F415405
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 246 | 686 | 423 |
Family's Representative Sequence
| Representative Sequence | 3300003771|Ga0055526_1013996|Ga0055526_10139962 |
| Length | 439 |
| Sequence | MSGHSTYEPKTGFERWLDARLPIVRLGYDSFVDYPTPRNLNYWWTFGGILSLCLASQLITGIILVMHYTPSADHAFASVEHIMRDVNYGWLIRYMHANGASMFFIAVYIHMLRGLYYGSYKAPREVLWLLGCVIYLLMMATAFMGYVLPWGQMSFHGAVVITNLFGALPLVGESITTWLWGGFAVDNPTLNRFFSLHYLLPFMIAGVVILHIWALHVVGQNNPTGVEPKSKADTVPFTPYATVKDGFAMSVFLILFAWFVFFMPNALGHADNYIPANPLVTPSHIVPEWYFLPFYAILRAVPDKLMGVLAMFGAIACLFALPWLDTSKVRSMRYRPTAKIHFFIFVVACCILGVCGAKLPDDQVIPHLTTFQLMASDLNSFVWLSRVAALYYFAFFLVILPVLGLTEKTLPVPDSIASPALSHPAAAPAEATAAPEMKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 2 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 20 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 21 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 22 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 26 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 27 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 28 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 29 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 30 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 31 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 101 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 104 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 106 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 116 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 117 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 118 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 167 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 168 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 169 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 170 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 171 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 172 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 180 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 181 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 182 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 183 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 184 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 186 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 187 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 188 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 189 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 190 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 191 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 192 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 193 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 194 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 195 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 196 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 197 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 198 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 199 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 200 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 201 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 202 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 203 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 204 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 205 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 206 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 207 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 208 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 209 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 213 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 214 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 215 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 216 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 217 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 218 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 219 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 220 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 221 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 222 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 223 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 224 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 225 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 226 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 227 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 228 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 229 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 230 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 231 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 232 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 233 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 234 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 235 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 236 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 237 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 238 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 239 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 240 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 241 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 242 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 243 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 244 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 245 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 246 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.13 |
| Metatranscriptomes | 4.66 |
| Isolates | 10.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.16 |
| Nodule | 0.58 |
| Rhizoplane | 2.04 |
| Rhizosphere | 63.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1013996 | 3300003771 | Bacteria | 3341 |
| 2 | Ga0006777J48905_1081508 | 3300003308 | Eukaryota | 1601 |
| 3 | Ga0006562J51391_1028761 | 3300003578 | Bacteria | 2490 |
| 4 | Ga0055526_1000150 | 3300003771 | Bacteria | 61554 |
| 5 | Ga0055526_1000671 | 3300003771 | Bacteria | 26208 |
| 6 | Ga0055524_1000068 | 3300003775 | Bacteria | 130413 |
| 7 | Ga0055528_1006412 | 3300003790 | Bacteria | 5338 |
| 8 | Ga0058861_11935250 | 3300004800 | Eukaryota | 1584 |
| 9 | Ga0058862_10011350 | 3300004803 | Unclassified | 4665 |
| 10 | Ga0065165_1001609 | 3300005262 | Bacteria | 23073 |
| 11 | Ga0070670_100000032 | 3300005331 | Bacteria | 158514 |
| 12 | Ga0070680_100028667 | 3300005336 | Bacteria | 4467 |
| 13 | Ga0070660_100016351 | 3300005339 | Bacteria | 5384 |
| 14 | Ga0070668_100000975 | 3300005347 | Bacteria | 20042 |
| 15 | Ga0070668_100014972 | 3300005347 | Bacteria | 5795 |
| 16 | Ga0070668_100031168 | 3300005347 | Bacteria | 4056 |
| 17 | Ga0070671_100059353 | 3300005355 | Bacteria | 3183 |
| 18 | Ga0070667_100000110 | 3300005367 | Bacteria | 105201 |
| 19 | Ga0070667_100024229 | 3300005367 | Bacteria | 5041 |
| 20 | Ga0070681_10020584 | 3300005458 | Bacteria | 6611 |
| 21 | Ga0070698_100008566 | 3300005471 | Bacteria | 11036 |
| 22 | Ga0070679_100138407 | 3300005530 | Bacteria | 2415 |
| 23 | Ga0070684_100025106 | 3300005535 | Bacteria | 5005 |
| 24 | Ga0068864_100000184 | 3300005618 | Bacteria | 57553 |
| 25 | Ga0068864_100000321 | 3300005618 | Bacteria | 42230 |
| 26 | Ga0068863_100000037 | 3300005841 | Bacteria | 162638 |
| 27 | Ga0068863_100001377 | 3300005841 | Bacteria | 24126 |
| 28 | Ga0068863_100004617 | 3300005841 | Bacteria | 13569 |
| 29 | Ga0068858_100000029 | 3300005842 | Bacteria | 144691 |
| 30 | Ga0068858_100006036 | 3300005842 | Bacteria | 11808 |
| 31 | Ga0068858_100018099 | 3300005842 | Bacteria | 6599 |
| 32 | Ga0068858_100179631 | 3300005842 | Bacteria | 1998 |
| 33 | Ga0068860_100000100 | 3300005843 | Bacteria | 144580 |
| 34 | Ga0068860_100000167 | 3300005843 | Bacteria | 108234 |
| 35 | Ga0068860_100005700 | 3300005843 | Bacteria | 12574 |
| 36 | Ga0068860_100111872 | 3300005843 | Bacteria | 2611 |
| 37 | Ga0068862_100008644 | 3300005844 | Bacteria | 8423 |
| 38 | Ga0068862_100054175 | 3300005844 | Bacteria | 3434 |
| 39 | Ga0081455_10019019 | 3300005937 | Bacteria | 6514 |
| 40 | Ga0075368_10001626 | 3300006042 | Bacteria | 7216 |
| 41 | Ga0075363_100004231 | 3300006048 | Bacteria | 6237 |
| 42 | Ga0075364_10001989 | 3300006051 | Bacteria | 11387 |
| 43 | Ga0075362_10012061 | 3300006177 | Bacteria | 3421 |
| 44 | Ga0075367_10004580 | 3300006178 | Bacteria | 6767 |
| 45 | Ga0075369_10002683 | 3300006186 | Bacteria | 6377 |
| 46 | Ga0075369_10014928 | 3300006186 | Bacteria | 3110 |
| 47 | Ga0075369_10027985 | 3300006186 | Bacteria | 2360 |
| 48 | Ga0075366_10048926 | 3300006195 | Bacteria | 2508 |
| 49 | Ga0097621_100162131 | 3300006237 | Bacteria | 1922 |
| 50 | Ga0068871_100055355 | 3300006358 | Bacteria | 3220 |
| 51 | Ga0068865_100030073 | 3300006881 | Bacteria | 3609 |
| 52 | Ga0105250_10006833 | 3300009092 | Bacteria | 4954 |
| 53 | Ga0105240_10099154 | 3300009093 | Bacteria | 3546 |
| 54 | Ga0105242_10188899 | 3300009176 | Bacteria | 1822 |
| 55 | Ga0105248_10024868 | 3300009177 | Bacteria | 6656 |
| 56 | Ga0105248_10099751 | 3300009177 | Bacteria | 3272 |
| 57 | Ga0105237_10063059 | 3300009545 | Bacteria | 3704 |
| 58 | Ga0105237_10212016 | 3300009545 | Bacteria | 1937 |
| 59 | Ga0105249_10110912 | 3300009553 | Bacteria | 2593 |
| 60 | Ga0157369_10033563 | 3300013105 | Bacteria | 5639 |
| 61 | Ga0171462_1006 | 3300013250 | Bacteria | 432986 |
| 62 | Ga0157374_10251396 | 3300013296 | Bacteria | 1740 |
| 63 | Ga0157375_10271393 | 3300013308 | Bacteria | 1858 |
| 64 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 65 | Ga0157380_10281972 | 3300014326 | Bacteria | 1521 |
| 66 | Ga0157377_10185471 | 3300014745 | Bacteria | 1311 |
| 67 | Ga0157379_10002605 | 3300014968 | Bacteria | 15162 |
| 68 | Ga0157379_10016863 | 3300014968 | Bacteria | 6429 |
| 69 | Ga0182007_10021788 | 3300015262 | Bacteria | 2270 |
| 70 | Ga0163161_10027011 | 3300017792 | Bacteria | 4071 |
| 71 | Ga0197907_11206118 | 3300020069 | Eukaryota | 1629 |
| 72 | Ga0206356_10481053 | 3300020070 | Eukaryota | 2200 |
| 73 | Ga0206349_1636510 | 3300020075 | Eukaryota | 9124 |
| 74 | Ga0206351_10585159 | 3300020077 | Eukaryota | 3638 |
| 75 | Ga0206351_10965601 | 3300020077 | Eukaryota | 4192 |
| 76 | Ga0206350_10665434 | 3300020080 | Unclassified | 7523 |
| 77 | Ga0206354_10629149 | 3300020081 | Eukaryota | 1281 |
| 78 | Ga0213872_10034229 | 3300021361 | Bacteria | 2326 |
| 79 | Ga0224712_10001644 | 3300022467 | Eukaryota | 5260 |
| 80 | Ga0224712_10008092 | 3300022467 | Unclassified | 3094 |
| 81 | Ga0209148_1005799 | 3300025254 | Bacteria | 2763 |
| 82 | Ga0209233_1016404 | 3300025261 | Bacteria | 2041 |
| 83 | Ga0209565_1000384 | 3300025263 | Bacteria | 37478 |
| 84 | Ga0209673_1000956 | 3300025273 | Bacteria | 36077 |
| 85 | Ga0209675_1000518 | 3300025291 | Bacteria | 28467 |
| 86 | Ga0209675_1011558 | 3300025291 | Bacteria | 2920 |
| 87 | Ga0209676_1000467 | 3300025292 | Bacteria | 67659 |
| 88 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 89 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 90 | Ga0209564_1000041 | 3300025295 | Bacteria | 405199 |
| 91 | Ga0209564_1006954 | 3300025295 | Bacteria | 5943 |
| 92 | Ga0209758_1006870 | 3300025297 | Bacteria | 7953 |
| 93 | Ga0209050_1000461 | 3300025298 | Bacteria | 72912 |
| 94 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 95 | Ga0209256_1001342 | 3300025299 | Bacteria | 26115 |
| 96 | Ga0209051_1009229 | 3300025303 | Bacteria | 5104 |
| 97 | Ga0207713_1047813 | 3300025735 | Bacteria | 1728 |
| 98 | Ga0207710_10037608 | 3300025900 | Bacteria | 2138 |
| 99 | Ga0207680_10043668 | 3300025903 | Bacteria | 2630 |
| 100 | Ga0207705_10000970 | 3300025909 | Bacteria | 23483 |
| 101 | Ga0207707_10037873 | 3300025912 | Bacteria | 4213 |
| 102 | Ga0207695_10011375 | 3300025913 | Bacteria | 10785 |
| 103 | Ga0207695_10147019 | 3300025913 | Bacteria | 2300 |
| 104 | Ga0207660_10015133 | 3300025917 | Bacteria | 5087 |
| 105 | Ga0207657_10070812 | 3300025919 | Bacteria | 2954 |
| 106 | Ga0207652_10004285 | 3300025921 | Bacteria | 11637 |
| 107 | Ga0207646_10147420 | 3300025922 | Bacteria | 2121 |
| 108 | Ga0207650_10000074 | 3300025925 | Bacteria | 134837 |
| 109 | Ga0207644_10041388 | 3300025931 | Bacteria | 3259 |
| 110 | Ga0207690_10006522 | 3300025932 | Bacteria | 6918 |
| 111 | Ga0207690_10148896 | 3300025932 | Bacteria | 1733 |
| 112 | Ga0207704_10008398 | 3300025938 | Bacteria | 4937 |
| 113 | Ga0207711_10007049 | 3300025941 | Bacteria | 9418 |
| 114 | Ga0207711_10103543 | 3300025941 | Bacteria | 2521 |
| 115 | Ga0207711_10184327 | 3300025941 | Bacteria | 1899 |
| 116 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 117 | Ga0207668_10000246 | 3300025972 | Bacteria | 36387 |
| 118 | Ga0207668_10018118 | 3300025972 | Bacteria | 4424 |
| 119 | Ga0207668_10026970 | 3300025972 | Bacteria | 3737 |
| 120 | Ga0207668_10031422 | 3300025972 | Bacteria | 3497 |
| 121 | Ga0207658_10000275 | 3300025986 | Bacteria | 53906 |
| 122 | Ga0207641_10000034 | 3300026088 | Bacteria | 217752 |
| 123 | Ga0207641_10001197 | 3300026088 | Bacteria | 26009 |
| 124 | Ga0207641_10001917 | 3300026088 | Bacteria | 19953 |
| 125 | Ga0207648_10047240 | 3300026089 | Bacteria | 3774 |
| 126 | Ga0207676_10000202 | 3300026095 | Bacteria | 51825 |
| 127 | Ga0207676_10001101 | 3300026095 | Bacteria | 20425 |
| 128 | Ga0207675_100017209 | 3300026118 | Bacteria | 6751 |
| 129 | Ga0207683_10057586 | 3300026121 | Bacteria | 3411 |
| 130 | Ga0209813_10003607 | 3300027866 | Bacteria | 3636 |
| 131 | Ga0268266_10000289 | 3300028379 | Bacteria | 82515 |
| 132 | Ga0268266_10038244 | 3300028379 | Bacteria | 4086 |
| 133 | Ga0268266_10050459 | 3300028379 | Bacteria | 3570 |
| 134 | Ga0268265_10000648 | 3300028380 | Bacteria | 34549 |
| 135 | Ga0268265_10002515 | 3300028380 | Bacteria | 13726 |
| 136 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 137 | Ga0268264_10000068 | 3300028381 | Bacteria | 275708 |
| 138 | Ga0268264_10057511 | 3300028381 | Bacteria | 3253 |
| 139 | Ga0268264_10057931 | 3300028381 | Bacteria | 3242 |
| 140 | Ga0268264_10095551 | 3300028381 | Bacteria | 2572 |
| 141 | Ga0268264_10135395 | 3300028381 | Bacteria | 2189 |
| 142 | Ga0265337_1003068 | 3300028556 | Bacteria | 7372 |
| 143 | Ga0307515_10012598 | 3300028794 | Bacteria | 15891 |
| 144 | Ga0307515_10017065 | 3300028794 | Bacteria | 13254 |
| 145 | Ga0265338_10024225 | 3300028800 | Bacteria | 6207 |
| 146 | Ga0265328_10000028 | 3300031239 | Bacteria | 112296 |
| 147 | Ga0265328_10000155 | 3300031239 | Bacteria | 32139 |
| 148 | Ga0265328_10007852 | 3300031239 | Bacteria | 4432 |
| 149 | Ga0265329_10005561 | 3300031242 | Bacteria | 5081 |
| 150 | Ga0265331_10000437 | 3300031250 | Bacteria | 40997 |
| 151 | Ga0265331_10001502 | 3300031250 | Bacteria | 17215 |
| 152 | Ga0265327_10001631 | 3300031251 | Bacteria | 27036 |
| 153 | Ga0265327_10003877 | 3300031251 | Bacteria | 13777 |
| 154 | Ga0265327_10051285 | 3300031251 | Bacteria | 2154 |
| 155 | Ga0265327_10061995 | 3300031251 | Bacteria | 1905 |
| 156 | Ga0265316_10001118 | 3300031344 | Bacteria | 29088 |
| 157 | Ga0265316_10092150 | 3300031344 | Bacteria | 2310 |
| 158 | Ga0307513_10000045 | 3300031456 | Bacteria | 158626 |
| 159 | Ga0265342_10069915 | 3300031712 | Bacteria | 2049 |
| 160 | Ga0307413_10012170 | 3300031824 | Bacteria | 4271 |
| 161 | Ga0373927_0000479 | 3300035695 | Bacteria | 30749 |
| 162 | Ga0373925_0005838 | 3300037068 | Bacteria | 9133 |
| 163 | Ga0395899_0004713 | 3300037312 | Bacteria | 10637 |
| 164 | Ga0395899_0021296 | 3300037312 | Bacteria | 4918 |
| 165 | Ga0395900_0001901 | 3300037418 | Bacteria | 23770 |
| 166 | Ga0395900_0100671 | 3300037418 | Bacteria | 2968 |
| 167 | Ga0395900_0143932 | 3300037418 | Bacteria | 2439 |
| 168 | Ga0395898_0002582 | 3300037466 | Bacteria | 21175 |
| 169 | Ga0395905_0000291 | 3300037471 | Unclassified | 73478 |
| 170 | Ga0395905_0008664 | 3300037471 | Unclassified | 10021 |
| 171 | Ga0395905_0075758 | 3300037471 | Bacteria | 3153 |
| 172 | Ga0395901_0000870 | 3300038443 | Unclassified | 33324 |
| 173 | Ga0395901_0006258 | 3300038443 | Bacteria | 12063 |
| 174 | Ga0395901_0083653 | 3300038443 | Eukaryota | 3336 |
| 175 | Ga0400483_018872 | 3300039062 | Bacteria | 11395 |
| 176 | Ga0400483_277960 | 3300039062 | Bacteria | 10935 |
| 177 | Ga0436365_0635493 | 3300039437 | Bacteria | 3062 |
| 178 | Ga0436365_1347305 | 3300039437 | Bacteria | 1977 |
| 179 | Ga0436360_0292789 | 3300039438 | Bacteria | 4190 |
| 180 | Ga0436360_0442682 | 3300039438 | Bacteria | 3371 |
| 181 | Ga0436361_0394147 | 3300039447 | Bacteria | 7521 |
| 182 | Ga0436361_0672503 | 3300039447 | Bacteria | 2975 |
| 183 | Ga0466967_0115764 | 3300045976 | Bacteria | 2469 |
| 184 | Ga0495627_008977 | 3300046453 | Bacteria | 3697 |
| 185 | Ga0495603_0035040 | 3300046455 | Eukaryota | 3016 |
| 186 | Ga0495590_0001741 | 3300046457 | Bacteria | 9231 |
| 187 | Ga0495629_0026670 | 3300046459 | Bacteria | 4104 |
| 188 | Ga0495638_0000588 | 3300046460 | Bacteria | 41034 |
| 189 | Ga0495638_0004112 | 3300046460 | Bacteria | 11128 |
| 190 | Ga0495638_0009677 | 3300046460 | Bacteria | 6739 |
| 191 | Ga0495641_0017974 | 3300046461 | Eukaryota | 3662 |
| 192 | Ga0495650_0000114 | 3300046471 | Bacteria | 192527 |
| 193 | Ga0495605_0000966 | 3300046474 | Eukaryota | 19541 |
| 194 | Ga0495584_0000878 | 3300046491 | Eukaryota | 19407 |
| 195 | Ga0495585_0003129 | 3300046492 | Eukaryota | 11347 |
| 196 | Ga0495585_0051526 | 3300046492 | Bacteria | 2281 |
| 197 | Ga0495607_0010068 | 3300046501 | Bacteria | 6367 |
| 198 | Ga0495583_0000013 | 3300046506 | Bacteria | 323372 |
| 199 | Ga0495606_0037933 | 3300046507 | Bacteria | 3267 |
| 200 | Ga0495616_0000053 | 3300046513 | Bacteria | 104389 |
| 201 | Ga0495628_0019068 | 3300046516 | Eukaryota | 5673 |
| 202 | Ga0495631_0007232 | 3300046518 | Eukaryota | 5659 |
| 203 | Ga0495632_0036021 | 3300046519 | Bacteria | 2519 |
| 204 | Ga0495648_0000372 | 3300046524 | Bacteria | 49423 |
| 205 | Ga0495654_0000082 | 3300046530 | Bacteria | 108599 |
| 206 | Ga0495587_0040432 | 3300046536 | Eukaryota | 2787 |
| 207 | Ga0495609_0008702 | 3300046538 | Bacteria | 4951 |
| 208 | Ga0495609_0012485 | 3300046538 | Bacteria | 4030 |
| 209 | Ga0495597_0018835 | 3300046542 | Bacteria | 3235 |
| 210 | Ga0495622_0005584 | 3300046557 | Bacteria | 5832 |
| 211 | Ga0495622_0009123 | 3300046557 | Bacteria | 4592 |
| 212 | Ga0495656_0000083 | 3300046615 | Eukaryota | 42115 |
| 213 | Ga0495668_0000342 | 3300046616 | Bacteria | 61973 |
| 214 | Ga0495668_0020755 | 3300046616 | Bacteria | 3775 |
| 215 | Ga0495611_0071767 | 3300046648 | Bacteria | 1583 |
| 216 | Ga0495625_0000290 | 3300046660 | Bacteria | 77650 |
| 217 | Ga0495625_0010575 | 3300046660 | Bacteria | 7620 |
| 218 | Ga0495669_0000329 | 3300046684 | Bacteria | 25520 |
| 219 | Ga0495613_0001323 | 3300046689 | Bacteria | 18949 |
| 220 | Ga0495624_0045482 | 3300046690 | Bacteria | 2794 |
| 221 | Ga0495670_0031372 | 3300046691 | Eukaryota | 2640 |
| 222 | Ga0495671_0012771 | 3300046692 | Eukaryota | 4574 |
| 223 | Ga0495649_0006696 | 3300046694 | Bacteria | 7147 |
| 224 | Ga0495589_0003699 | 3300046794 | Eukaryota | 8252 |
| 225 | Ga0495589_0017961 | 3300046794 | Bacteria | 3628 |
| 226 | Ga0495581_0001020 | 3300047315 | Eukaryota | 15142 |
| 227 | Ga0495672_0002135 | 3300047320 | Bacteria | 18531 |
| 228 | Ga0495672_0008929 | 3300047320 | Bacteria | 7320 |
| 229 | Ga0495676_0043322 | 3300047321 | Eukaryota | 3685 |
| 230 | Ga0495680_0022162 | 3300047322 | Bacteria | 5303 |
| 231 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 232 | Ga0495673_0003311 | 3300047469 | Eukaryota | 10680 |
| 233 | Ga0495673_0004316 | 3300047469 | Bacteria | 8951 |
| 234 | Ga0495681_0014181 | 3300047470 | Eukaryota | 4584 |
| 235 | Ga0495681_0050976 | 3300047470 | Bacteria | 1948 |
| 236 | Ga0495686_0006216 | 3300047472 | Bacteria | 9206 |
| 237 | Ga0495686_0006929 | 3300047472 | Bacteria | 8570 |
| 238 | Ga0495593_0024764 | 3300047673 | Bacteria | 3323 |
| 239 | Ga0496101_0171059 | 3300048904 | Bacteria | 1670 |
| 240 | Ga0496101_0174443 | 3300048904 | Bacteria | 1653 |
| 241 | Ga0496107_0000329 | 3300048910 | Bacteria | 25658 |
| 242 | Ga0496107_0150173 | 3300048910 | Bacteria | 1723 |
| 243 | Ga0496109_0136893 | 3300048912 | Bacteria | 2289 |
| 244 | Ga0496111_0152396 | 3300048914 | Bacteria | 1715 |
| 245 | Ga0496115_0002250 | 3300048918 | Bacteria | 13815 |
| 246 | Ga0496117_0012409 | 3300048920 | Bacteria | 7515 |
| 247 | Ga0496117_0075256 | 3300048920 | Bacteria | 2244 |
| 248 | Ga0496118_0005681 | 3300048921 | Bacteria | 14053 |
| 249 | Ga0496119_0015319 | 3300048922 | Bacteria | 5914 |
| 250 | Ga0496121_0001066 | 3300048924 | Bacteria | 48544 |
| 251 | Ga0496121_0001417 | 3300048924 | Bacteria | 40646 |
| 252 | Ga0496122_0017375 | 3300048925 | Bacteria | 6729 |
| 253 | Ga0496122_0051407 | 3300048925 | Bacteria | 3131 |
| 254 | Ga0496123_0029975 | 3300048926 | Bacteria | 3992 |
| 255 | Ga0496123_0052602 | 3300048926 | Bacteria | 2701 |
| 256 | Ga0496125_0016135 | 3300048928 | Bacteria | 7184 |
| 257 | Ga0496126_0026487 | 3300048929 | Bacteria | 5559 |
| 258 | Ga0495678_001396 | 3300049459 | Bacteria | 19168 |
| 259 | Ga0501047_0014685 | 3300049581 | Bacteria | 7452 |
| 260 | Ga0501257_000824 | 3300049686 | Bacteria | 6198 |
| 261 | Ga0501044_0197149 | 3300049823 | Bacteria | 1973 |
| 262 | nmdc:mga03n38_3147_c1 | 3300050490 | Bacteria | 5253 |
| 263 | nmdc:mga00v17_2988_c1 | 3300050491 | Bacteria | 8682 |
| 264 | nmdc:mga0k408_24012_c2 | 3300050493 | Bacteria | 3023 |
| 265 | nmdc:mga04h51_5853_c1 | 3300050495 | Bacteria | 3153 |
| 266 | nmdc:mga07m45_132262_c1 | 3300050496 | Bacteria | 1444 |
| 267 | nmdc:mga0sz30_17490_c1 | 3300050516 | Bacteria | 2860 |
| 268 | nmdc:mga0sz30_24502_c1 | 3300050516 | Bacteria | 2463 |
| 269 | Ga0500635_0000045 | 3300053080 | Bacteria | 87314 |
| 270 | Ga0500578_0000102 | 3300053086 | Bacteria | 99108 |
| 271 | Ga0500578_0100795 | 3300053086 | Bacteria | 1827 |
| 272 | Ga0500643_001892 | 3300053087 | Bacteria | 11378 |
| 273 | Ga0500644_0000287 | 3300053088 | Bacteria | 27540 |
| 274 | Ga0500644_0000533 | 3300053088 | Bacteria | 15780 |
| 275 | Ga0500583_0042763 | 3300053092 | Bacteria | 2066 |
| 276 | Ga0500641_0047784 | 3300053096 | Bacteria | 1751 |
| 277 | Ga0500556_0000558 | 3300053104 | Bacteria | 24866 |
| 278 | Ga0500562_000146 | 3300053108 | Bacteria | 20862 |
| 279 | Ga0500562_009046 | 3300053108 | Bacteria | 2517 |
| 280 | Ga0500569_003672 | 3300053109 | Bacteria | 3164 |
| 281 | Ga0500572_000189 | 3300053111 | Bacteria | 21822 |
| 282 | Ga0500594_0000123 | 3300053118 | Bacteria | 21627 |
| 283 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 284 | Ga0500595_000109 | 3300053119 | Bacteria | 55874 |
| 285 | Ga0500595_003186 | 3300053119 | Bacteria | 7763 |
| 286 | Ga0500595_005023 | 3300053119 | Bacteria | 5823 |
| 287 | Ga0500608_000187 | 3300053122 | Bacteria | 24884 |
| 288 | Ga0500618_000319 | 3300053125 | Bacteria | 35375 |
| 289 | Ga0500642_0039571 | 3300053130 | Bacteria | 2028 |
| 290 | Ga0500559_0000010 | 3300053136 | Bacteria | 165569 |
| 291 | Ga0500559_0000280 | 3300053136 | Bacteria | 39387 |
| 292 | Ga0500559_0002775 | 3300053136 | Bacteria | 8869 |
| 293 | Ga0500590_019652 | 3300053148 | Bacteria | 3501 |
| 294 | Ga0500604_0030440 | 3300053151 | Bacteria | 1579 |
| 295 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 296 | Ga0500622_0000611 | 3300053156 | Bacteria | 32433 |
| 297 | Ga0500622_0015009 | 3300053156 | Bacteria | 4154 |
| 298 | Ga0500622_0016204 | 3300053156 | Bacteria | 3984 |
| 299 | Ga0500622_0061874 | 3300053156 | Bacteria | 1907 |
| 300 | Ga0500636_0007042 | 3300053177 | Bacteria | 6485 |
| 301 | Ga0500636_0015065 | 3300053177 | Bacteria | 4552 |
| 302 | Ga0500636_0060966 | 3300053177 | Bacteria | 2202 |
| 303 | Ga0500637_0038226 | 3300053178 | Bacteria | 2702 |
| 304 | Ga0500645_000156 | 3300053730 | Bacteria | 53110 |
| 305 | Ga0500596_001528 | 3300053735 | Bacteria | 4685 |
| 306 | Ga0587084_000108 | 3300059477 | Eukaryota | 4549 |
| 307 | Ga0587073_0002444 | 3300059492 | Eukaryota | 2379 |
| 308 | Ga0587069_001182 | 3300059642 | Bacteria | 2312 |
| 309 | 2511121726 | 2510917020 | Bacteria | 5657507 |
| 310 | 2585148987 | 2582581279 | Bacteria | 4980720 |
| 311 | 2585151607 | 2582581280 | Bacteria | 5994497 |
| 312 | 2585195519 | 2582581293 | Bacteria | 5907401 |
| 313 | 2587915357 | 2585428106 | Bacteria | 5179711 |
| 314 | 2643749233 | 2643221545 | Bacteria | 5083237 |
| 315 | 2643781352 | 2643221552 | Bacteria | 5708754 |
| 316 | 2643922932 | 2643221583 | Bacteria | 5218014 |
| 317 | 2643927067 | 2643221584 | Bacteria | 5511711 |
| 318 | 2643998403 | 2643221598 | Bacteria | 4578346 |
| 319 | 2644086732 | 2643221614 | Bacteria | 4260023 |
| 320 | 2644223912 | 2643221640 | Bacteria | 5258820 |
| 321 | 2644232898 | 2643221642 | Bacteria | 5357871 |
| 322 | 2644341686 | 2643221661 | Bacteria | 4267604 |
| 323 | 2644367973 | 2643221666 | Bacteria | 4265935 |
| 324 | 2644508992 | 2643221691 | Bacteria | 5093099 |
| 325 | 2644731756 | 2643221733 | Bacteria | 5690728 |
| 326 | 2644736703 | 2643221734 | Bacteria | 5365412 |
| 327 | 2774873914 | 2773857925 | Bacteria | 6472445 |
| 328 | 2792462918 | 2791355048 | Bacteria | 5832535 |
| 329 | 2819536335 | 2818991435 | Bacteria | 5433759 |
| 330 | 2819644590 | 2818991454 | Bacteria | 5563326 |
| 331 | 2819719263 | 2818991467 | Bacteria | 5893227 |
| 332 | 2841915831 | 2841911363 | Bacteria | 6173697 |
| 333 | 2841921789 | 2841917233 | Bacteria | 6173500 |
| 334 | 2843746465 | 2843744320 | Bacteria | 5659202 |
| 335 | 2849561820 | 2849560528 | Bacteria | 5393480 |
| 336 | 2849574114 | 2849573788 | Bacteria | 5421256 |
| 337 | 2851157795 | 2851153111 | Bacteria | 5542585 |
| 338 | 2857508041 | 2857504554 | Bacteria | 5369913 |
| 339 | 2884963133 | 2884960567 | Bacteria | 5437054 |
| 340 | 2891091380 | 2891088606 | Bacteria | 4762464 |
| 341 | 2898332561 | 2898329390 | Bacteria | 5168154 |
| 342 | 2917704475 | 2917699015 | Bacteria | 7043791 |
| 343 | 2928534803 | 2928531327 | Bacteria | 5101314 |
| 344 | Ga0055526_1013996 | |||
| 345 | Ga0006777J48905_1081508 | |||
| 346 | Ga0006562J51391_1028761 | |||
| 347 | Ga0055526_1000150 | |||
| 348 | Ga0055526_1000671 | |||
| 349 | Ga0055524_1000068 | |||
| 350 | Ga0055528_1006412 | |||
| 351 | Ga0058861_11935250 | |||
| 352 | Ga0058862_10011350 | |||
| 353 | Ga0065165_1001609 | |||
| 354 | Ga0070670_100000032 | |||
| 355 | Ga0070680_100028667 | |||
| 356 | Ga0070660_100016351 | |||
| 357 | Ga0070668_100000975 | |||
| 358 | Ga0070668_100014972 | |||
| 359 | Ga0070668_100031168 | |||
| 360 | Ga0070671_100059353 | |||
| 361 | Ga0070667_100000110 | |||
| 362 | Ga0070667_100024229 | |||
| 363 | Ga0070681_10020584 | |||
| 364 | Ga0070698_100008566 | |||
| 365 | Ga0070679_100138407 | |||
| 366 | Ga0070684_100025106 | |||
| 367 | Ga0068864_100000184 | |||
| 368 | Ga0068864_100000321 | |||
| 369 | Ga0068863_100000037 | |||
| 370 | Ga0068863_100001377 | |||
| 371 | Ga0068863_100004617 | |||
| 372 | Ga0068858_100000029 | |||
| 373 | Ga0068858_100006036 | |||
| 374 | Ga0068858_100018099 | |||
| 375 | Ga0068858_100179631 | |||
| 376 | Ga0068860_100000100 | |||
| 377 | Ga0068860_100000167 | |||
| 378 | Ga0068860_100005700 | |||
| 379 | Ga0068860_100111872 | |||
| 380 | Ga0068862_100008644 | |||
| 381 | Ga0068862_100054175 | |||
| 382 | Ga0081455_10019019 | |||
| 383 | Ga0075368_10001626 | |||
| 384 | Ga0075363_100004231 | |||
| 385 | Ga0075364_10001989 | |||
| 386 | Ga0075362_10012061 | |||
| 387 | Ga0075367_10004580 | |||
| 388 | Ga0075369_10002683 | |||
| 389 | Ga0075369_10014928 | |||
| 390 | Ga0075369_10027985 | |||
| 391 | Ga0075366_10048926 | |||
| 392 | Ga0097621_100162131 | |||
| 393 | Ga0068871_100055355 | |||
| 394 | Ga0068865_100030073 | |||
| 395 | Ga0105250_10006833 | |||
| 396 | Ga0105240_10099154 | |||
| 397 | Ga0105242_10188899 | |||
| 398 | Ga0105248_10024868 | |||
| 399 | Ga0105248_10099751 | |||
| 400 | Ga0105237_10063059 | |||
| 401 | Ga0105237_10212016 | |||
| 402 | Ga0105249_10110912 | |||
| 403 | Ga0157369_10033563 | |||
| 404 | Ga0171462_1006 | |||
| 405 | Ga0157374_10251396 | |||
| 406 | Ga0157375_10271393 | |||
| 407 | Ga0163163_10000004 | |||
| 408 | Ga0157380_10281972 | |||
| 409 | Ga0157377_10185471 | |||
| 410 | Ga0157379_10002605 | |||
| 411 | Ga0157379_10016863 | |||
| 412 | Ga0182007_10021788 | |||
| 413 | Ga0163161_10027011 | |||
| 414 | Ga0197907_11206118 | |||
| 415 | Ga0206356_10481053 | |||
| 416 | Ga0206349_1636510 | |||
| 417 | Ga0206351_10585159 | |||
| 418 | Ga0206351_10965601 | |||
| 419 | Ga0206350_10665434 | |||
| 420 | Ga0206354_10629149 | |||
| 421 | Ga0213872_10034229 | |||
| 422 | Ga0224712_10001644 | |||
| 423 | Ga0224712_10008092 | |||
| 424 | Ga0209148_1005799 | |||
| 425 | Ga0209233_1016404 | |||
| 426 | Ga0209565_1000384 | |||
| 427 | Ga0209673_1000956 | |||
| 428 | Ga0209675_1000518 | |||
| 429 | Ga0209675_1011558 | |||
| 430 | Ga0209676_1000467 | |||
| 431 | Ga0209025_1000008 | |||
| 432 | Ga0209564_1000015 | |||
| 433 | Ga0209564_1000041 | |||
| 434 | Ga0209564_1006954 | |||
| 435 | Ga0209758_1006870 | |||
| 436 | Ga0209050_1000461 | |||
| 437 | Ga0209256_1000014 | |||
| 438 | Ga0209256_1001342 | |||
| 439 | Ga0209051_1009229 | |||
| 440 | Ga0207713_1047813 | |||
| 441 | Ga0207710_10037608 | |||
| 442 | Ga0207680_10043668 | |||
| 443 | Ga0207705_10000970 | |||
| 444 | Ga0207707_10037873 | |||
| 445 | Ga0207695_10011375 | |||
| 446 | Ga0207695_10147019 | |||
| 447 | Ga0207660_10015133 | |||
| 448 | Ga0207657_10070812 | |||
| 449 | Ga0207652_10004285 | |||
| 450 | Ga0207646_10147420 | |||
| 451 | Ga0207650_10000074 | |||
| 452 | Ga0207644_10041388 | |||
| 453 | Ga0207690_10006522 | |||
| 454 | Ga0207690_10148896 | |||
| 455 | Ga0207704_10008398 | |||
| 456 | Ga0207711_10007049 | |||
| 457 | Ga0207711_10103543 | |||
| 458 | Ga0207711_10184327 | |||
| 459 | Ga0207668_10000001 | |||
| 460 | Ga0207668_10000246 | |||
| 461 | Ga0207668_10018118 | |||
| 462 | Ga0207668_10026970 | |||
| 463 | Ga0207668_10031422 | |||
| 464 | Ga0207658_10000275 | |||
| 465 | Ga0207641_10000034 | |||
| 466 | Ga0207641_10001197 | |||
| 467 | Ga0207641_10001917 | |||
| 468 | Ga0207648_10047240 | |||
| 469 | Ga0207676_10000202 | |||
| 470 | Ga0207676_10001101 | |||
| 471 | Ga0207675_100017209 | |||
| 472 | Ga0207683_10057586 | |||
| 473 | Ga0209813_10003607 | |||
| 474 | Ga0268266_10000289 | |||
| 475 | Ga0268266_10038244 | |||
| 476 | Ga0268266_10050459 | |||
| 477 | Ga0268265_10000648 | |||
| 478 | Ga0268265_10002515 | |||
| 479 | Ga0268264_10000002 | |||
| 480 | Ga0268264_10000068 | |||
| 481 | Ga0268264_10057511 | |||
| 482 | Ga0268264_10057931 | |||
| 483 | Ga0268264_10095551 | |||
| 484 | Ga0268264_10135395 | |||
| 485 | Ga0265337_1003068 | |||
| 486 | Ga0307515_10012598 | |||
| 487 | Ga0307515_10017065 | |||
| 488 | Ga0265338_10024225 | |||
| 489 | Ga0265328_10000028 | |||
| 490 | Ga0265328_10000155 | |||
| 491 | Ga0265328_10007852 | |||
| 492 | Ga0265329_10005561 | |||
| 493 | Ga0265331_10000437 | |||
| 494 | Ga0265331_10001502 | |||
| 495 | Ga0265327_10001631 | |||
| 496 | Ga0265327_10003877 | |||
| 497 | Ga0265327_10051285 | |||
| 498 | Ga0265327_10061995 | |||
| 499 | Ga0265316_10001118 | |||
| 500 | Ga0265316_10092150 | |||
| 501 | Ga0307513_10000045 | |||
| 502 | Ga0265342_10069915 | |||
| 503 | Ga0307413_10012170 | |||
| 504 | Ga0373927_0000479 | |||
| 505 | Ga0373925_0005838 | |||
| 506 | Ga0395899_0004713 | |||
| 507 | Ga0395899_0021296 | |||
| 508 | Ga0395900_0001901 | |||
| 509 | Ga0395900_0100671 | |||
| 510 | Ga0395900_0143932 | |||
| 511 | Ga0395898_0002582 | |||
| 512 | Ga0395905_0000291 | |||
| 513 | Ga0395905_0008664 | |||
| 514 | Ga0395905_0075758 | |||
| 515 | Ga0395901_0000870 | |||
| 516 | Ga0395901_0006258 | |||
| 517 | Ga0395901_0083653 | |||
| 518 | Ga0400483_018872 | |||
| 519 | Ga0400483_277960 | |||
| 520 | Ga0436365_0635493 | |||
| 521 | Ga0436365_1347305 | |||
| 522 | Ga0436360_0292789 | |||
| 523 | Ga0436360_0442682 | |||
| 524 | Ga0436361_0394147 | |||
| 525 | Ga0436361_0672503 | |||
| 526 | Ga0466967_0115764 | |||
| 527 | Ga0495627_008977 | |||
| 528 | Ga0495603_0035040 | |||
| 529 | Ga0495590_0001741 | |||
| 530 | Ga0495629_0026670 | |||
| 531 | Ga0495638_0000588 | |||
| 532 | Ga0495638_0004112 | |||
| 533 | Ga0495638_0009677 | |||
| 534 | Ga0495641_0017974 | |||
| 535 | Ga0495650_0000114 | |||
| 536 | Ga0495605_0000966 | |||
| 537 | Ga0495584_0000878 | |||
| 538 | Ga0495585_0003129 | |||
| 539 | Ga0495585_0051526 | |||
| 540 | Ga0495607_0010068 | |||
| 541 | Ga0495583_0000013 | |||
| 542 | Ga0495606_0037933 | |||
| 543 | Ga0495616_0000053 | |||
| 544 | Ga0495628_0019068 | |||
| 545 | Ga0495631_0007232 | |||
| 546 | Ga0495632_0036021 | |||
| 547 | Ga0495648_0000372 | |||
| 548 | Ga0495654_0000082 | |||
| 549 | Ga0495587_0040432 | |||
| 550 | Ga0495609_0008702 | |||
| 551 | Ga0495609_0012485 | |||
| 552 | Ga0495597_0018835 | |||
| 553 | Ga0495622_0005584 | |||
| 554 | Ga0495622_0009123 | |||
| 555 | Ga0495656_0000083 | |||
| 556 | Ga0495668_0000342 | |||
| 557 | Ga0495668_0020755 | |||
| 558 | Ga0495611_0071767 | |||
| 559 | Ga0495625_0000290 | |||
| 560 | Ga0495625_0010575 | |||
| 561 | Ga0495669_0000329 | |||
| 562 | Ga0495613_0001323 | |||
| 563 | Ga0495624_0045482 | |||
| 564 | Ga0495670_0031372 | |||
| 565 | Ga0495671_0012771 | |||
| 566 | Ga0495649_0006696 | |||
| 567 | Ga0495589_0003699 | |||
| 568 | Ga0495589_0017961 | |||
| 569 | Ga0495581_0001020 | |||
| 570 | Ga0495672_0002135 | |||
| 571 | Ga0495672_0008929 | |||
| 572 | Ga0495676_0043322 | |||
| 573 | Ga0495680_0022162 | |||
| 574 | Ga0495673_0000025 | |||
| 575 | Ga0495673_0003311 | |||
| 576 | Ga0495673_0004316 | |||
| 577 | Ga0495681_0014181 | |||
| 578 | Ga0495681_0050976 | |||
| 579 | Ga0495686_0006216 | |||
| 580 | Ga0495686_0006929 | |||
| 581 | Ga0495593_0024764 | |||
| 582 | Ga0496101_0171059 | |||
| 583 | Ga0496101_0174443 | |||
| 584 | Ga0496107_0000329 | |||
| 585 | Ga0496107_0150173 | |||
| 586 | Ga0496109_0136893 | |||
| 587 | Ga0496111_0152396 | |||
| 588 | Ga0496115_0002250 | |||
| 589 | Ga0496117_0012409 | |||
| 590 | Ga0496117_0075256 | |||
| 591 | Ga0496118_0005681 | |||
| 592 | Ga0496119_0015319 | |||
| 593 | Ga0496121_0001066 | |||
| 594 | Ga0496121_0001417 | |||
| 595 | Ga0496122_0017375 | |||
| 596 | Ga0496122_0051407 | |||
| 597 | Ga0496123_0029975 | |||
| 598 | Ga0496123_0052602 | |||
| 599 | Ga0496125_0016135 | |||
| 600 | Ga0496126_0026487 | |||
| 601 | Ga0495678_001396 | |||
| 602 | Ga0501047_0014685 | |||
| 603 | Ga0501257_000824 | |||
| 604 | Ga0501044_0197149 | |||
| 605 | nmdc:mga03n38_3147_c1 | |||
| 606 | nmdc:mga00v17_2988_c1 | |||
| 607 | nmdc:mga0k408_24012_c2 | |||
| 608 | nmdc:mga04h51_5853_c1 | |||
| 609 | nmdc:mga07m45_132262_c1 | |||
| 610 | nmdc:mga0sz30_17490_c1 | |||
| 611 | nmdc:mga0sz30_24502_c1 | |||
| 612 | Ga0500635_0000045 | |||
| 613 | Ga0500578_0000102 | |||
| 614 | Ga0500578_0100795 | |||
| 615 | Ga0500643_001892 | |||
| 616 | Ga0500644_0000287 | |||
| 617 | Ga0500644_0000533 | |||
| 618 | Ga0500583_0042763 | |||
| 619 | Ga0500641_0047784 | |||
| 620 | Ga0500556_0000558 | |||
| 621 | Ga0500562_000146 | |||
| 622 | Ga0500562_009046 | |||
| 623 | Ga0500569_003672 | |||
| 624 | Ga0500572_000189 | |||
| 625 | Ga0500594_0000123 | |||
| 626 | Ga0500595_000002 | |||
| 627 | Ga0500595_000109 | |||
| 628 | Ga0500595_003186 | |||
| 629 | Ga0500595_005023 | |||
| 630 | Ga0500608_000187 | |||
| 631 | Ga0500618_000319 | |||
| 632 | Ga0500642_0039571 | |||
| 633 | Ga0500559_0000010 | |||
| 634 | Ga0500559_0000280 | |||
| 635 | Ga0500559_0002775 | |||
| 636 | Ga0500590_019652 | |||
| 637 | Ga0500604_0030440 | |||
| 638 | Ga0500616_0000002 | |||
| 639 | Ga0500622_0000611 | |||
| 640 | Ga0500622_0015009 | |||
| 641 | Ga0500622_0016204 | |||
| 642 | Ga0500622_0061874 | |||
| 643 | Ga0500636_0007042 | |||
| 644 | Ga0500636_0015065 | |||
| 645 | Ga0500636_0060966 | |||
| 646 | Ga0500637_0038226 | |||
| 647 | Ga0500645_000156 | |||
| 648 | Ga0500596_001528 | |||
| 649 | Ga0587084_000108 | |||
| 650 | Ga0587073_0002444 | |||
| 651 | Ga0587069_001182 | |||
| 652 | 2511121726 | |||
| 653 | 2585148987 | |||
| 654 | 2585151607 | |||
| 655 | 2585195519 | |||
| 656 | 2587915357 | |||
| 657 | 2643749233 | |||
| 658 | 2643781352 | |||
| 659 | 2643922932 | |||
| 660 | 2643927067 | |||
| 661 | 2643998403 | |||
| 662 | 2644086732 | |||
| 663 | 2644223912 | |||
| 664 | 2644232898 | |||
| 665 | 2644341686 | |||
| 666 | 2644367973 | |||
| 667 | 2644508992 | |||
| 668 | 2644731756 | |||
| 669 | 2644736703 | |||
| 670 | 2774873914 | |||
| 671 | 2792462918 | |||
| 672 | 2819536335 | |||
| 673 | 2819644590 | |||
| 674 | 2819719263 | |||
| 675 | 2841915831 | |||
| 676 | 2841921789 | |||
| 677 | 2843746465 | |||
| 678 | 2849561820 | |||
| 679 | 2849574114 | |||
| 680 | 2851157795 | |||
| 681 | 2857508041 | |||
| 682 | 2884963133 | |||
| 683 | 2891091380 | |||
| 684 | 2898332561 | |||
| 685 | 2917704475 | |||
| 686 | 2928534803 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bel-assembly1.cif.gz_M | cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ciii membrane domain) | 0.8528 | 6 | 363 |
| 1zrt-assembly1.cif.gz_P | rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound | 0.8428 | 2 | 362 |
| 2fyn-assembly1.cif.gz_A | crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex | 0.8345 | 2 | 365 |
| 2yiu-assembly1.cif.gz_D | x-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution | 0.8326 | 2 | 365 |
| 7jrg-assembly1.cif.gz_C | plant mitochondrial complex iii2 from vigna radiata | 0.832 | 6 | 365 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fynA00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8345 | 2 | 365 | 1.20.810.10 |
| af_Q7HP03_2_368_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8234 | 9 | 368 | 1.20.810.10 |
| 3cwbC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8231 | 5 | 373 | 1.20.810.10 |
| 1kyoC00 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.8229 | 1 | 374 | 1.20.810.10 |
| af_P24890_1_369_1.20.810.10 | Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C | 0.818 | 1 | 373 | 1.20.810.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6F8Z1P1-F1-model_v4 | Cytochrome b | 0.8529 | 6 | 364 |
GO:0005743
GO:0009055 GO:0016491 GO:0022904 GO:0046872 |
| AF-A7J1C0-F1-model_v4 | Cytochrome b | 0.8521 | 14 | 344 |
GO:0005743
GO:0006122 GO:0008121 GO:0045275 GO:0046872 |
| AF-A0A2E4S603-F1-model_v4 | Cytochrome b | 0.8515 | 2 | 362 |
GO:0008121
GO:0022904 GO:0045275 GO:0046872 |
| AF-A1C1F7-F1-model_v4 | Cytochrome b | 0.851 | 13 | 345 |
GO:0005743
GO:0006122 GO:0008121 GO:0045275 GO:0046872 |
| AF-A0A424RUB0-F1-model_v4 | Cytochrome b | 0.8507 | 72 | 362 |
GO:0008121
GO:0022904 GO:0045275 GO:0046872 |