F415405

General Info

Members Datasets Scaffolds Average Seq Length
343 246 686 423

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1013996|Ga0055526_10139962
Length 439
Sequence MSGHSTYEPKTGFERWLDARLPIVRLGYDSFVDYPTPRNLNYWWTFGGILSLCLASQLITGIILVMHYTPSADHAFASVEHIMRDVNYGWLIRYMHANGASMFFIAVYIHMLRGLYYGSYKAPREVLWLLGCVIYLLMMATAFMGYVLPWGQMSFHGAVVITNLFGALPLVGESITTWLWGGFAVDNPTLNRFFSLHYLLPFMIAGVVILHIWALHVVGQNNPTGVEPKSKADTVPFTPYATVKDGFAMSVFLILFAWFVFFMPNALGHADNYIPANPLVTPSHIVPEWYFLPFYAILRAVPDKLMGVLAMFGAIACLFALPWLDTSKVRSMRYRPTAKIHFFIFVVACCILGVCGAKLPDDQVIPHLTTFQLMASDLNSFVWLSRVAALYYFAFFLVILPVLGLTEKTLPVPDSIASPALSHPAAAPAEATAAPEMKG

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
141 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
186 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
193 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
198 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
209 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
213 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
214 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
215 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
216 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
217 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
218 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
219 2643221583 Caulobacter sp. Root655 Isolate Unclassified
220 2643221584 Caulobacter sp. Root656 Isolate Unclassified
221 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
222 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
223 2643221640 Caulobacter sp. Root342 Isolate Unclassified
224 2643221642 Caulobacter sp. Root343 Isolate Unclassified
225 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
226 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
227 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
228 2643221733 Bosea sp. Root381 Isolate Unclassified
229 2643221734 Bosea sp. Root670 Isolate Unclassified
230 2773857925 Microvirga vignae BR3299 Isolate Unclassified
231 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
232 2818991435 Caulobacter henricii 536 Isolate Unclassified
233 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
234 2818991467 Bosea vestrisii 3192 Isolate Unclassified
235 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
236 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
237 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
238 2849560528 Caulobacter zeae 410 Isolate Unclassified
239 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
240 2851153111 Caulobacter radicis 736 Isolate Unclassified
241 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
242 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
243 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
244 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
245 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
246 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.13
Metatranscriptomes 4.66
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.16
Nodule 0.58
Rhizoplane 2.04
Rhizosphere 63.27
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1013996 3300003771 Bacteria 3341
2 Ga0006777J48905_1081508 3300003308 Eukaryota 1601
3 Ga0006562J51391_1028761 3300003578 Bacteria 2490
4 Ga0055526_1000150 3300003771 Bacteria 61554
5 Ga0055526_1000671 3300003771 Bacteria 26208
6 Ga0055524_1000068 3300003775 Bacteria 130413
7 Ga0055528_1006412 3300003790 Bacteria 5338
8 Ga0058861_11935250 3300004800 Eukaryota 1584
9 Ga0058862_10011350 3300004803 Unclassified 4665
10 Ga0065165_1001609 3300005262 Bacteria 23073
11 Ga0070670_100000032 3300005331 Bacteria 158514
12 Ga0070680_100028667 3300005336 Bacteria 4467
13 Ga0070660_100016351 3300005339 Bacteria 5384
14 Ga0070668_100000975 3300005347 Bacteria 20042
15 Ga0070668_100014972 3300005347 Bacteria 5795
16 Ga0070668_100031168 3300005347 Bacteria 4056
17 Ga0070671_100059353 3300005355 Bacteria 3183
18 Ga0070667_100000110 3300005367 Bacteria 105201
19 Ga0070667_100024229 3300005367 Bacteria 5041
20 Ga0070681_10020584 3300005458 Bacteria 6611
21 Ga0070698_100008566 3300005471 Bacteria 11036
22 Ga0070679_100138407 3300005530 Bacteria 2415
23 Ga0070684_100025106 3300005535 Bacteria 5005
24 Ga0068864_100000184 3300005618 Bacteria 57553
25 Ga0068864_100000321 3300005618 Bacteria 42230
26 Ga0068863_100000037 3300005841 Bacteria 162638
27 Ga0068863_100001377 3300005841 Bacteria 24126
28 Ga0068863_100004617 3300005841 Bacteria 13569
29 Ga0068858_100000029 3300005842 Bacteria 144691
30 Ga0068858_100006036 3300005842 Bacteria 11808
31 Ga0068858_100018099 3300005842 Bacteria 6599
32 Ga0068858_100179631 3300005842 Bacteria 1998
33 Ga0068860_100000100 3300005843 Bacteria 144580
34 Ga0068860_100000167 3300005843 Bacteria 108234
35 Ga0068860_100005700 3300005843 Bacteria 12574
36 Ga0068860_100111872 3300005843 Bacteria 2611
37 Ga0068862_100008644 3300005844 Bacteria 8423
38 Ga0068862_100054175 3300005844 Bacteria 3434
39 Ga0081455_10019019 3300005937 Bacteria 6514
40 Ga0075368_10001626 3300006042 Bacteria 7216
41 Ga0075363_100004231 3300006048 Bacteria 6237
42 Ga0075364_10001989 3300006051 Bacteria 11387
43 Ga0075362_10012061 3300006177 Bacteria 3421
44 Ga0075367_10004580 3300006178 Bacteria 6767
45 Ga0075369_10002683 3300006186 Bacteria 6377
46 Ga0075369_10014928 3300006186 Bacteria 3110
47 Ga0075369_10027985 3300006186 Bacteria 2360
48 Ga0075366_10048926 3300006195 Bacteria 2508
49 Ga0097621_100162131 3300006237 Bacteria 1922
50 Ga0068871_100055355 3300006358 Bacteria 3220
51 Ga0068865_100030073 3300006881 Bacteria 3609
52 Ga0105250_10006833 3300009092 Bacteria 4954
53 Ga0105240_10099154 3300009093 Bacteria 3546
54 Ga0105242_10188899 3300009176 Bacteria 1822
55 Ga0105248_10024868 3300009177 Bacteria 6656
56 Ga0105248_10099751 3300009177 Bacteria 3272
57 Ga0105237_10063059 3300009545 Bacteria 3704
58 Ga0105237_10212016 3300009545 Bacteria 1937
59 Ga0105249_10110912 3300009553 Bacteria 2593
60 Ga0157369_10033563 3300013105 Bacteria 5639
61 Ga0171462_1006 3300013250 Bacteria 432986
62 Ga0157374_10251396 3300013296 Bacteria 1740
63 Ga0157375_10271393 3300013308 Bacteria 1858
64 Ga0163163_10000004 3300014325 Bacteria 416569
65 Ga0157380_10281972 3300014326 Bacteria 1521
66 Ga0157377_10185471 3300014745 Bacteria 1311
67 Ga0157379_10002605 3300014968 Bacteria 15162
68 Ga0157379_10016863 3300014968 Bacteria 6429
69 Ga0182007_10021788 3300015262 Bacteria 2270
70 Ga0163161_10027011 3300017792 Bacteria 4071
71 Ga0197907_11206118 3300020069 Eukaryota 1629
72 Ga0206356_10481053 3300020070 Eukaryota 2200
73 Ga0206349_1636510 3300020075 Eukaryota 9124
74 Ga0206351_10585159 3300020077 Eukaryota 3638
75 Ga0206351_10965601 3300020077 Eukaryota 4192
76 Ga0206350_10665434 3300020080 Unclassified 7523
77 Ga0206354_10629149 3300020081 Eukaryota 1281
78 Ga0213872_10034229 3300021361 Bacteria 2326
79 Ga0224712_10001644 3300022467 Eukaryota 5260
80 Ga0224712_10008092 3300022467 Unclassified 3094
81 Ga0209148_1005799 3300025254 Bacteria 2763
82 Ga0209233_1016404 3300025261 Bacteria 2041
83 Ga0209565_1000384 3300025263 Bacteria 37478
84 Ga0209673_1000956 3300025273 Bacteria 36077
85 Ga0209675_1000518 3300025291 Bacteria 28467
86 Ga0209675_1011558 3300025291 Bacteria 2920
87 Ga0209676_1000467 3300025292 Bacteria 67659
88 Ga0209025_1000008 3300025294 Bacteria 1130876
89 Ga0209564_1000015 3300025295 Bacteria 615324
90 Ga0209564_1000041 3300025295 Bacteria 405199
91 Ga0209564_1006954 3300025295 Bacteria 5943
92 Ga0209758_1006870 3300025297 Bacteria 7953
93 Ga0209050_1000461 3300025298 Bacteria 72912
94 Ga0209256_1000014 3300025299 Bacteria 687409
95 Ga0209256_1001342 3300025299 Bacteria 26115
96 Ga0209051_1009229 3300025303 Bacteria 5104
97 Ga0207713_1047813 3300025735 Bacteria 1728
98 Ga0207710_10037608 3300025900 Bacteria 2138
99 Ga0207680_10043668 3300025903 Bacteria 2630
100 Ga0207705_10000970 3300025909 Bacteria 23483
101 Ga0207707_10037873 3300025912 Bacteria 4213
102 Ga0207695_10011375 3300025913 Bacteria 10785
103 Ga0207695_10147019 3300025913 Bacteria 2300
104 Ga0207660_10015133 3300025917 Bacteria 5087
105 Ga0207657_10070812 3300025919 Bacteria 2954
106 Ga0207652_10004285 3300025921 Bacteria 11637
107 Ga0207646_10147420 3300025922 Bacteria 2121
108 Ga0207650_10000074 3300025925 Bacteria 134837
109 Ga0207644_10041388 3300025931 Bacteria 3259
110 Ga0207690_10006522 3300025932 Bacteria 6918
111 Ga0207690_10148896 3300025932 Bacteria 1733
112 Ga0207704_10008398 3300025938 Bacteria 4937
113 Ga0207711_10007049 3300025941 Bacteria 9418
114 Ga0207711_10103543 3300025941 Bacteria 2521
115 Ga0207711_10184327 3300025941 Bacteria 1899
116 Ga0207668_10000001 3300025972 Bacteria 266091
117 Ga0207668_10000246 3300025972 Bacteria 36387
118 Ga0207668_10018118 3300025972 Bacteria 4424
119 Ga0207668_10026970 3300025972 Bacteria 3737
120 Ga0207668_10031422 3300025972 Bacteria 3497
121 Ga0207658_10000275 3300025986 Bacteria 53906
122 Ga0207641_10000034 3300026088 Bacteria 217752
123 Ga0207641_10001197 3300026088 Bacteria 26009
124 Ga0207641_10001917 3300026088 Bacteria 19953
125 Ga0207648_10047240 3300026089 Bacteria 3774
126 Ga0207676_10000202 3300026095 Bacteria 51825
127 Ga0207676_10001101 3300026095 Bacteria 20425
128 Ga0207675_100017209 3300026118 Bacteria 6751
129 Ga0207683_10057586 3300026121 Bacteria 3411
130 Ga0209813_10003607 3300027866 Bacteria 3636
131 Ga0268266_10000289 3300028379 Bacteria 82515
132 Ga0268266_10038244 3300028379 Bacteria 4086
133 Ga0268266_10050459 3300028379 Bacteria 3570
134 Ga0268265_10000648 3300028380 Bacteria 34549
135 Ga0268265_10002515 3300028380 Bacteria 13726
136 Ga0268264_10000002 3300028381 Bacteria 1153045
137 Ga0268264_10000068 3300028381 Bacteria 275708
138 Ga0268264_10057511 3300028381 Bacteria 3253
139 Ga0268264_10057931 3300028381 Bacteria 3242
140 Ga0268264_10095551 3300028381 Bacteria 2572
141 Ga0268264_10135395 3300028381 Bacteria 2189
142 Ga0265337_1003068 3300028556 Bacteria 7372
143 Ga0307515_10012598 3300028794 Bacteria 15891
144 Ga0307515_10017065 3300028794 Bacteria 13254
145 Ga0265338_10024225 3300028800 Bacteria 6207
146 Ga0265328_10000028 3300031239 Bacteria 112296
147 Ga0265328_10000155 3300031239 Bacteria 32139
148 Ga0265328_10007852 3300031239 Bacteria 4432
149 Ga0265329_10005561 3300031242 Bacteria 5081
150 Ga0265331_10000437 3300031250 Bacteria 40997
151 Ga0265331_10001502 3300031250 Bacteria 17215
152 Ga0265327_10001631 3300031251 Bacteria 27036
153 Ga0265327_10003877 3300031251 Bacteria 13777
154 Ga0265327_10051285 3300031251 Bacteria 2154
155 Ga0265327_10061995 3300031251 Bacteria 1905
156 Ga0265316_10001118 3300031344 Bacteria 29088
157 Ga0265316_10092150 3300031344 Bacteria 2310
158 Ga0307513_10000045 3300031456 Bacteria 158626
159 Ga0265342_10069915 3300031712 Bacteria 2049
160 Ga0307413_10012170 3300031824 Bacteria 4271
161 Ga0373927_0000479 3300035695 Bacteria 30749
162 Ga0373925_0005838 3300037068 Bacteria 9133
163 Ga0395899_0004713 3300037312 Bacteria 10637
164 Ga0395899_0021296 3300037312 Bacteria 4918
165 Ga0395900_0001901 3300037418 Bacteria 23770
166 Ga0395900_0100671 3300037418 Bacteria 2968
167 Ga0395900_0143932 3300037418 Bacteria 2439
168 Ga0395898_0002582 3300037466 Bacteria 21175
169 Ga0395905_0000291 3300037471 Unclassified 73478
170 Ga0395905_0008664 3300037471 Unclassified 10021
171 Ga0395905_0075758 3300037471 Bacteria 3153
172 Ga0395901_0000870 3300038443 Unclassified 33324
173 Ga0395901_0006258 3300038443 Bacteria 12063
174 Ga0395901_0083653 3300038443 Eukaryota 3336
175 Ga0400483_018872 3300039062 Bacteria 11395
176 Ga0400483_277960 3300039062 Bacteria 10935
177 Ga0436365_0635493 3300039437 Bacteria 3062
178 Ga0436365_1347305 3300039437 Bacteria 1977
179 Ga0436360_0292789 3300039438 Bacteria 4190
180 Ga0436360_0442682 3300039438 Bacteria 3371
181 Ga0436361_0394147 3300039447 Bacteria 7521
182 Ga0436361_0672503 3300039447 Bacteria 2975
183 Ga0466967_0115764 3300045976 Bacteria 2469
184 Ga0495627_008977 3300046453 Bacteria 3697
185 Ga0495603_0035040 3300046455 Eukaryota 3016
186 Ga0495590_0001741 3300046457 Bacteria 9231
187 Ga0495629_0026670 3300046459 Bacteria 4104
188 Ga0495638_0000588 3300046460 Bacteria 41034
189 Ga0495638_0004112 3300046460 Bacteria 11128
190 Ga0495638_0009677 3300046460 Bacteria 6739
191 Ga0495641_0017974 3300046461 Eukaryota 3662
192 Ga0495650_0000114 3300046471 Bacteria 192527
193 Ga0495605_0000966 3300046474 Eukaryota 19541
194 Ga0495584_0000878 3300046491 Eukaryota 19407
195 Ga0495585_0003129 3300046492 Eukaryota 11347
196 Ga0495585_0051526 3300046492 Bacteria 2281
197 Ga0495607_0010068 3300046501 Bacteria 6367
198 Ga0495583_0000013 3300046506 Bacteria 323372
199 Ga0495606_0037933 3300046507 Bacteria 3267
200 Ga0495616_0000053 3300046513 Bacteria 104389
201 Ga0495628_0019068 3300046516 Eukaryota 5673
202 Ga0495631_0007232 3300046518 Eukaryota 5659
203 Ga0495632_0036021 3300046519 Bacteria 2519
204 Ga0495648_0000372 3300046524 Bacteria 49423
205 Ga0495654_0000082 3300046530 Bacteria 108599
206 Ga0495587_0040432 3300046536 Eukaryota 2787
207 Ga0495609_0008702 3300046538 Bacteria 4951
208 Ga0495609_0012485 3300046538 Bacteria 4030
209 Ga0495597_0018835 3300046542 Bacteria 3235
210 Ga0495622_0005584 3300046557 Bacteria 5832
211 Ga0495622_0009123 3300046557 Bacteria 4592
212 Ga0495656_0000083 3300046615 Eukaryota 42115
213 Ga0495668_0000342 3300046616 Bacteria 61973
214 Ga0495668_0020755 3300046616 Bacteria 3775
215 Ga0495611_0071767 3300046648 Bacteria 1583
216 Ga0495625_0000290 3300046660 Bacteria 77650
217 Ga0495625_0010575 3300046660 Bacteria 7620
218 Ga0495669_0000329 3300046684 Bacteria 25520
219 Ga0495613_0001323 3300046689 Bacteria 18949
220 Ga0495624_0045482 3300046690 Bacteria 2794
221 Ga0495670_0031372 3300046691 Eukaryota 2640
222 Ga0495671_0012771 3300046692 Eukaryota 4574
223 Ga0495649_0006696 3300046694 Bacteria 7147
224 Ga0495589_0003699 3300046794 Eukaryota 8252
225 Ga0495589_0017961 3300046794 Bacteria 3628
226 Ga0495581_0001020 3300047315 Eukaryota 15142
227 Ga0495672_0002135 3300047320 Bacteria 18531
228 Ga0495672_0008929 3300047320 Bacteria 7320
229 Ga0495676_0043322 3300047321 Eukaryota 3685
230 Ga0495680_0022162 3300047322 Bacteria 5303
231 Ga0495673_0000025 3300047469 Bacteria 512352
232 Ga0495673_0003311 3300047469 Eukaryota 10680
233 Ga0495673_0004316 3300047469 Bacteria 8951
234 Ga0495681_0014181 3300047470 Eukaryota 4584
235 Ga0495681_0050976 3300047470 Bacteria 1948
236 Ga0495686_0006216 3300047472 Bacteria 9206
237 Ga0495686_0006929 3300047472 Bacteria 8570
238 Ga0495593_0024764 3300047673 Bacteria 3323
239 Ga0496101_0171059 3300048904 Bacteria 1670
240 Ga0496101_0174443 3300048904 Bacteria 1653
241 Ga0496107_0000329 3300048910 Bacteria 25658
242 Ga0496107_0150173 3300048910 Bacteria 1723
243 Ga0496109_0136893 3300048912 Bacteria 2289
244 Ga0496111_0152396 3300048914 Bacteria 1715
245 Ga0496115_0002250 3300048918 Bacteria 13815
246 Ga0496117_0012409 3300048920 Bacteria 7515
247 Ga0496117_0075256 3300048920 Bacteria 2244
248 Ga0496118_0005681 3300048921 Bacteria 14053
249 Ga0496119_0015319 3300048922 Bacteria 5914
250 Ga0496121_0001066 3300048924 Bacteria 48544
251 Ga0496121_0001417 3300048924 Bacteria 40646
252 Ga0496122_0017375 3300048925 Bacteria 6729
253 Ga0496122_0051407 3300048925 Bacteria 3131
254 Ga0496123_0029975 3300048926 Bacteria 3992
255 Ga0496123_0052602 3300048926 Bacteria 2701
256 Ga0496125_0016135 3300048928 Bacteria 7184
257 Ga0496126_0026487 3300048929 Bacteria 5559
258 Ga0495678_001396 3300049459 Bacteria 19168
259 Ga0501047_0014685 3300049581 Bacteria 7452
260 Ga0501257_000824 3300049686 Bacteria 6198
261 Ga0501044_0197149 3300049823 Bacteria 1973
262 nmdc:mga03n38_3147_c1 3300050490 Bacteria 5253
263 nmdc:mga00v17_2988_c1 3300050491 Bacteria 8682
264 nmdc:mga0k408_24012_c2 3300050493 Bacteria 3023
265 nmdc:mga04h51_5853_c1 3300050495 Bacteria 3153
266 nmdc:mga07m45_132262_c1 3300050496 Bacteria 1444
267 nmdc:mga0sz30_17490_c1 3300050516 Bacteria 2860
268 nmdc:mga0sz30_24502_c1 3300050516 Bacteria 2463
269 Ga0500635_0000045 3300053080 Bacteria 87314
270 Ga0500578_0000102 3300053086 Bacteria 99108
271 Ga0500578_0100795 3300053086 Bacteria 1827
272 Ga0500643_001892 3300053087 Bacteria 11378
273 Ga0500644_0000287 3300053088 Bacteria 27540
274 Ga0500644_0000533 3300053088 Bacteria 15780
275 Ga0500583_0042763 3300053092 Bacteria 2066
276 Ga0500641_0047784 3300053096 Bacteria 1751
277 Ga0500556_0000558 3300053104 Bacteria 24866
278 Ga0500562_000146 3300053108 Bacteria 20862
279 Ga0500562_009046 3300053108 Bacteria 2517
280 Ga0500569_003672 3300053109 Bacteria 3164
281 Ga0500572_000189 3300053111 Bacteria 21822
282 Ga0500594_0000123 3300053118 Bacteria 21627
283 Ga0500595_000002 3300053119 Bacteria 1074388
284 Ga0500595_000109 3300053119 Bacteria 55874
285 Ga0500595_003186 3300053119 Bacteria 7763
286 Ga0500595_005023 3300053119 Bacteria 5823
287 Ga0500608_000187 3300053122 Bacteria 24884
288 Ga0500618_000319 3300053125 Bacteria 35375
289 Ga0500642_0039571 3300053130 Bacteria 2028
290 Ga0500559_0000010 3300053136 Bacteria 165569
291 Ga0500559_0000280 3300053136 Bacteria 39387
292 Ga0500559_0002775 3300053136 Bacteria 8869
293 Ga0500590_019652 3300053148 Bacteria 3501
294 Ga0500604_0030440 3300053151 Bacteria 1579
295 Ga0500616_0000002 3300053153 Bacteria 1611257
296 Ga0500622_0000611 3300053156 Bacteria 32433
297 Ga0500622_0015009 3300053156 Bacteria 4154
298 Ga0500622_0016204 3300053156 Bacteria 3984
299 Ga0500622_0061874 3300053156 Bacteria 1907
300 Ga0500636_0007042 3300053177 Bacteria 6485
301 Ga0500636_0015065 3300053177 Bacteria 4552
302 Ga0500636_0060966 3300053177 Bacteria 2202
303 Ga0500637_0038226 3300053178 Bacteria 2702
304 Ga0500645_000156 3300053730 Bacteria 53110
305 Ga0500596_001528 3300053735 Bacteria 4685
306 Ga0587084_000108 3300059477 Eukaryota 4549
307 Ga0587073_0002444 3300059492 Eukaryota 2379
308 Ga0587069_001182 3300059642 Bacteria 2312
309 2511121726 2510917020 Bacteria 5657507
310 2585148987 2582581279 Bacteria 4980720
311 2585151607 2582581280 Bacteria 5994497
312 2585195519 2582581293 Bacteria 5907401
313 2587915357 2585428106 Bacteria 5179711
314 2643749233 2643221545 Bacteria 5083237
315 2643781352 2643221552 Bacteria 5708754
316 2643922932 2643221583 Bacteria 5218014
317 2643927067 2643221584 Bacteria 5511711
318 2643998403 2643221598 Bacteria 4578346
319 2644086732 2643221614 Bacteria 4260023
320 2644223912 2643221640 Bacteria 5258820
321 2644232898 2643221642 Bacteria 5357871
322 2644341686 2643221661 Bacteria 4267604
323 2644367973 2643221666 Bacteria 4265935
324 2644508992 2643221691 Bacteria 5093099
325 2644731756 2643221733 Bacteria 5690728
326 2644736703 2643221734 Bacteria 5365412
327 2774873914 2773857925 Bacteria 6472445
328 2792462918 2791355048 Bacteria 5832535
329 2819536335 2818991435 Bacteria 5433759
330 2819644590 2818991454 Bacteria 5563326
331 2819719263 2818991467 Bacteria 5893227
332 2841915831 2841911363 Bacteria 6173697
333 2841921789 2841917233 Bacteria 6173500
334 2843746465 2843744320 Bacteria 5659202
335 2849561820 2849560528 Bacteria 5393480
336 2849574114 2849573788 Bacteria 5421256
337 2851157795 2851153111 Bacteria 5542585
338 2857508041 2857504554 Bacteria 5369913
339 2884963133 2884960567 Bacteria 5437054
340 2891091380 2891088606 Bacteria 4762464
341 2898332561 2898329390 Bacteria 5168154
342 2917704475 2917699015 Bacteria 7043791
343 2928534803 2928531327 Bacteria 5101314
344 Ga0055526_1013996
345 Ga0006777J48905_1081508
346 Ga0006562J51391_1028761
347 Ga0055526_1000150
348 Ga0055526_1000671
349 Ga0055524_1000068
350 Ga0055528_1006412
351 Ga0058861_11935250
352 Ga0058862_10011350
353 Ga0065165_1001609
354 Ga0070670_100000032
355 Ga0070680_100028667
356 Ga0070660_100016351
357 Ga0070668_100000975
358 Ga0070668_100014972
359 Ga0070668_100031168
360 Ga0070671_100059353
361 Ga0070667_100000110
362 Ga0070667_100024229
363 Ga0070681_10020584
364 Ga0070698_100008566
365 Ga0070679_100138407
366 Ga0070684_100025106
367 Ga0068864_100000184
368 Ga0068864_100000321
369 Ga0068863_100000037
370 Ga0068863_100001377
371 Ga0068863_100004617
372 Ga0068858_100000029
373 Ga0068858_100006036
374 Ga0068858_100018099
375 Ga0068858_100179631
376 Ga0068860_100000100
377 Ga0068860_100000167
378 Ga0068860_100005700
379 Ga0068860_100111872
380 Ga0068862_100008644
381 Ga0068862_100054175
382 Ga0081455_10019019
383 Ga0075368_10001626
384 Ga0075363_100004231
385 Ga0075364_10001989
386 Ga0075362_10012061
387 Ga0075367_10004580
388 Ga0075369_10002683
389 Ga0075369_10014928
390 Ga0075369_10027985
391 Ga0075366_10048926
392 Ga0097621_100162131
393 Ga0068871_100055355
394 Ga0068865_100030073
395 Ga0105250_10006833
396 Ga0105240_10099154
397 Ga0105242_10188899
398 Ga0105248_10024868
399 Ga0105248_10099751
400 Ga0105237_10063059
401 Ga0105237_10212016
402 Ga0105249_10110912
403 Ga0157369_10033563
404 Ga0171462_1006
405 Ga0157374_10251396
406 Ga0157375_10271393
407 Ga0163163_10000004
408 Ga0157380_10281972
409 Ga0157377_10185471
410 Ga0157379_10002605
411 Ga0157379_10016863
412 Ga0182007_10021788
413 Ga0163161_10027011
414 Ga0197907_11206118
415 Ga0206356_10481053
416 Ga0206349_1636510
417 Ga0206351_10585159
418 Ga0206351_10965601
419 Ga0206350_10665434
420 Ga0206354_10629149
421 Ga0213872_10034229
422 Ga0224712_10001644
423 Ga0224712_10008092
424 Ga0209148_1005799
425 Ga0209233_1016404
426 Ga0209565_1000384
427 Ga0209673_1000956
428 Ga0209675_1000518
429 Ga0209675_1011558
430 Ga0209676_1000467
431 Ga0209025_1000008
432 Ga0209564_1000015
433 Ga0209564_1000041
434 Ga0209564_1006954
435 Ga0209758_1006870
436 Ga0209050_1000461
437 Ga0209256_1000014
438 Ga0209256_1001342
439 Ga0209051_1009229
440 Ga0207713_1047813
441 Ga0207710_10037608
442 Ga0207680_10043668
443 Ga0207705_10000970
444 Ga0207707_10037873
445 Ga0207695_10011375
446 Ga0207695_10147019
447 Ga0207660_10015133
448 Ga0207657_10070812
449 Ga0207652_10004285
450 Ga0207646_10147420
451 Ga0207650_10000074
452 Ga0207644_10041388
453 Ga0207690_10006522
454 Ga0207690_10148896
455 Ga0207704_10008398
456 Ga0207711_10007049
457 Ga0207711_10103543
458 Ga0207711_10184327
459 Ga0207668_10000001
460 Ga0207668_10000246
461 Ga0207668_10018118
462 Ga0207668_10026970
463 Ga0207668_10031422
464 Ga0207658_10000275
465 Ga0207641_10000034
466 Ga0207641_10001197
467 Ga0207641_10001917
468 Ga0207648_10047240
469 Ga0207676_10000202
470 Ga0207676_10001101
471 Ga0207675_100017209
472 Ga0207683_10057586
473 Ga0209813_10003607
474 Ga0268266_10000289
475 Ga0268266_10038244
476 Ga0268266_10050459
477 Ga0268265_10000648
478 Ga0268265_10002515
479 Ga0268264_10000002
480 Ga0268264_10000068
481 Ga0268264_10057511
482 Ga0268264_10057931
483 Ga0268264_10095551
484 Ga0268264_10135395
485 Ga0265337_1003068
486 Ga0307515_10012598
487 Ga0307515_10017065
488 Ga0265338_10024225
489 Ga0265328_10000028
490 Ga0265328_10000155
491 Ga0265328_10007852
492 Ga0265329_10005561
493 Ga0265331_10000437
494 Ga0265331_10001502
495 Ga0265327_10001631
496 Ga0265327_10003877
497 Ga0265327_10051285
498 Ga0265327_10061995
499 Ga0265316_10001118
500 Ga0265316_10092150
501 Ga0307513_10000045
502 Ga0265342_10069915
503 Ga0307413_10012170
504 Ga0373927_0000479
505 Ga0373925_0005838
506 Ga0395899_0004713
507 Ga0395899_0021296
508 Ga0395900_0001901
509 Ga0395900_0100671
510 Ga0395900_0143932
511 Ga0395898_0002582
512 Ga0395905_0000291
513 Ga0395905_0008664
514 Ga0395905_0075758
515 Ga0395901_0000870
516 Ga0395901_0006258
517 Ga0395901_0083653
518 Ga0400483_018872
519 Ga0400483_277960
520 Ga0436365_0635493
521 Ga0436365_1347305
522 Ga0436360_0292789
523 Ga0436360_0442682
524 Ga0436361_0394147
525 Ga0436361_0672503
526 Ga0466967_0115764
527 Ga0495627_008977
528 Ga0495603_0035040
529 Ga0495590_0001741
530 Ga0495629_0026670
531 Ga0495638_0000588
532 Ga0495638_0004112
533 Ga0495638_0009677
534 Ga0495641_0017974
535 Ga0495650_0000114
536 Ga0495605_0000966
537 Ga0495584_0000878
538 Ga0495585_0003129
539 Ga0495585_0051526
540 Ga0495607_0010068
541 Ga0495583_0000013
542 Ga0495606_0037933
543 Ga0495616_0000053
544 Ga0495628_0019068
545 Ga0495631_0007232
546 Ga0495632_0036021
547 Ga0495648_0000372
548 Ga0495654_0000082
549 Ga0495587_0040432
550 Ga0495609_0008702
551 Ga0495609_0012485
552 Ga0495597_0018835
553 Ga0495622_0005584
554 Ga0495622_0009123
555 Ga0495656_0000083
556 Ga0495668_0000342
557 Ga0495668_0020755
558 Ga0495611_0071767
559 Ga0495625_0000290
560 Ga0495625_0010575
561 Ga0495669_0000329
562 Ga0495613_0001323
563 Ga0495624_0045482
564 Ga0495670_0031372
565 Ga0495671_0012771
566 Ga0495649_0006696
567 Ga0495589_0003699
568 Ga0495589_0017961
569 Ga0495581_0001020
570 Ga0495672_0002135
571 Ga0495672_0008929
572 Ga0495676_0043322
573 Ga0495680_0022162
574 Ga0495673_0000025
575 Ga0495673_0003311
576 Ga0495673_0004316
577 Ga0495681_0014181
578 Ga0495681_0050976
579 Ga0495686_0006216
580 Ga0495686_0006929
581 Ga0495593_0024764
582 Ga0496101_0171059
583 Ga0496101_0174443
584 Ga0496107_0000329
585 Ga0496107_0150173
586 Ga0496109_0136893
587 Ga0496111_0152396
588 Ga0496115_0002250
589 Ga0496117_0012409
590 Ga0496117_0075256
591 Ga0496118_0005681
592 Ga0496119_0015319
593 Ga0496121_0001066
594 Ga0496121_0001417
595 Ga0496122_0017375
596 Ga0496122_0051407
597 Ga0496123_0029975
598 Ga0496123_0052602
599 Ga0496125_0016135
600 Ga0496126_0026487
601 Ga0495678_001396
602 Ga0501047_0014685
603 Ga0501257_000824
604 Ga0501044_0197149
605 nmdc:mga03n38_3147_c1
606 nmdc:mga00v17_2988_c1
607 nmdc:mga0k408_24012_c2
608 nmdc:mga04h51_5853_c1
609 nmdc:mga07m45_132262_c1
610 nmdc:mga0sz30_17490_c1
611 nmdc:mga0sz30_24502_c1
612 Ga0500635_0000045
613 Ga0500578_0000102
614 Ga0500578_0100795
615 Ga0500643_001892
616 Ga0500644_0000287
617 Ga0500644_0000533
618 Ga0500583_0042763
619 Ga0500641_0047784
620 Ga0500556_0000558
621 Ga0500562_000146
622 Ga0500562_009046
623 Ga0500569_003672
624 Ga0500572_000189
625 Ga0500594_0000123
626 Ga0500595_000002
627 Ga0500595_000109
628 Ga0500595_003186
629 Ga0500595_005023
630 Ga0500608_000187
631 Ga0500618_000319
632 Ga0500642_0039571
633 Ga0500559_0000010
634 Ga0500559_0000280
635 Ga0500559_0002775
636 Ga0500590_019652
637 Ga0500604_0030440
638 Ga0500616_0000002
639 Ga0500622_0000611
640 Ga0500622_0015009
641 Ga0500622_0016204
642 Ga0500622_0061874
643 Ga0500636_0007042
644 Ga0500636_0015065
645 Ga0500636_0060966
646 Ga0500637_0038226
647 Ga0500645_000156
648 Ga0500596_001528
649 Ga0587084_000108
650 Ga0587073_0002444
651 Ga0587069_001182
652 2511121726
653 2585148987
654 2585151607
655 2585195519
656 2587915357
657 2643749233
658 2643781352
659 2643922932
660 2643927067
661 2643998403
662 2644086732
663 2644223912
664 2644232898
665 2644341686
666 2644367973
667 2644508992
668 2644731756
669 2644736703
670 2774873914
671 2792462918
672 2819536335
673 2819644590
674 2819719263
675 2841915831
676 2841921789
677 2843746465
678 2849561820
679 2849574114
680 2851157795
681 2857508041
682 2884963133
683 2891091380
684 2898332561
685 2917704475
686 2928534803

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00033

Cytochrome_B

Cytochrome b/b6/petB

31

219

0.99

PF13631

Cytochrom_B_N_2

Cytochrome b(N-terminal)/b6/petB

101

270

0.96

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

275

393

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bel-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ciii membrane domain) 0.8528 6 363
1zrt-assembly1.cif.gz_P rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound 0.8428 2 362
2fyn-assembly1.cif.gz_A crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex 0.8345 2 365
2yiu-assembly1.cif.gz_D x-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution 0.8326 2 365
7jrg-assembly1.cif.gz_C plant mitochondrial complex iii2 from vigna radiata 0.832 6 365
ID Description Score Start End Superfamily
2fynA00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8345 2 365 1.20.810.10
af_Q7HP03_2_368_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8234 9 368 1.20.810.10
3cwbC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8231 5 373 1.20.810.10
1kyoC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8229 1 374 1.20.810.10
af_P24890_1_369_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.818 1 373 1.20.810.10

Map