria 5314748
322 2772606472 2772190705 Bacteria 4666226
323 2775671573 2775506739 Bacteria 3855222
324 2816874856 2816332188 Bacteria 5133218
325 2819678627 2818991460 Bacteria 7595395
326 2842085391 2842083920 Bacteria 4857652
327 2871722385 2871720351 Bacteria 4862476
328 2884793670 2884791551 Bacteria 8511252
329 2889294795 2889290771 Bacteria 5530962
330 2906001417 2905999023 Bacteria 4591259
331 2919099600 2919097161 Bacteria 3860339
332 2919402541 2919399522 Bacteria 5164947
333 2929182209 2929177148 Bacteria 7883697
334 2929924181 2929921140 Bacteria 8649150
335 2945925675 2945924605 Bacteria 4296724
336 2945978127 2945977869 Bacteria 7777518
337 2946016012 2946013367 Bacteria 7766675
338 2946023082 2946019816 Bacteria 4621265
339 2977244543 2977243572 Bacteria 4374394
340 2984573593 2984572630 Bacteria 4186940
341 2984607036 2984606641 Bacteria 4186971
342 2993375989 2993372514 Bacteria 4214139
343 2993482837 2993480792 Bacteria 4022225
344 8003152567 8003151029 Bacteria 8187759
345 Ga0496122_0005383
346 SwRhRL2b_contig_1389943
347 SwRhRL2b_contig_753927
348 JGI24736J21556_1011898
349 JGI24741J21665_1000699
350 rootH1_10000428
351 rootH2_10006124
352 rootH2_10008379
353 rootH2_10010920
354 rootH2_10020079
355 rootH2_10104731
356 rootH2_10139933
357 rootL2_10000931
358 rootL2_10029102
359 rootL2_10044184
360 rootL2_10050740
361 rootL2_10065433
362 rootL2_10253090
363 rootL2_10293138
364 rootH1_10000888
365 rootH1_10025715
366 rootH1_10025716
367 rootH1_10056533
368 rootH1_10075457
369 rootH1_10095951
370 rootH1_10099913
371 rootH1_10112543
372 rootH1_10265201
373 JGI25160J50197_1012042
374 Ga0055535_1004257
375 Ga0055534_1007368
376 Ga0055530_10007572
377 Ga0065165_1001654
378 Ga0065165_1004229
379 Ga0065714_10075715
380 Ga0065704_10075150
381 Ga0065704_10106346
382 Ga0065712_10135311
383 Ga0070683_100001309
384 Ga0070683_100004590
385 Ga0070683_100049052
386 Ga0070683_101047264
387 Ga0070670_100016897
388 Ga0070670_100594511
389 Ga0070670_100601169
390 Ga0070666_10042901
391 Ga0070666_10428558
392 Ga0070682_100000187
393 Ga0068868_100065765
394 Ga0070660_100041518
395 Ga0070691_10008899
396 Ga0070661_100065188
397 Ga0070668_100040170
398 Ga0070668_100362504
399 Ga0070671_100140474
400 Ga0070673_100378257
401 Ga0070673_100685903
402 Ga0070659_100035764
403 Ga0070659_100379492
404 Ga0070684_100003969
405 Ga0070684_100226852
406 Ga0070684_100282632
407 Ga0068853_100065775
408 Ga0068853_100499499
409 Ga0070672_100056265
410 Ga0068855_100006583
411 Ga0070664_100017474
412 Ga0070664_100052182
413 Ga0068857_100745738
414 Ga0068854_100041370
415 Ga0068854_100117017
416 Ga0068856_100067587
417 Ga0068856_100296079
418 Ga0068852_100004016
419 Ga0068852_100083601
420 Ga0068852_100120868
421 Ga0068852_100128173
422 Ga0068852_100189729
423 Ga0068852_100388674
424 Ga0068852_100395997
425 Ga0068852_100494509
426 Ga0068864_100223036
427 Ga0068864_100374172
428 Ga0068851_10110134
429 Ga0068851_10288279
430 Ga0081540_1002851
431 Ga0105244_10000001
432 Ga0105240_10000160
433 Ga0105240_10000846
434 Ga0105240_10002203
435 Ga0105240_10112820
436 Ga0105243_10000447
437 Ga0105243_10078954
438 Ga0105241_10000604
439 Ga0105237_10005255
440 Ga0105237_10007307
441 Ga0105237_10009649
442 Ga0105237_10032304
443 Ga0105237_10057406
444 Ga0105237_10117476
445 Ga0105238_10004074
446 Ga0105238_10141812
447 Ga0105238_10184100
448 Ga0105239_10002380
449 Ga0105239_10005620
450 Ga0105239_10008598
451 Ga0105239_10064280
452 Ga0105239_10222237
453 Ga0105239_10229544
454 Ga0157373_10048976
455 Ga0157373_10144645
456 Ga0157371_10007547
457 Ga0157371_10020574
458 Ga0157371_10339868
459 Ga0157370_10002065
460 Ga0157370_10006322
461 Ga0157370_10057767
462 Ga0157369_10014957
463 Ga0157369_10032724
464 Ga0157369_10678734
465 Ga0157374_10000004
466 Ga0157374_10048159
467 Ga0157374_10748305
468 Ga0157378_10072205
469 Ga0163162_10536478
470 Ga0157372_10001393
471 Ga0157372_10001615
472 Ga0157372_10048220
473 Ga0157372_10052642
474 Ga0157372_10119872
475 Ga0157372_10128965
476 Ga0157372_10135353
477 Ga0157372_10146580
478 Ga0157372_10192615
479 Ga0157372_10235901
480 Ga0157372_10595751
481 Ga0157372_10674151
482 Ga0157375_10001396
483 Ga0157375_10413719
484 Ga0163163_10006249
485 Ga0157377_10055665
486 Ga0157376_10094103
487 Ga0182006_1000003
488 Ga0182007_10043861
489 Ga0163161_10096579
490 Ga0163161_10132120
491 Ga0209258_100156
492 Ga0209646_1000009
493 Ga0209026_1000133
494 Ga0209148_1000427
495 Ga0209675_1000059
496 Ga0209050_1000526
497 Ga0207426_1000104
498 Ga0207656_10155283
499 Ga0207655_1000018
500 Ga0207680_10041823
501 Ga0207647_10004322
502 Ga0207654_10003906
503 Ga0207695_10000027
504 Ga0207695_10000076
505 Ga0207695_10000090
506 Ga0207695_10000687
507 Ga0207695_10066895
508 Ga0207671_10002245
509 Ga0207671_10011030
510 Ga0207671_10091124
511 Ga0207671_10194543
512 Ga0207671_10262566
513 Ga0207671_10337662
514 Ga0207657_10198317
515 Ga0207649_10074767
516 Ga0207694_10007575
517 Ga0207694_10367104
518 Ga0207650_10003309
519 Ga0207659_10140425
520 Ga0207690_10129896
521 Ga0207690_10137465
522 Ga0207709_10000691
523 Ga0207709_10201231
524 Ga0207691_10137235
525 Ga0207691_10425439
526 Ga0207661_10000698
527 Ga0207661_10038967
528 Ga0207679_10014970
529 Ga0207667_10000431
530 Ga0207667_10019665
531 Ga0207651_10237455
532 Ga0207668_10029624
533 Ga0207640_10011001
534 Ga0207677_10115506
535 Ga0207703_10548312
536 Ga0207639_10027849
537 Ga0207639_10755309
538 Ga0207702_10072272
539 Ga0207702_10253288
540 Ga0207702_10372854
541 Ga0207674_10000549
542 Ga0207698_10034133
543 Ga0207698_10091607
544 Ga0207698_10355142
545 Ga0209995_1001482
546 Ga0209974_10121504
547 Ga0268266_10000010
548 Ga0268264_10000252
549 Ga0307515_10000003
550 Ga0307515_10223423
551 Ga0307513_10016334
552 Ga0307509_10043822
553 Ga0307509_10402485
554 Ga0307508_10001016
555 Ga0307405_10120803
556 Ga0307406_10120404
557 Ga0307412_10000275
558 Ga0307412_10000733
559 Ga0307412_10010855
560 Ga0307416_100000055
561 Ga0307414_10000047
562 Ga0307414_10019514
563 Ga0307414_10102006
564 Ga0307414_10344986
565 Ga0307414_10357589
566 Ga0307411_10493280
567 Ga0307510_10001662
568 Ga0395905_0002024
569 Ga0395905_0173509
570 Ga0439466_0075857
571 Ga0439465_0000041
572 Ga0439465_0012581
573 Ga0439465_0021151
574 Ga0439445_0014970
575 Ga0466982_0030704
576 Ga0466961_0044864
577 Ga0466964_0017712
578 Ga0466970_0092993
579 Ga0466959_0063916
580 Ga0495627_000335
581 Ga0495638_0250175
582 Ga0495596_0002798
583 Ga0495610_0000006
584 Ga0495632_0005544
585 Ga0495643_0039768
586 Ga0495648_0001413
587 Ga0495663_0020538
588 Ga0495654_0000044
589 Ga0495633_0000569
590 Ga0495633_0000761
591 Ga0495668_0010720
592 Ga0495611_0000015
593 Ga0495625_0000987
594 Ga0495660_0178481
595 Ga0495672_0146960
596 Ga0495683_0214968
597 Ga0495686_0000086
598 Ga0495686_0001844
599 Ga0495686_0005340
600 Ga0496102_0227410
601 Ga0496103_0029307
602 Ga0496116_0000144
603 Ga0496117_0000076
604 Ga0496118_0000496
605 Ga0496119_0000021
606 Ga0496121_0000007
607 Ga0496122_0000871
608 Ga0496122_0001609
609 Ga0496122_0002808
610 Ga0496122_0005681
611 Ga0496123_0002387
612 Ga0496123_0004486
613 Ga0496123_0010300
614 Ga0496125_0002012
615 Ga0496125_0012946
616 Ga0496126_0001385
617 Ga0501043_0274237
618 Ga0501202_012965
619 Ga0501217_001652
620 Ga0501247_013520
621 Ga0501250_008163
622 Ga0501251_002013
623 Ga0501257_006445
624 Ga0501241_002161
625 Ga0501241_051316
626 Ga0501269_003815
627 Ga0501271_005922
628 Ga0500578_0318789
629 Ga0500583_0001601
630 Ga0500583_0011360
631 Ga0500553_073008
632 Ga0500562_005256
633 Ga0500655_001299
634 Ga0500559_0017815
635 Ga0500588_0005610
636 Ga0500604_0006385
637 Ga0500622_0000031
638 Ga0500622_0000039
639 Ga0500622_0009661
640 Ga0500636_0089884
641 Ga0500637_0176247
642 Ga0500637_0359531
643 2511234841
644 2585142245
645 2585156415
646 2585160648
647 2585426598
648 2587678895
649 2587747715
650 2587751608
651 2587941423
652 2588210699
653 2588214064
654 2588221298
655 2588221734
656 2588232577
657 2588443578
658 2590601975
659 2590613824
660 2729200492
661 2740059471
662 2753673527
663 2765574651
664 2772606472
665 2775671573
666 2816874856
667 2819678627
668 2842085391
669 2871722385
670 2884793670
671 2889294795
672 2906001417
673 2919099600
674 2919402541
675 2929182209
676 2929924181
677 2945925675
678 2945978127
679 2946016012
680 2946023082
681 2977244543
682 2984573593
683 2984607036
684 2993375989
685 2993482837
686 8003152567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

27

218

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

33

227

0.86

PF08659

KR

KR domain

27

203

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u4s-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.8971 6 242
5u4s-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp. 0.8935 6 242
4nbu-assembly1.cif.gz_D crystal structure of fabg from bacillus sp 0.8918 6 219
5u9p-assembly1.cif.gz_C crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with nadp and tartrate 0.8912 7 226
1fdu-assembly1.cif.gz_B human 17-beta-hydroxysteroid-dehydrogenase type 1 mutant h221l complexed with estradiol and nadp+ 0.891 5 230
ID Description Score Start End Superfamily
af_Q3B7V0_30_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9167 5 241 3.40.50.720
af_O15229_1_369_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9126 3 36 3.50.50.60
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9061 7 242 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9046 9 242 3.40.50.720
af_Q5M875_26_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9035 6 241 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6H2BF11-F1-model_v4 deleted 0.9966 7 243
AF-A0A3D3K2H3-F1-model_v4 3-oxoacyl-ACP reductase 0.9953 69 243 GO:0016491
AF-A0A3D3K2H3-F1-model_v4 3-oxoacyl-ACP reductase 0.9896 69 243 GO:0016491
AF-A0A6H2BF11-F1-model_v4 deleted 0.9842 7 243
AF-X0TTU9-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9607 8 203 GO:0016491

Map