F415342

General Info

Members Datasets Scaffolds Average Seq Length
342 235 684 280

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0087055|Ga0501034_0087055_2081_3037
Length 318
Sequence VLFARNVLFLFGLNISRIEKEYFKFEIKKRKFFMSLNPNSEQWTETISSKSSLFSLNLNEVWRYRDLVYMLVRRDFVTSFKQTVLGPVWFFINPILTTIMFVIIFGRVAGLSTDGAPQIPFYLAGVTMWNYFSSCLNGTSSVFRGNASIFGKVYFPRLVMPLSIVISNLMRFGVQFVLFAIVILYYLISNNSVHPNLWILITPFLIVLMAAFAMGTGMIFSSLTTKYKDFTMLLSFGVSLYMYATPVVIPISQFPERFRWILDINPLTGIFECFKYAYLGVGDFSVNMLLYSTIVIFVILAIGTIIFNKVEKSFMDTV

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
176 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
188 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
196 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
197 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
198 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
199 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
200 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
201 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
202 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
203 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
204 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
205 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
206 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
207 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
208 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
209 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
210 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
211 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
212 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
213 2738541284 Pedobacter sp. YR016 Isolate Unclassified
214 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
215 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
216 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
217 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
218 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
219 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
220 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
221 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
222 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
223 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
224 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
225 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
226 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
227 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
228 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
229 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
230 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
231 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
232 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
233 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
234 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
235 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.13
Metatranscriptomes 0.58
Isolates 12.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 6.14
Nodule 0.29
Rhizoplane 1.75
Rhizosphere 79.24
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0087055 3300049571 Bacteria 3124
2 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
3 SwRhRL2b_contig_503364 2162886007 Bacteria 1086
4 JGI24736J21556_1002406 3300001904 Bacteria 3302
5 JGI24741J21665_1000053 3300001915 Bacteria 28323
6 JGI24740J21852_10006796 3300001979 Bacteria 4699
7 JGI24737J22298_10001385 3300001990 Bacteria 8609
8 JGI24735J21928_10000905 3300002067 Bacteria 10581
9 JGI24744J21845_10006775 3300002077 Bacteria 2371
10 JGI25162J39368_1000123 3300002737 Bacteria 85062
11 JGI25165J46597_1009353 3300003214 Bacteria 1480
12 rootH2_10291355 3300003320 Bacteria 1721
13 rootH2_10314100 3300003320 Bacteria 1242
14 rootL2_10035342 3300003322 Bacteria 31163
15 rootL2_10108558 3300003322 Bacteria 3843
16 rootL2_10209827 3300003322 Bacteria 1245
17 Ga0006562J51391_1034006 3300003578 Bacteria 2357
18 Ga0055534_1010414 3300003784 Bacteria 1949
19 Ga0058862_11672467 3300004803 Bacteria 1450
20 Ga0065714_10002476 3300005288 Bacteria 16393
21 Ga0065704_10070140 3300005289 Bacteria 482257
22 Ga0065704_10070627 3300005289 Bacteria 18948
23 Ga0065704_10075459 3300005289 Bacteria 5581
24 Ga0065704_10094467 3300005289 Bacteria 2541
25 Ga0065704_10155307 3300005289 Bacteria 1396
26 Ga0070658_10000301 3300005327 Bacteria 42860
27 Ga0070658_10153306 3300005327 Bacteria 1930
28 Ga0070683_100543008 3300005329 Bacteria 1111
29 Ga0070670_100020536 3300005331 Bacteria 5679
30 Ga0070670_100032995 3300005331 Unclassified 4462
31 Ga0070680_100002242 3300005336 Bacteria 14262
32 Ga0070680_100007099 3300005336 Bacteria 8539
33 Ga0070682_100031492 3300005337 Bacteria 3208
34 Ga0068868_100004333 3300005338 Bacteria 9947
35 Ga0070660_100067910 3300005339 Bacteria 2778
36 Ga0070660_100124876 3300005339 Bacteria 2056
37 Ga0070660_100160359 3300005339 Bacteria 1812
38 Ga0070668_100005392 3300005347 Bacteria 9493
39 Ga0070668_100033889 3300005347 Bacteria 3891
40 Ga0070675_100025422 3300005354 Bacteria 4747
41 Ga0070671_100015203 3300005355 Bacteria 6217
42 Ga0070673_100159703 3300005364 Unclassified 1916
43 Ga0070659_100002177 3300005366 Bacteria 13962
44 Ga0070667_100065126 3300005367 Bacteria 3094
45 Ga0070713_100060272 3300005436 Bacteria 3172
46 Ga0070662_100000273 3300005457 Bacteria 30505
47 Ga0070681_10029020 3300005458 Bacteria 5555
48 Ga0070698_100463356 3300005471 Bacteria 1203
49 Ga0070679_100005487 3300005530 Bacteria 11757
50 Ga0068853_100064233 3300005539 Bacteria 3182
51 Ga0068855_100000098 3300005563 Bacteria 105977
52 Ga0068855_100000246 3300005563 Bacteria 68191
53 Ga0068855_100004293 3300005563 Bacteria 17420
54 Ga0068855_100017752 3300005563 Bacteria 8554
55 Ga0068855_100304291 3300005563 Bacteria 1765
56 Ga0068857_100057046 3300005577 Bacteria 3466
57 Ga0068856_100000006 3300005614 Bacteria 223827
58 Ga0068856_100004154 3300005614 Bacteria 14469
59 Ga0068856_100049263 3300005614 Bacteria 4152
60 Ga0068856_100147328 3300005614 Bacteria 2362
61 Ga0068856_100569148 3300005614 Unclassified 1154
62 Ga0068866_10049017 3300005718 Bacteria 2138
63 Ga0068861_100555961 3300005719 Bacteria 1046
64 Ga0068851_10030675 3300005834 Bacteria 2667
65 Ga0068863_100087963 3300005841 Bacteria 2944
66 Ga0097621_100000503 3300006237 Bacteria 27338
67 Ga0075370_10145449 3300006353 Bacteria 1387
68 Ga0068871_100009454 3300006358 Bacteria 7065
69 Ga0068871_100379568 3300006358 Bacteria 1255
70 Ga0075431_100003977 3300006847 Bacteria 14407
71 Ga0075429_100107665 3300006880 Bacteria 2436
72 Ga0097620_100012023 3300006931 Bacteria 8696
73 Ga0105244_10000005 3300009036 Bacteria 481412
74 Ga0105250_10019213 3300009092 Bacteria 2762
75 Ga0105240_10000047 3300009093 Bacteria 239067
76 Ga0111539_10005994 3300009094 Bacteria 15706
77 Ga0114129_10009167 3300009147 Bacteria 14108
78 Ga0105243_10000216 3300009148 Bacteria 67300
79 Ga0105241_10342859 3300009174 Bacteria 1295
80 Ga0105248_10076681 3300009177 Bacteria 3757
81 Ga0105237_10001137 3300009545 Bacteria 35733
82 Ga0105237_10001178 3300009545 Bacteria 34927
83 Ga0105237_10005890 3300009545 Bacteria 13744
84 Ga0105249_10002034 3300009553 Bacteria 17542
85 Ga0105239_10000240 3300010375 Bacteria 81097
86 Ga0105239_10000659 3300010375 Bacteria 49123
87 Ga0105239_10000759 3300010375 Bacteria 45638
88 Ga0105239_10001566 3300010375 Bacteria 30205
89 Ga0157373_10000032 3300013100 Bacteria 126310
90 Ga0157373_10008545 3300013100 Bacteria 7605
91 Ga0157373_10107430 3300013100 Unclassified 1962
92 Ga0157371_10000069 3300013102 Bacteria 165391
93 Ga0157371_10000257 3300013102 Bacteria 73583
94 Ga0157371_10000521 3300013102 Bacteria 45906
95 Ga0157371_10018704 3300013102 Bacteria 5119
96 Ga0157371_10040730 3300013102 Bacteria 3316
97 Ga0157371_10043978 3300013102 Bacteria 3181
98 Ga0157371_10102261 3300013102 Bacteria 2033
99 Ga0157370_10001978 3300013104 Bacteria 25174
100 Ga0157370_10005939 3300013104 Bacteria 13603
101 Ga0157370_10023638 3300013104 Bacteria 6099
102 Ga0157370_10027323 3300013104 Bacteria 5627
103 Ga0157370_10038948 3300013104 Bacteria 4597
104 Ga0157370_10094264 3300013104 Bacteria 2809
105 Ga0157370_10442840 3300013104 Bacteria 1195
106 Ga0157370_10658071 3300013104 Unclassified 957
107 Ga0157369_10000939 3300013105 Bacteria 37034
108 Ga0157369_10384626 3300013105 Bacteria 1456
109 Ga0157374_10009787 3300013296 Bacteria 8233
110 Ga0157374_10015542 3300013296 Bacteria 6677
111 Ga0157374_10283320 3300013296 Unclassified 1636
112 Ga0157378_10000370 3300013297 Bacteria 44420
113 Ga0157378_10282359 3300013297 Bacteria 1601
114 Ga0163162_10003569 3300013306 Bacteria 14879
115 Ga0157372_10000327 3300013307 Bacteria 52004
116 Ga0157372_10006205 3300013307 Bacteria 12701
117 Ga0157372_10006889 3300013307 Bacteria 12091
118 Ga0157372_10027698 3300013307 Bacteria 6175
119 Ga0157372_10184248 3300013307 Bacteria 2418
120 Ga0157372_10220351 3300013307 Bacteria 2199
121 Ga0157372_10627576 3300013307 Unclassified 1252
122 Ga0157372_10854930 3300013307 Bacteria 1056
123 Ga0157372_10872556 3300013307 Unclassified 1044
124 Ga0157375_10000141 3300013308 Bacteria 72136
125 Ga0157375_10005044 3300013308 Bacteria 11468
126 Ga0157375_10196028 3300013308 Bacteria 2175
127 Ga0163163_10000215 3300014325 Bacteria 60028
128 Ga0163163_10170548 3300014325 Unclassified 2222
129 Ga0182008_10000003 3300014497 Bacteria 456880
130 Ga0182008_10000006 3300014497 Bacteria 378521
131 Ga0157377_10018527 3300014745 Bacteria 3619
132 Ga0157379_10094971 3300014968 Bacteria 2675
133 Ga0157376_10000216 3300014969 Bacteria 39942
134 Ga0163161_10000863 3300017792 Bacteria 23632
135 Ga0163161_10017377 3300017792 Bacteria 5033
136 Ga0163161_10033944 3300017792 Bacteria 3648
137 Ga0213872_10010670 3300021361 Bacteria 4366
138 Ga0213876_10011649 3300021384 Bacteria 4694
139 Ga0209437_100251 3300025233 Bacteria 85135
140 Ga0209026_1008604 3300025250 Bacteria 2110
141 Ga0209233_1000478 3300025261 Bacteria 24667
142 Ga0209675_1000066 3300025291 Bacteria 171883
143 Ga0209050_1000879 3300025298 Bacteria 40293
144 Ga0207696_1022969 3300025711 Bacteria 1973
145 Ga0207655_1000016 3300025728 Bacteria 551476
146 Ga0207647_10000041 3300025904 Bacteria 92367
147 Ga0207647_10026626 3300025904 Bacteria 3781
148 Ga0207647_10157567 3300025904 Unclassified 1325
149 Ga0207705_10000336 3300025909 Bacteria 42484
150 Ga0207705_10120920 3300025909 Bacteria 1943
151 Ga0207707_10328831 3300025912 Unclassified 1319
152 Ga0207695_10000010 3300025913 Bacteria 981919
153 Ga0207695_10100705 3300025913 Bacteria 2884
154 Ga0207695_10191219 3300025913 Bacteria 1964
155 Ga0207671_10001141 3300025914 Bacteria 31777
156 Ga0207671_10002987 3300025914 Bacteria 17333
157 Ga0207693_10394890 3300025915 Bacteria 1081
158 Ga0207660_10002900 3300025917 Bacteria 11206
159 Ga0207657_10078242 3300025919 Bacteria 2785
160 Ga0207657_10109050 3300025919 Unclassified 2288
161 Ga0207657_10156634 3300025919 Bacteria 1852
162 Ga0207652_10004076 3300025921 Bacteria 11918
163 Ga0207650_10030832 3300025925 Bacteria 3867
164 Ga0207659_10034471 3300025926 Bacteria 3491
165 Ga0207700_10206768 3300025928 Bacteria 1657
166 Ga0207644_10008407 3300025931 Bacteria 6755
167 Ga0207690_10003394 3300025932 Bacteria 9517
168 Ga0207706_10000380 3300025933 Bacteria 48389
169 Ga0207709_10000084 3300025935 Bacteria 161002
170 Ga0207667_10000014 3300025949 Bacteria 421261
171 Ga0207667_10000823 3300025949 Bacteria 40119
172 Ga0207667_10008112 3300025949 Bacteria 12514
173 Ga0207667_10034884 3300025949 Bacteria 5400
174 Ga0207667_10256749 3300025949 Bacteria 1788
175 Ga0207651_10697176 3300025960 Bacteria 894
176 Ga0207712_10006004 3300025961 Bacteria 7663
177 Ga0207668_10082730 3300025972 Bacteria 2333
178 Ga0207668_10083586 3300025972 Bacteria 2323
179 Ga0207640_10022577 3300025981 Bacteria 3769
180 Ga0207658_10032346 3300025986 Bacteria 3723
181 Ga0207677_10013263 3300026023 Bacteria 4770
182 Ga0207702_10000023 3300026078 Bacteria 189234
183 Ga0207702_10014889 3300026078 Bacteria 6451
184 Ga0207702_10077521 3300026078 Bacteria 2875
185 Ga0207641_10073525 3300026088 Bacteria 2946
186 Ga0207674_10018153 3300026116 Bacteria 7654
187 Ga0207675_100225203 3300026118 Unclassified 1808
188 Ga0307517_10026155 3300028786 Bacteria 7088
189 Ga0265338_10015498 3300028800 Bacteria 8368
190 Ga0265339_10174992 3300031249 Bacteria 1072
191 Ga0307516_10042125 3300031730 Bacteria 4532
192 Ga0307412_10000027 3300031911 Bacteria 214663
193 Ga0307412_10008629 3300031911 Bacteria 5827
194 Ga0307416_100000006 3300032002 Bacteria 466074
195 Ga0307510_10001133 3300033180 Bacteria 28580
196 Ga0373953_0053475 3300035117 Bacteria 1637
197 Ga0373954_0038265 3300035118 Bacteria 2231
198 Ga0395899_0000049 3300037312 Bacteria 225231
199 Ga0395899_0058448 3300037312 Bacteria 2844
200 Ga0395900_0000541 3300037418 Bacteria 52877
201 Ga0395900_0087180 3300037418 Bacteria 3208
202 Ga0395900_0138781 3300037418 Unclassified 2490
203 Ga0395900_0351708 3300037418 Bacteria 1447
204 Ga0395901_0143245 3300038443 Bacteria 2512
205 Ga0400490_48759 3300038726 Bacteria 15842
206 Ga0436365_0599632 3300039437 Bacteria 7051
207 Ga0436365_1081099 3300039437 Bacteria 41037
208 Ga0436360_1195894 3300039438 Bacteria 1127
209 Ga0436361_0033376 3300039447 Bacteria 9178
210 Ga0436361_0295894 3300039447 Bacteria 17469
211 Ga0436361_0318011 3300039447 Bacteria 3391
212 Ga0436361_1138820 3300039447 Bacteria 1143
213 Ga0439465_0003550 3300041413 Bacteria 5082
214 Ga0439445_0001701 3300042004 Bacteria 4831
215 Ga0453683_0295853 3300044673 Bacteria 1035
216 Ga0453684_0001660 3300044712 Bacteria 60336
217 Ga0453684_0001748 3300044712 Bacteria 58096
218 Ga0453684_0075376 3300044712 Bacteria 4240
219 Ga0466968_0036692 3300044735 Bacteria 2055
220 Ga0451576_0009348 3300045051 Bacteria 11372
221 Ga0495627_000022 3300046453 Bacteria 254672
222 Ga0495627_007455 3300046453 Bacteria 4189
223 Ga0495592_0139241 3300046454 Bacteria 1690
224 Ga0495638_0025374 3300046460 Unclassified 3854
225 Ga0495596_0007137 3300046500 Bacteria 5057
226 Ga0495606_0010107 3300046507 Bacteria 7878
227 Ga0495606_0029912 3300046507 Bacteria 3816
228 Ga0495606_0072839 3300046507 Bacteria 2157
229 Ga0495610_0000005 3300046512 Bacteria 924111
230 Ga0495616_0001171 3300046513 Bacteria 18545
231 Ga0495648_0017373 3300046524 Bacteria 5144
232 Ga0495663_0000093 3300046525 Bacteria 39511
233 Ga0495663_0001020 3300046525 Bacteria 9258
234 Ga0495652_0015055 3300046529 Bacteria 6928
235 Ga0495654_0000003 3300046530 Bacteria 863485
236 Ga0495609_0000003 3300046538 Bacteria 711547
237 Ga0495645_0141111 3300046543 Bacteria 1680
238 Ga0495633_0101611 3300046558 Bacteria 1335
239 Ga0495667_0081676 3300046559 Bacteria 2100
240 Ga0495611_0000026 3300046648 Bacteria 118428
241 Ga0495625_0034846 3300046660 Bacteria 3712
242 Ga0495625_0193322 3300046660 Bacteria 1347
243 Ga0495661_0001729 3300046665 Bacteria 17655
244 Ga0495599_0007660 3300046678 Bacteria 6556
245 Ga0495623_0058114 3300046679 Bacteria 2432
246 Ga0495669_0049044 3300046684 Bacteria 1890
247 Ga0495660_0004838 3300046810 Bacteria 8124
248 Ga0495604_0040098 3300047317 Bacteria 3678
249 Ga0495636_0000011 3300047318 Bacteria 87862
250 Ga0495686_0000069 3300047472 Bacteria 217778
251 Ga0495602_0049316 3300048088 Bacteria 3772
252 Ga0496102_0017191 3300048905 Bacteria 6333
253 Ga0496103_0253459 3300048906 Bacteria 1132
254 Ga0496105_0112280 3300048908 Bacteria 2249
255 Ga0496105_0179137 3300048908 Bacteria 1736
256 Ga0496114_0000603 3300048917 Bacteria 26557
257 Ga0496115_0005239 3300048918 Bacteria 9424
258 Ga0496116_0000029 3300048919 Bacteria 422187
259 Ga0496117_0000007 3300048920 Bacteria 720505
260 Ga0496118_0000104 3300048921 Bacteria 157435
261 Ga0496119_0000007 3300048922 Bacteria 475920
262 Ga0496122_0000222 3300048925 Bacteria 126693
263 Ga0496122_0000724 3300048925 Bacteria 64522
264 Ga0496122_0003160 3300048925 Bacteria 22018
265 Ga0496122_0003562 3300048925 Bacteria 20353
266 Ga0496122_0009530 3300048925 Bacteria 10205
267 Ga0496123_0000592 3300048926 Bacteria 61754
268 Ga0496123_0012316 3300048926 Bacteria 7304
269 Ga0496123_0014775 3300048926 Bacteria 6446
270 Ga0496124_0005164 3300048927 Bacteria 14855
271 Ga0496124_0267149 3300048927 Bacteria 1255
272 Ga0496125_0000498 3300048928 Bacteria 68479
273 Ga0496125_0012483 3300048928 Bacteria 8430
274 Ga0496125_0018950 3300048928 Bacteria 6513
275 Ga0496126_0001962 3300048929 Bacteria 29153
276 Ga0501036_0407963 3300049572 Unclassified 1133
277 Ga0501251_000464 3300049681 Bacteria 3624
278 Ga0501269_000031 3300049766 Bacteria 44939
279 Ga0501035_0008102 3300049822 Bacteria 9794
280 nmdc:mga03683_898_c1 3300050489 Bacteria 8564
281 nmdc:mga0k408_17819_c1 3300050493 Bacteria 3959
282 nmdc:mga0k408_3920_c1 3300050493 Bacteria 7891
283 nmdc:mga0k408_3984_c1 3300050493 Bacteria 7831
284 nmdc:mga07m45_20261_c1 3300050496 Bacteria 1395
285 nmdc:mga07m45_224566_c1 3300050496 Bacteria 1093
286 nmdc:mga05p37_72145_c1 3300050507 Unclassified 4248
287 nmdc:mga09592_377139_c1 3300050508 Unclassified 1226
288 nmdc:mga09592_53168_c1 3300050508 Bacteria 3419
289 nmdc:mga06r32_32403_c1 3300050510 Bacteria 4917
290 nmdc:mga08y16_76985_c1 3300050511 Bacteria 3477
291 Ga0495601_0023125 3300053077 Bacteria 3818
292 Ga0495619_0057616 3300053085 Bacteria 2578
293 Ga0500651_0085454 3300053093 Bacteria 1949
294 Ga0500555_000802 3300053103 Bacteria 11320
295 Ga0500556_0000441 3300053104 Bacteria 29701
296 Ga0500642_0047502 3300053130 Bacteria 1881
297 Ga0500564_043652 3300053138 Bacteria 2061
298 Ga0500568_0001850 3300053139 Bacteria 13039
299 Ga0500622_0002113 3300053156 Bacteria 14791
300 Ga0501084_0195422 3300054114 Bacteria 1707
301 2511235059 2511231000 Bacteria 4488346
302 2524004373 2523533629 Bacteria 2982326
303 2524006707 2523533629 Bacteria 2982326
304 2585140986 2582581278 Bacteria 5296881
305 2585159075 2582581281 Bacteria 4487904
306 2585163338 2582581282 Bacteria 4495830
307 2585425994 2582581873 Bacteria 3032664
308 2587677128 2585428045 Bacteria 5203023
309 2587746335 2585428060 Bacteria 5304711
310 2587752531 2585428061 Bacteria 3939663
311 2587944699 2585428115 Bacteria 4420269
312 2588211393 2585428182 Bacteria 5007281
313 2588215770 2585428183 Bacteria 5166119
314 2588219168 2585428184 Bacteria 4978681
315 2588224669 2585428185 Bacteria 4969476
316 2588447455 2588253712 Bacteria 5403181
317 2590603088 2588254255 Bacteria 5014294
318 2590610091 2588254257 Bacteria 5436094
319 2729200897 2728369107 Bacteria 5082720
320 2738760244 2738541284 Bacteria 5199923
321 2740060320 2739367874 Bacteria 4872888
322 2753674102 2751185877 Bacteria 4921427
323 2765575570 2765235839 Bacteria 5314748
324 2772603791 2772190705 Bacteria 4666226
325 2775674421 2775506739 Bacteria 3855222
326 2787507227 2786546548 Bacteria 4745694
327 2816875423 2816332188 Bacteria 5133218
328 2842087281 2842083920 Bacteria 4857652
329 2871723495 2871720351 Bacteria 4862476
330 2881958415 2881955468 Bacteria 3545609
331 2889293919 2889290771 Bacteria 5530962
332 2898714092 2898713307 Bacteria 4110805
333 2905999088 2905999023 Bacteria 4591259
334 2910246660 2910245624 Bacteria 6935613
335 2919098037 2919097161 Bacteria 3860339
336 2919403296 2919399522 Bacteria 5164947
337 2946023979 2946019816 Bacteria 4621265
338 2977243631 2977243572 Bacteria 4374394
339 2984574369 2984572630 Bacteria 4186940
340 2984607819 2984606641 Bacteria 4186971
341 2993375192 2993372514 Bacteria 4214139
342 2993482052 2993480792 Bacteria 4022225
343 Ga0501034_0087055
344 SwRhRL2b_contig_1663050
345 SwRhRL2b_contig_503364
346 JGI24736J21556_1002406
347 JGI24741J21665_1000053
348 JGI24740J21852_10006796
349 JGI24737J22298_10001385
350 JGI24735J21928_10000905
351 JGI24744J21845_10006775
352 JGI25162J39368_1000123
353 JGI25165J46597_1009353
354 rootH2_10291355
355 rootH2_10314100
356 rootL2_10035342
357 rootL2_10108558
358 rootL2_10209827
359 Ga0006562J51391_1034006
360 Ga0055534_1010414
361 Ga0058862_11672467
362 Ga0065714_10002476
363 Ga0065704_10070140
364 Ga0065704_10070627
365 Ga0065704_10075459
366 Ga0065704_10094467
367 Ga0065704_10155307
368 Ga0070658_10000301
369 Ga0070658_10153306
370 Ga0070683_100543008
371 Ga0070670_100020536
372 Ga0070670_100032995
373 Ga0070680_100002242
374 Ga0070680_100007099
375 Ga0070682_100031492
376 Ga0068868_100004333
377 Ga0070660_100067910
378 Ga0070660_100124876
379 Ga0070660_100160359
380 Ga0070668_100005392
381 Ga0070668_100033889
382 Ga0070675_100025422
383 Ga0070671_100015203
384 Ga0070673_100159703
385 Ga0070659_100002177
386 Ga0070667_100065126
387 Ga0070713_100060272
388 Ga0070662_100000273
389 Ga0070681_10029020
390 Ga0070698_100463356
391 Ga0070679_100005487
392 Ga0068853_100064233
393 Ga0068855_100000098
394 Ga0068855_100000246
395 Ga0068855_100004293
396 Ga0068855_100017752
397 Ga0068855_100304291
398 Ga0068857_100057046
399 Ga0068856_100000006
400 Ga0068856_100004154
401 Ga0068856_100049263
402 Ga0068856_100147328
403 Ga0068856_100569148
404 Ga0068866_10049017
405 Ga0068861_100555961
406 Ga0068851_10030675
407 Ga0068863_100087963
408 Ga0097621_100000503
409 Ga0075370_10145449
410 Ga0068871_100009454
411 Ga0068871_100379568
412 Ga0075431_100003977
413 Ga0075429_100107665
414 Ga0097620_100012023
415 Ga0105244_10000005
416 Ga0105250_10019213
417 Ga0105240_10000047
418 Ga0111539_10005994
419 Ga0114129_10009167
420 Ga0105243_10000216
421 Ga0105241_10342859
422 Ga0105248_10076681
423 Ga0105237_10001137
424 Ga0105237_10001178
425 Ga0105237_10005890
426 Ga0105249_10002034
427 Ga0105239_10000240
428 Ga0105239_10000659
429 Ga0105239_10000759
430 Ga0105239_10001566
431 Ga0157373_10000032
432 Ga0157373_10008545
433 Ga0157373_10107430
434 Ga0157371_10000069
435 Ga0157371_10000257
436 Ga0157371_10000521
437 Ga0157371_10018704
438 Ga0157371_10040730
439 Ga0157371_10043978
440 Ga0157371_10102261
441 Ga0157370_10001978
442 Ga0157370_10005939
443 Ga0157370_10023638
444 Ga0157370_10027323
445 Ga0157370_10038948
446 Ga0157370_10094264
447 Ga0157370_10442840
448 Ga0157370_10658071
449 Ga0157369_10000939
450 Ga0157369_10384626
451 Ga0157374_10009787
452 Ga0157374_10015542
453 Ga0157374_10283320
454 Ga0157378_10000370
455 Ga0157378_10282359
456 Ga0163162_10003569
457 Ga0157372_10000327
458 Ga0157372_10006205
459 Ga0157372_10006889
460 Ga0157372_10027698
461 Ga0157372_10184248
462 Ga0157372_10220351
463 Ga0157372_10627576
464 Ga0157372_10854930
465 Ga0157372_10872556
466 Ga0157375_10000141
467 Ga0157375_10005044
468 Ga0157375_10196028
469 Ga0163163_10000215
470 Ga0163163_10170548
471 Ga0182008_10000003
472 Ga0182008_10000006
473 Ga0157377_10018527
474 Ga0157379_10094971
475 Ga0157376_10000216
476 Ga0163161_10000863
477 Ga0163161_10017377
478 Ga0163161_10033944
479 Ga0213872_10010670
480 Ga0213876_10011649
481 Ga0209437_100251
482 Ga0209026_1008604
483 Ga0209233_1000478
484 Ga0209675_1000066
485 Ga0209050_1000879
486 Ga0207696_1022969
487 Ga0207655_1000016
488 Ga0207647_10000041
489 Ga0207647_10026626
490 Ga0207647_10157567
491 Ga0207705_10000336
492 Ga0207705_10120920
493 Ga0207707_10328831
494 Ga0207695_10000010
495 Ga0207695_10100705
496 Ga0207695_10191219
497 Ga0207671_10001141
498 Ga0207671_10002987
499 Ga0207693_10394890
500 Ga0207660_10002900
501 Ga0207657_10078242
502 Ga0207657_10109050
503 Ga0207657_10156634
504 Ga0207652_10004076
505 Ga0207650_10030832
506 Ga0207659_10034471
507 Ga0207700_10206768
508 Ga0207644_10008407
509 Ga0207690_10003394
510 Ga0207706_10000380
511 Ga0207709_10000084
512 Ga0207667_10000014
513 Ga0207667_10000823
514 Ga0207667_10008112
515 Ga0207667_10034884
516 Ga0207667_10256749
517 Ga0207651_10697176
518 Ga0207712_10006004
519 Ga0207668_10082730
520 Ga0207668_10083586
521 Ga0207640_10022577
522 Ga0207658_10032346
523 Ga0207677_10013263
524 Ga0207702_10000023
525 Ga0207702_10014889
526 Ga0207702_10077521
527 Ga0207641_10073525
528 Ga0207674_10018153
529 Ga0207675_100225203
530 Ga0307517_10026155
531 Ga0265338_10015498
532 Ga0265339_10174992
533 Ga0307516_10042125
534 Ga0307412_10000027
535 Ga0307412_10008629
536 Ga0307416_100000006
537 Ga0307510_10001133
538 Ga0373953_0053475
539 Ga0373954_0038265
540 Ga0395899_0000049
541 Ga0395899_0058448
542 Ga0395900_0000541
543 Ga0395900_0087180
544 Ga0395900_0138781
545 Ga0395900_0351708
546 Ga0395901_0143245
547 Ga0400490_48759
548 Ga0436365_0599632
549 Ga0436365_1081099
550 Ga0436360_1195894
551 Ga0436361_0033376
552 Ga0436361_0295894
553 Ga0436361_0318011
554 Ga0436361_1138820
555 Ga0439465_0003550
556 Ga0439445_0001701
557 Ga0453683_0295853
558 Ga0453684_0001660
559 Ga0453684_0001748
560 Ga0453684_0075376
561 Ga0466968_0036692
562 Ga0451576_0009348
563 Ga0495627_000022
564 Ga0495627_007455
565 Ga0495592_0139241
566 Ga0495638_0025374
567 Ga0495596_0007137
568 Ga0495606_0010107
569 Ga0495606_0029912
570 Ga0495606_0072839
571 Ga0495610_0000005
572 Ga0495616_0001171
573 Ga0495648_0017373
574 Ga0495663_0000093
575 Ga0495663_0001020
576 Ga0495652_0015055
577 Ga0495654_0000003
578 Ga0495609_0000003
579 Ga0495645_0141111
580 Ga0495633_0101611
581 Ga0495667_0081676
582 Ga0495611_0000026
583 Ga0495625_0034846
584 Ga0495625_0193322
585 Ga0495661_0001729
586 Ga0495599_0007660
587 Ga0495623_0058114
588 Ga0495669_0049044
589 Ga0495660_0004838
590 Ga0495604_0040098
591 Ga0495636_0000011
592 Ga0495686_0000069
593 Ga0495602_0049316
594 Ga0496102_0017191
595 Ga0496103_0253459
596 Ga0496105_0112280
597 Ga0496105_0179137
598 Ga0496114_0000603
599 Ga0496115_0005239
600 Ga0496116_0000029
601 Ga0496117_0000007
602 Ga0496118_0000104
603 Ga0496119_0000007
604 Ga0496122_0000222
605 Ga0496122_0000724
606 Ga0496122_0003160
607 Ga0496122_0003562
608 Ga0496122_0009530
609 Ga0496123_0000592
610 Ga0496123_0012316
611 Ga0496123_0014775
612 Ga0496124_0005164
613 Ga0496124_0267149
614 Ga0496125_0000498
615 Ga0496125_0012483
616 Ga0496125_0018950
617 Ga0496126_0001962
618 Ga0501036_0407963
619 Ga0501251_000464
620 Ga0501269_000031
621 Ga0501035_0008102
622 nmdc:mga03683_898_c1
623 nmdc:mga0k408_17819_c1
624 nmdc:mga0k408_3920_c1
625 nmdc:mga0k408_3984_c1
626 nmdc:mga07m45_20261_c1
627 nmdc:mga07m45_224566_c1
628 nmdc:mga05p37_72145_c1
629 nmdc:mga09592_377139_c1
630 nmdc:mga09592_53168_c1
631 nmdc:mga06r32_32403_c1
632 nmdc:mga08y16_76985_c1
633 Ga0495601_0023125
634 Ga0495619_0057616
635 Ga0500651_0085454
636 Ga0500555_000802
637 Ga0500556_0000441
638 Ga0500642_0047502
639 Ga0500564_043652
640 Ga0500568_0001850
641 Ga0500622_0002113
642 Ga0501084_0195422
643 2511235059
644 2524004373
645 2524006707
646 2585140986
647 2585159075
648 2585163338
649 2585425994
650 2587677128
651 2587746335
652 2587752531
653 2587944699
654 2588211393
655 2588215770
656 2588219168
657 2588224669
658 2588447455
659 2590603088
660 2590610091
661 2729200897
662 2738760244
663 2740060320
664 2753674102
665 2765575570
666 2772603791
667 2775674421
668 2787507227
669 2816875423
670 2842087281
671 2871723495
672 2881958415
673 2889293919
674 2898714092
675 2905999088
676 2910246660
677 2919098037
678 2919403296
679 2946023979
680 2977243631
681 2984574369
682 2984607819
683 2993375192
684 2993482052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

66

279

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.9002 34 277
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8836 34 277
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8726 34 277
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8661 34 280
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8443 34 277
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6371 88 274 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6148 60 274 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5502 80 275 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4907 60 274 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4593 88 274 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A5B5W015-F1-model_v4 deleted 0.9779 52 282
AF-A0A4Q5YB90-F1-model_v4 Transport permease protein 0.9772 49 282 GO:0015920
GO:0043190
GO:0140359
AF-A0A3D3D577-F1-model_v4 deleted 0.9681 38 282
AF-A0A5B5W015-F1-model_v4 deleted 0.9575 52 282
AF-A0A1M7BHU4-F1-model_v4 Transport permease protein 0.9574 48 282 GO:0015920
GO:0043190
GO:0140359

Map