F415346

General Info

Members Datasets Scaffolds Average Seq Length
342 193 684 453

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0003228|Ga0501047_0003228_9977_11377
Length 466
Sequence MNLRLADVAMWTKGALHGADDATSGAAVTGIFTDTRKPVAGGLFVALKGENFDAHDFLAQAKEAGAAAALVARPIAVDLPQVVVADTLLALGDLASAVRAQRRARVAGXXXSNGKTTVKTLLASILAHCGKTHVNAGNLNNEIGLPLSILAMPEDAQFAVLEMGAGKPGDIAYLAAIARPEIALVNNIGPAHLERMGSLEGIAQTKGAIYAALPAHGTAVINVDDAFADYFAGVSGTRRVLRFGLEHAADVRAEISAMGTTSRFELVAPAGRCAVNLPLPGRHNVLNALAAAALGLAFDAPLDAIKHGLESAPAVAGRLIRHAMPGGWTLIDDSYNANPGSTAAAIATLAAEASSTKSGESWLVLGDMRELGADASKLHADIGDLAREQGIARMYAVGDLSKHAARAFGANARHFADQSALIAALAADAHAGVTVLVKGSRGSAMDRVVRALLGEANGNGGTRHAA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
67 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
68 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
69 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
191 2739367700 Dyella sp. YR388 Isolate Unclassified
192 2884411467 Dyella sp. AD56 Isolate Rhizosphere
193 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 0.58
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.53
Nodule 0
Rhizoplane 4.97
Rhizosphere 71.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0003228 3300049581 Bacteria 15454
2 JGI24739J22299_10000934 3300001989 Bacteria 10874
3 JGI24737J22298_10001994 3300001990 Bacteria 7298
4 JGI25156J39149_1000763 3300002705 Bacteria 16723
5 JGI25162J39368_1001140 3300002737 Bacteria 15933
6 JGI25162J39368_1001141 3300002737 Bacteria 15919
7 JGI25157J39369_1000133 3300002741 Bacteria 62143
8 JGI25157J39369_1000213 3300002741 Bacteria 48048
9 JGI25163J39215_1000210 3300002771 Bacteria 22204
10 JGI25164J39214_1000075 3300002772 Bacteria 97713
11 JGI25165J46597_1000178 3300003214 Bacteria 97713
12 rootH2_10038156 3300003320 Bacteria 6937
13 Ga0006562J51391_1017132 3300003578 Bacteria 8263
14 Ga0006562J51391_1017134 3300003578 Bacteria 5240
15 Ga0055538_1000590 3300003751 Bacteria 12121
16 Ga0055539_1001313 3300003752 Bacteria 4846
17 Ga0055533_1002821 3300003756 Bacteria 3769
18 Ga0055535_1000350 3300003761 Bacteria 45642
19 Ga0055542_1001122 3300003762 Bacteria 15933
20 Ga0055542_1001123 3300003762 Bacteria 15927
21 Ga0055529_1000153 3300003763 Bacteria 97713
22 Ga0065165_1001387 3300005262 Bacteria 26573
23 Ga0070658_10006615 3300005327 Bacteria 9394
24 Ga0070683_100129403 3300005329 Bacteria 2388
25 Ga0070670_100053841 3300005331 Bacteria 3455
26 Ga0068869_100094370 3300005334 Bacteria 2255
27 Ga0068869_100128166 3300005334 Bacteria 1948
28 Ga0070666_10000022 3300005335 Bacteria 166910
29 Ga0070666_10000888 3300005335 Bacteria 18197
30 Ga0070660_100039046 3300005339 Bacteria 3607
31 Ga0070661_100009609 3300005344 Bacteria 6701
32 Ga0070668_100086305 3300005347 Bacteria 2468
33 Ga0070668_100092293 3300005347 Bacteria 2388
34 Ga0070667_100000065 3300005367 Bacteria 135172
35 Ga0070667_100085755 3300005367 Bacteria 2701
36 Ga0070667_100088757 3300005367 Bacteria 2655
37 Ga0070663_100007231 3300005455 Bacteria 6745
38 Ga0070663_100047659 3300005455 Bacteria 3036
39 Ga0070678_100050411 3300005456 Bacteria 3011
40 Ga0070662_100017832 3300005457 Bacteria 4790
41 Ga0070681_10000231 3300005458 Bacteria 43967
42 Ga0068867_100078815 3300005459 Bacteria 2478
43 Ga0070685_10000983 3300005466 Bacteria 15333
44 Ga0068853_100039209 3300005539 Bacteria 4040
45 Ga0068853_100162615 3300005539 Bacteria 2015
46 Ga0070672_100099333 3300005543 Bacteria 2359
47 Ga0070665_100033222 3300005548 Bacteria 5191
48 Ga0070665_100048673 3300005548 Bacteria 4255
49 Ga0068855_100071441 3300005563 Bacteria 4036
50 Ga0068855_100075719 3300005563 Bacteria 3907
51 Ga0068855_100231198 3300005563 Bacteria 2070
52 Ga0068857_100000919 3300005577 Bacteria 22265
53 Ga0068854_100006938 3300005578 Bacteria 7224
54 Ga0068854_100026946 3300005578 Bacteria 3955
55 Ga0068856_100056920 3300005614 Bacteria 3860
56 Ga0068852_100026399 3300005616 Bacteria 4720
57 Ga0068852_100031616 3300005616 Bacteria 4371
58 Ga0068852_100080465 3300005616 Bacteria 2889
59 Ga0068864_100020921 3300005618 Bacteria 5477
60 Ga0068851_10000956 3300005834 Bacteria 12498
61 Ga0068851_10028940 3300005834 Bacteria 2740
62 Ga0068851_10050168 3300005834 Bacteria 2118
63 Ga0068858_100000817 3300005842 Bacteria 32476
64 Ga0068858_100126832 3300005842 Bacteria 2390
65 Ga0068860_100004354 3300005843 Bacteria 14469
66 Ga0068860_100198712 3300005843 Bacteria 1942
67 Ga0068862_100112315 3300005844 Bacteria 2393
68 Ga0068862_100122128 3300005844 Bacteria 2297
69 Ga0097621_100049596 3300006237 Bacteria 3411
70 Ga0068871_100035397 3300006358 Bacteria 3967
71 Ga0068871_100077728 3300006358 Bacteria 2743
72 Ga0068871_100082680 3300006358 Bacteria 2663
73 Ga0068865_100001698 3300006881 Bacteria 12909
74 Ga0068865_100071000 3300006881 Bacteria 2468
75 Ga0105240_10000239 3300009093 Bacteria 109259
76 Ga0105240_10007228 3300009093 Bacteria 16170
77 Ga0105240_10007369 3300009093 Bacteria 16004
78 Ga0105240_10094045 3300009093 Bacteria 3657
79 Ga0105240_10198219 3300009093 Bacteria 2355
80 Ga0105245_10009341 3300009098 Bacteria 8553
81 Ga0105242_10006944 3300009176 Bacteria 8740
82 Ga0105237_10000011 3300009545 Bacteria 307361
83 Ga0105237_10138689 3300009545 Bacteria 2426
84 Ga0105238_10000760 3300009551 Bacteria 33531
85 Ga0105238_10001027 3300009551 Bacteria 28401
86 Ga0105238_10045967 3300009551 Bacteria 4408
87 Ga0105239_10000027 3300010375 Bacteria 248028
88 Ga0105239_10037721 3300010375 Bacteria 5296
89 Ga0105239_10063635 3300010375 Bacteria 4050
90 Ga0105239_10065237 3300010375 Bacteria 3998
91 Ga0105239_10082540 3300010375 Bacteria 3539
92 Ga0105239_10116614 3300010375 Bacteria 2963
93 Ga0105239_10387915 3300010375 Bacteria 1580
94 Ga0105246_10012981 3300011119 Bacteria 5213
95 Ga0157314_1000213 3300012500 Bacteria 6314
96 Ga0157370_10034228 3300013104 Bacteria 4949
97 Ga0157370_10061807 3300013104 Bacteria 3554
98 Ga0157369_10000001 3300013105 Bacteria 554908
99 Ga0157369_10031193 3300013105 Bacteria 5873
100 Ga0157369_10187921 3300013105 Bacteria 2172
101 Ga0163162_10000017 3300013306 Bacteria 233474
102 Ga0163162_10000132 3300013306 Bacteria 67582
103 Ga0163162_10078605 3300013306 Bacteria 3364
104 Ga0157372_10002763 3300013307 Bacteria 18978
105 Ga0157372_10110438 3300013307 Bacteria 3149
106 Ga0157375_10041790 3300013308 Bacteria 4430
107 Ga0157375_10087389 3300013308 Bacteria 3170
108 Ga0163163_10103571 3300014325 Bacteria 2871
109 Ga0157379_10000606 3300014968 Bacteria 28906
110 Ga0157376_10063779 3300014969 Bacteria 3105
111 Ga0157376_10068440 3300014969 Bacteria 3007
112 Ga0157376_10271986 3300014969 Bacteria 1592
113 Ga0183369_1018 3300015685 Bacteria 117953
114 Ga0183368_1003 3300015687 Bacteria 1276390
115 Ga0209435_101138 3300025206 Bacteria 3667
116 Ga0209760_100466 3300025207 Bacteria 8909
117 Ga0209784_100104 3300025224 Bacteria 98272
118 Ga0209566_101798 3300025225 Bacteria 4977
119 Ga0209674_100012 3300025226 Bacteria 950162
120 Ga0209672_100765 3300025228 Bacteria 15441
121 Ga0207427_100070 3300025231 Bacteria 160908
122 Ga0207427_101323 3300025231 Bacteria 9272
123 Ga0209437_100059 3300025233 Bacteria 355048
124 Ga0209437_100214 3300025233 Bacteria 107034
125 Ga0209258_100027 3300025242 Bacteria 518449
126 Ga0209258_100383 3300025242 Bacteria 56544
127 Ga0209258_105570 3300025242 Bacteria 2110
128 Ga0209646_1001180 3300025246 Bacteria 7586
129 Ga0209026_1000176 3300025250 Bacteria 97745
130 Ga0209026_1002879 3300025250 Bacteria 6067
131 Ga0209148_1000001 3300025254 Bacteria 2545271
132 Ga0209148_1000002 3300025254 Bacteria 2399500
133 Ga0209759_1000333 3300025256 Bacteria 62095
134 Ga0209759_1003384 3300025256 Bacteria 6395
135 Ga0209129_1001293 3300025258 Bacteria 14274
136 Ga0209233_1000002 3300025261 Bacteria 2501366
137 Ga0209455_1000019 3300025272 Bacteria 705658
138 Ga0209455_1010270 3300025272 Bacteria 2392
139 Ga0209758_1000791 3300025297 Bacteria 45103
140 Ga0209758_1038693 3300025297 Bacteria 1826
141 Ga0209051_1006843 3300025303 Bacteria 6344
142 Ga0207656_10036424 3300025321 Bacteria 2065
143 Ga0207680_10000001 3300025903 Bacteria 1091453
144 Ga0207680_10000079 3300025903 Bacteria 43755
145 Ga0207680_10003931 3300025903 Bacteria 7012
146 Ga0207680_10020019 3300025903 Bacteria 3590
147 Ga0207680_10077782 3300025903 Bacteria 2076
148 Ga0207647_10000262 3300025904 Bacteria 43207
149 Ga0207647_10016792 3300025904 Bacteria 4988
150 Ga0207645_10022090 3300025907 Bacteria 4144
151 Ga0207643_10016629 3300025908 Bacteria 4012
152 Ga0207705_10001121 3300025909 Bacteria 21795
153 Ga0207654_10000719 3300025911 Bacteria 18479
154 Ga0207654_10053506 3300025911 Bacteria 2331
155 Ga0207654_10104373 3300025911 Bacteria 1752
156 Ga0207707_10000075 3300025912 Bacteria 101459
157 Ga0207695_10000082 3300025913 Bacteria 284333
158 Ga0207695_10001405 3300025913 Bacteria 40582
159 Ga0207695_10002529 3300025913 Bacteria 26858
160 Ga0207695_10005890 3300025913 Bacteria 16084
161 Ga0207695_10009237 3300025913 Bacteria 12219
162 Ga0207695_10011712 3300025913 Bacteria 10596
163 Ga0207695_10067433 3300025913 Bacteria 3670
164 Ga0207671_10000011 3300025914 Bacteria 530349
165 Ga0207671_10009449 3300025914 Bacteria 8151
166 Ga0207657_10001571 3300025919 Bacteria 24515
167 Ga0207649_10028538 3300025920 Bacteria 3286
168 Ga0207649_10117493 3300025920 Bacteria 1788
169 Ga0207694_10000200 3300025924 Bacteria 59994
170 Ga0207694_10000412 3300025924 Bacteria 39847
171 Ga0207694_10001428 3300025924 Bacteria 20477
172 Ga0207694_10020266 3300025924 Bacteria 5028
173 Ga0207650_10010026 3300025925 Bacteria 6487
174 Ga0207706_10006038 3300025933 Bacteria 11268
175 Ga0207706_10239299 3300025933 Bacteria 1587
176 Ga0207686_10013879 3300025934 Bacteria 4468
177 Ga0207686_10037827 3300025934 Bacteria 2915
178 Ga0207670_10001106 3300025936 Bacteria 14192
179 Ga0207669_10151794 3300025937 Bacteria 1624
180 Ga0207704_10029040 3300025938 Bacteria 3077
181 Ga0207691_10013922 3300025940 Bacteria 7674
182 Ga0207691_10031936 3300025940 Bacteria 4914
183 Ga0207689_10071678 3300025942 Bacteria 2846
184 Ga0207689_10122590 3300025942 Bacteria 2138
185 Ga0207667_10049716 3300025949 Bacteria 4426
186 Ga0207667_10050016 3300025949 Bacteria 4411
187 Ga0207667_10072922 3300025949 Bacteria 3568
188 Ga0207712_10000395 3300025961 Bacteria 37905
189 Ga0207640_10004782 3300025981 Bacteria 7354
190 Ga0207640_10006824 3300025981 Bacteria 6279
191 Ga0207640_10022980 3300025981 Bacteria 3742
192 Ga0207703_10113168 3300026035 Bacteria 2319
193 Ga0207703_10115925 3300026035 Bacteria 2292
194 Ga0207639_10057788 3300026041 Bacteria 2981
195 Ga0207639_10153703 3300026041 Bacteria 1930
196 Ga0207678_10013058 3300026067 Bacteria 7287
197 Ga0207678_10068921 3300026067 Bacteria 3034
198 Ga0207678_10088850 3300026067 Bacteria 2641
199 Ga0207702_10050940 3300026078 Bacteria 3497
200 Ga0207648_10009137 3300026089 Bacteria 9527
201 Ga0207676_10004524 3300026095 Bacteria 9833
202 Ga0207674_10000146 3300026116 Bacteria 82851
203 Ga0207674_10002886 3300026116 Bacteria 21357
204 Ga0207674_10206132 3300026116 Bacteria 1915
205 Ga0207683_10034554 3300026121 Bacteria 4394
206 Ga0207698_10022876 3300026142 Bacteria 4356
207 Ga0207698_10038515 3300026142 Bacteria 3533
208 Ga0268266_10000008 3300028379 Bacteria 1161875
209 Ga0268266_10000075 3300028379 Bacteria 218045
210 Ga0268264_10008995 3300028381 Bacteria 8287
211 Ga0268264_10034111 3300028381 Bacteria 4185
212 Ga0268264_10048041 3300028381 Bacteria 3549
213 Ga0268264_10102625 3300028381 Bacteria 2489
214 Ga0307508_10012885 3300031616 Bacteria 7644
215 Ga0307510_10016108 3300033180 Bacteria 8828
216 Ga0395899_0018037 3300037312 Bacteria 5371
217 Ga0395899_0066580 3300037312 Bacteria 2645
218 Ga0395900_0020257 3300037418 Bacteria 6788
219 Ga0395900_0077137 3300037418 Bacteria 3423
220 Ga0395898_0101967 3300037466 Bacteria 2755
221 Ga0395898_0102690 3300037466 Bacteria 2744
222 Ga0395901_0045194 3300038443 Bacteria 4569
223 Ga0395901_0073303 3300038443 Bacteria 3570
224 Ga0395901_0074450 3300038443 Bacteria 3542
225 Ga0395901_0100132 3300038443 Bacteria 3039
226 Ga0436365_1115483 3300039437 Bacteria 2281
227 Ga0451793_0513347 3300041452 Bacteria 3719
228 Ga0466969_0014103 3300044656 Bacteria 4205
229 Ga0466969_0023134 3300044656 Bacteria 3203
230 Ga0466972_0000578 3300044658 Bacteria 17792
231 Ga0466982_0000012 3300044672 Bacteria 166823
232 Ga0466965_0001344 3300044683 Bacteria 9858
233 Ga0466966_0013949 3300044684 Bacteria 5320
234 Ga0466961_0019003 3300044693 Bacteria 4421
235 Ga0466961_0040875 3300044693 Bacteria 2972
236 Ga0466964_0013919 3300044706 Bacteria 3055
237 Ga0466971_0002418 3300044719 Bacteria 7876
238 Ga0466970_0000012 3300044765 Bacteria 83623
239 Ga0466959_0019425 3300045049 Bacteria 4997
240 Ga0466959_0031054 3300045049 Bacteria 3953
241 Ga0495638_0000019 3300046460 Bacteria 384671
242 Ga0495638_0000164 3300046460 Bacteria 103139
243 Ga0495638_0003036 3300046460 Bacteria 13368
244 Ga0495650_0000338 3300046471 Bacteria 83352
245 Ga0495650_0000498 3300046471 Bacteria 59590
246 Ga0495606_0001115 3300046507 Bacteria 38368
247 Ga0495597_0036615 3300046542 Bacteria 2208
248 Ga0495622_0028616 3300046557 Bacteria 2602
249 Ga0495625_0015407 3300046660 Bacteria 6056
250 Ga0496100_0138627 3300048903 Bacteria 1721
251 Ga0496101_0074591 3300048904 Bacteria 2495
252 Ga0496101_0087082 3300048904 Bacteria 2318
253 Ga0496104_0000012 3300048907 Bacteria 438011
254 Ga0496105_0000032 3300048908 Bacteria 135801
255 Ga0496105_0001031 3300048908 Bacteria 19253
256 Ga0496105_0132196 3300048908 Bacteria 2057
257 Ga0496106_0040738 3300048909 Bacteria 3480
258 Ga0496107_0055126 3300048910 Bacteria 2871
259 Ga0496113_0010938 3300048916 Bacteria 6025
260 Ga0496114_0207636 3300048917 Bacteria 1717
261 Ga0496115_0000060 3300048918 Bacteria 101954
262 Ga0496115_0000238 3300048918 Bacteria 50050
263 Ga0496115_0001908 3300048918 Bacteria 14878
264 Ga0496115_0008327 3300048918 Bacteria 7669
265 Ga0496115_0121943 3300048918 Bacteria 2145
266 Ga0496117_0008257 3300048920 Bacteria 9919
267 Ga0496117_0013518 3300048920 Bacteria 7116
268 Ga0496118_0002643 3300048921 Bacteria 23743
269 Ga0496118_0002869 3300048921 Bacteria 22496
270 Ga0496118_0006327 3300048921 Bacteria 13082
271 Ga0496118_0012479 3300048921 Bacteria 8147
272 Ga0496118_0078140 3300048921 Bacteria 2343
273 Ga0496119_0000322 3300048922 Bacteria 67165
274 Ga0496120_0000143 3300048923 Bacteria 120051
275 Ga0496120_0000665 3300048923 Bacteria 50530
276 Ga0496121_0000938 3300048924 Bacteria 52758
277 Ga0496121_0016791 3300048924 Bacteria 7530
278 Ga0496121_0035013 3300048924 Bacteria 4506
279 Ga0496121_0067821 3300048924 Bacteria 2889
280 Ga0496121_0074826 3300048924 Bacteria 2707
281 Ga0496123_0030787 3300048926 Bacteria 3921
282 Ga0496124_0005234 3300048927 Bacteria 14713
283 Ga0496125_0000469 3300048928 Bacteria 72128
284 Ga0496125_0027756 3300048928 Bacteria 5124
285 Ga0496126_0000253 3300048929 Bacteria 115336
286 Ga0496126_0001473 3300048929 Bacteria 36602
287 Ga0496126_0007637 3300048929 Bacteria 11803
288 Ga0496126_0020315 3300048929 Bacteria 6517
289 Ga0496126_0046366 3300048929 Bacteria 3987
290 Ga0495682_0010674 3300049460 Bacteria 3549
291 Ga0501031_0003742 3300049568 Bacteria 9787
292 Ga0501031_0026823 3300049568 Bacteria 3755
293 Ga0501032_0017448 3300049569 Bacteria 5042
294 Ga0501033_0002131 3300049570 Bacteria 17126
295 Ga0501033_0004203 3300049570 Bacteria 11589
296 Ga0501034_0004129 3300049571 Bacteria 16267
297 Ga0501034_0010416 3300049571 Bacteria 9689
298 Ga0501034_0029591 3300049571 Bacteria 5569
299 Ga0501036_0134550 3300049572 Bacteria 2086
300 Ga0501038_0065215 3300049574 Bacteria 3103
301 Ga0501039_0162039 3300049575 Bacteria 1758
302 Ga0501043_0026366 3300049579 Bacteria 4559
303 Ga0501046_0019540 3300049580 Bacteria 5617
304 Ga0501046_0022692 3300049580 Bacteria 5169
305 Ga0501046_0121808 3300049580 Bacteria 1984
306 Ga0501047_0003250 3300049581 Bacteria 15415
307 Ga0501047_0003474 3300049581 Bacteria 14889
308 Ga0501047_0004850 3300049581 Bacteria 12636
309 Ga0501047_0150514 3300049581 Bacteria 2203
310 Ga0501048_0014302 3300049582 Bacteria 5877
311 Ga0501067_0002904 3300049583 Bacteria 9439
312 Ga0501068_0038052 3300049584 Bacteria 2880
313 Ga0501069_0005784 3300049585 Bacteria 6442
314 Ga0501070_0007491 3300049586 Bacteria 9273
315 Ga0501070_0012898 3300049586 Bacteria 7043
316 Ga0501070_0027451 3300049586 Bacteria 4775
317 Ga0501072_0001407 3300049588 Bacteria 18110
318 Ga0501073_0000954 3300049589 Bacteria 20809
319 Ga0501073_0040593 3300049589 Bacteria 3292
320 Ga0501074_0006699 3300049590 Bacteria 8312
321 Ga0501074_0016056 3300049590 Bacteria 5442
322 Ga0501074_0041701 3300049590 Bacteria 3322
323 Ga0501079_0104167 3300049741 Bacteria 2201
324 Ga0501080_0000256 3300049742 Bacteria 40148
325 Ga0501080_0008223 3300049742 Bacteria 9445
326 Ga0501080_0011116 3300049742 Bacteria 8238
327 Ga0501080_0042736 3300049742 Bacteria 4219
328 Ga0501083_0000332 3300049744 Bacteria 29936
329 Ga0501035_0023801 3300049822 Bacteria 5619
330 Ga0501035_0250011 3300049822 Bacteria 1506
331 Ga0501044_0004979 3300049823 Bacteria 14859
332 Ga0501044_0011093 3300049823 Bacteria 9773
333 Ga0501044_0079844 3300049823 Bacteria 3314
334 Ga0500568_0000810 3300053139 Bacteria 21989
335 Ga0500661_001787 3300055283 Bacteria 4053
336 Ga0501082_0024404 3300060353 Bacteria 5213
337 Ga0466962_0002138 3300061719 Bacteria 9331
338 Ga0466962_0030318 3300061719 Bacteria 2590
339 2687584402 2687453130 Bacteria 4227172
340 2739732530 2739367700 Bacteria 4747630
341 2884412612 2884411467 Bacteria 5246714
342 2928965247 2928963466 Bacteria 5165703
343 Ga0501047_0003228
344 JGI24739J22299_10000934
345 JGI24737J22298_10001994
346 JGI25156J39149_1000763
347 JGI25162J39368_1001140
348 JGI25162J39368_1001141
349 JGI25157J39369_1000133
350 JGI25157J39369_1000213
351 JGI25163J39215_1000210
352 JGI25164J39214_1000075
353 JGI25165J46597_1000178
354 rootH2_10038156
355 Ga0006562J51391_1017132
356 Ga0006562J51391_1017134
357 Ga0055538_1000590
358 Ga0055539_1001313
359 Ga0055533_1002821
360 Ga0055535_1000350
361 Ga0055542_1001122
362 Ga0055542_1001123
363 Ga0055529_1000153
364 Ga0065165_1001387
365 Ga0070658_10006615
366 Ga0070683_100129403
367 Ga0070670_100053841
368 Ga0068869_100094370
369 Ga0068869_100128166
370 Ga0070666_10000022
371 Ga0070666_10000888
372 Ga0070660_100039046
373 Ga0070661_100009609
374 Ga0070668_100086305
375 Ga0070668_100092293
376 Ga0070667_100000065
377 Ga0070667_100085755
378 Ga0070667_100088757
379 Ga0070663_100007231
380 Ga0070663_100047659
381 Ga0070678_100050411
382 Ga0070662_100017832
383 Ga0070681_10000231
384 Ga0068867_100078815
385 Ga0070685_10000983
386 Ga0068853_100039209
387 Ga0068853_100162615
388 Ga0070672_100099333
389 Ga0070665_100033222
390 Ga0070665_100048673
391 Ga0068855_100071441
392 Ga0068855_100075719
393 Ga0068855_100231198
394 Ga0068857_100000919
395 Ga0068854_100006938
396 Ga0068854_100026946
397 Ga0068856_100056920
398 Ga0068852_100026399
399 Ga0068852_100031616
400 Ga0068852_100080465
401 Ga0068864_100020921
402 Ga0068851_10000956
403 Ga0068851_10028940
404 Ga0068851_10050168
405 Ga0068858_100000817
406 Ga0068858_100126832
407 Ga0068860_100004354
408 Ga0068860_100198712
409 Ga0068862_100112315
410 Ga0068862_100122128
411 Ga0097621_100049596
412 Ga0068871_100035397
413 Ga0068871_100077728
414 Ga0068871_100082680
415 Ga0068865_100001698
416 Ga0068865_100071000
417 Ga0105240_10000239
418 Ga0105240_10007228
419 Ga0105240_10007369
420 Ga0105240_10094045
421 Ga0105240_10198219
422 Ga0105245_10009341
423 Ga0105242_10006944
424 Ga0105237_10000011
425 Ga0105237_10138689
426 Ga0105238_10000760
427 Ga0105238_10001027
428 Ga0105238_10045967
429 Ga0105239_10000027
430 Ga0105239_10037721
431 Ga0105239_10063635
432 Ga0105239_10065237
433 Ga0105239_10082540
434 Ga0105239_10116614
435 Ga0105239_10387915
436 Ga0105246_10012981
437 Ga0157314_1000213
438 Ga0157370_10034228
439 Ga0157370_10061807
440 Ga0157369_10000001
441 Ga0157369_10031193
442 Ga0157369_10187921
443 Ga0163162_10000017
444 Ga0163162_10000132
445 Ga0163162_10078605
446 Ga0157372_10002763
447 Ga0157372_10110438
448 Ga0157375_10041790
449 Ga0157375_10087389
450 Ga0163163_10103571
451 Ga0157379_10000606
452 Ga0157376_10063779
453 Ga0157376_10068440
454 Ga0157376_10271986
455 Ga0183369_1018
456 Ga0183368_1003
457 Ga0209435_101138
458 Ga0209760_100466
459 Ga0209784_100104
460 Ga0209566_101798
461 Ga0209674_100012
462 Ga0209672_100765
463 Ga0207427_100070
464 Ga0207427_101323
465 Ga0209437_100059
466 Ga0209437_100214
467 Ga0209258_100027
468 Ga0209258_100383
469 Ga0209258_105570
470 Ga0209646_1001180
471 Ga0209026_1000176
472 Ga0209026_1002879
473 Ga0209148_1000001
474 Ga0209148_1000002
475 Ga0209759_1000333
476 Ga0209759_1003384
477 Ga0209129_1001293
478 Ga0209233_1000002
479 Ga0209455_1000019
480 Ga0209455_1010270
481 Ga0209758_1000791
482 Ga0209758_1038693
483 Ga0209051_1006843
484 Ga0207656_10036424
485 Ga0207680_10000001
486 Ga0207680_10000079
487 Ga0207680_10003931
488 Ga0207680_10020019
489 Ga0207680_10077782
490 Ga0207647_10000262
491 Ga0207647_10016792
492 Ga0207645_10022090
493 Ga0207643_10016629
494 Ga0207705_10001121
495 Ga0207654_10000719
496 Ga0207654_10053506
497 Ga0207654_10104373
498 Ga0207707_10000075
499 Ga0207695_10000082
500 Ga0207695_10001405
501 Ga0207695_10002529
502 Ga0207695_10005890
503 Ga0207695_10009237
504 Ga0207695_10011712
505 Ga0207695_10067433
506 Ga0207671_10000011
507 Ga0207671_10009449
508 Ga0207657_10001571
509 Ga0207649_10028538
510 Ga0207649_10117493
511 Ga0207694_10000200
512 Ga0207694_10000412
513 Ga0207694_10001428
514 Ga0207694_10020266
515 Ga0207650_10010026
516 Ga0207706_10006038
517 Ga0207706_10239299
518 Ga0207686_10013879
519 Ga0207686_10037827
520 Ga0207670_10001106
521 Ga0207669_10151794
522 Ga0207704_10029040
523 Ga0207691_10013922
524 Ga0207691_10031936
525 Ga0207689_10071678
526 Ga0207689_10122590
527 Ga0207667_10049716
528 Ga0207667_10050016
529 Ga0207667_10072922
530 Ga0207712_10000395
531 Ga0207640_10004782
532 Ga0207640_10006824
533 Ga0207640_10022980
534 Ga0207703_10113168
535 Ga0207703_10115925
536 Ga0207639_10057788
537 Ga0207639_10153703
538 Ga0207678_10013058
539 Ga0207678_10068921
540 Ga0207678_10088850
541 Ga0207702_10050940
542 Ga0207648_10009137
543 Ga0207676_10004524
544 Ga0207674_10000146
545 Ga0207674_10002886
546 Ga0207674_10206132
547 Ga0207683_10034554
548 Ga0207698_10022876
549 Ga0207698_10038515
550 Ga0268266_10000008
551 Ga0268266_10000075
552 Ga0268264_10008995
553 Ga0268264_10034111
554 Ga0268264_10048041
555 Ga0268264_10102625
556 Ga0307508_10012885
557 Ga0307510_10016108
558 Ga0395899_0018037
559 Ga0395899_0066580
560 Ga0395900_0020257
561 Ga0395900_0077137
562 Ga0395898_0101967
563 Ga0395898_0102690
564 Ga0395901_0045194
565 Ga0395901_0073303
566 Ga0395901_0074450
567 Ga0395901_0100132
568 Ga0436365_1115483
569 Ga0451793_0513347
570 Ga0466969_0014103
571 Ga0466969_0023134
572 Ga0466972_0000578
573 Ga0466982_0000012
574 Ga0466965_0001344
575 Ga0466966_0013949
576 Ga0466961_0019003
577 Ga0466961_0040875
578 Ga0466964_0013919
579 Ga0466971_0002418
580 Ga0466970_0000012
581 Ga0466959_0019425
582 Ga0466959_0031054
583 Ga0495638_0000019
584 Ga0495638_0000164
585 Ga0495638_0003036
586 Ga0495650_0000338
587 Ga0495650_0000498
588 Ga0495606_0001115
589 Ga0495597_0036615
590 Ga0495622_0028616
591 Ga0495625_0015407
592 Ga0496100_0138627
593 Ga0496101_0074591
594 Ga0496101_0087082
595 Ga0496104_0000012
596 Ga0496105_0000032
597 Ga0496105_0001031
598 Ga0496105_0132196
599 Ga0496106_0040738
600 Ga0496107_0055126
601 Ga0496113_0010938
602 Ga0496114_0207636
603 Ga0496115_0000060
604 Ga0496115_0000238
605 Ga0496115_0001908
606 Ga0496115_0008327
607 Ga0496115_0121943
608 Ga0496117_0008257
609 Ga0496117_0013518
610 Ga0496118_0002643
611 Ga0496118_0002869
612 Ga0496118_0006327
613 Ga0496118_0012479
614 Ga0496118_0078140
615 Ga0496119_0000322
616 Ga0496120_0000143
617 Ga0496120_0000665
618 Ga0496121_0000938
619 Ga0496121_0016791
620 Ga0496121_0035013
621 Ga0496121_0067821
622 Ga0496121_0074826
623 Ga0496123_0030787
624 Ga0496124_0005234
625 Ga0496125_0000469
626 Ga0496125_0027756
627 Ga0496126_0000253
628 Ga0496126_0001473
629 Ga0496126_0007637
630 Ga0496126_0020315
631 Ga0496126_0046366
632 Ga0495682_0010674
633 Ga0501031_0003742
634 Ga0501031_0026823
635 Ga0501032_0017448
636 Ga0501033_0002131
637 Ga0501033_0004203
638 Ga0501034_0004129
639 Ga0501034_0010416
640 Ga0501034_0029591
641 Ga0501036_0134550
642 Ga0501038_0065215
643 Ga0501039_0162039
644 Ga0501043_0026366
645 Ga0501046_0019540
646 Ga0501046_0022692
647 Ga0501046_0121808
648 Ga0501047_0003250
649 Ga0501047_0003474
650 Ga0501047_0004850
651 Ga0501047_0150514
652 Ga0501048_0014302
653 Ga0501067_0002904
654 Ga0501068_0038052
655 Ga0501069_0005784
656 Ga0501070_0007491
657 Ga0501070_0012898
658 Ga0501070_0027451
659 Ga0501072_0001407
660 Ga0501073_0000954
661 Ga0501073_0040593
662 Ga0501074_0006699
663 Ga0501074_0016056
664 Ga0501074_0041701
665 Ga0501079_0104167
666 Ga0501080_0000256
667 Ga0501080_0008223
668 Ga0501080_0011116
669 Ga0501080_0042736
670 Ga0501083_0000332
671 Ga0501035_0023801
672 Ga0501035_0250011
673 Ga0501044_0004979
674 Ga0501044_0011093
675 Ga0501044_0079844
676 Ga0500568_0000810
677 Ga0500661_001787
678 Ga0501082_0024404
679 Ga0466962_0002138
680 Ga0466962_0030318
681 2687584402
682 2739732530
683 2884412612
684 2928965247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08245

Mur_ligase_M

Mur ligase middle domain

111

295

0.92

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

317

441

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qf5-assembly2.cif.gz_B crystal structure i of murf from acinetobacter baumannii 0.9508 27 374
8f5d-assembly1.cif.gz_A architecture of the mure-murf ligase bacterial cell wall biosynthesis complex 0.9485 28 239
4ziy-assembly1.cif.gz_A structure of udp-n-acetylmuramoylalanyl-d-glutamyl-2,6-diaminopimelate--d-alanyl-d-alanyl ligase from acinetobacter baumannii 0.9018 22 374
3zl8-assembly1.cif.gz_A crystal structure of murf ligase from thermotoga maritima in complex with adp 0.8888 28 374
4qdi-assembly1.cif.gz_A crystal structure ii of murf from acinetobacter baumannii 0.8706 26 374
ID Description Score Start End Superfamily
af_Q2FWH4_316_452_3.90.190.20 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9584 241 372 3.90.190.20
4cvlA03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.957 239 372 3.90.190.20
4ziyA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9536 22 238 3.40.1190.10
af_Q2FWH4_87_313_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9533 24 238 3.40.1190.10
af_P9WJL1_108_337_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9479 21 235 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A7V0JWJ9-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 0.9795 28 138 GO:0005524
GO:0009058
GO:0016881
AF-A0A1F8VD38-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase (EC 6.3.2.10) (D-alanyl-D-alanine-adding enzyme) 0.9789 28 372 GO:0005524
GO:0005737
GO:0008360
GO:0008766
GO:0009252
GO:0047480
GO:0051301
GO:0071555
AF-A0A7C0Y0A6-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 0.9778 28 158 GO:0005524
GO:0009058
GO:0016881
AF-A0A497A519-F1-model_v4 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 0.977 27 152 GO:0005524
GO:0009058
GO:0016881
AF-A0A258Y4V1-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9766 28 109 GO:0005524
GO:0009058
GO:0016881

Map