F415567

General Info

Members Datasets Scaffolds Average Seq Length
343 210 686 163

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000161|Ga0105237_1000016158
Length 178
Sequence MNEQPSKGASPAPAGNAEFVRLLRSPIRFRLYLLTRLPSAFFSGLRIAAADDSSCTVTIPFKWFTRNPFRSTYFACLSMAAEMSTGILAMAAVYKKNPPVSMLVVSLEGNFHKKATGLTAFRCEDGVSIRDIIEKAVSTGEAQIIKARSVGTNAAGETIAEFFITWSFRTRSKTSPNS

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
165 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
166 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
178 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
179 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
180 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
181 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
182 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
185 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
186 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
187 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
188 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
189 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
190 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
191 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
192 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
193 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
194 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
195 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
196 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
197 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 0.87
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 30.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10000161 3300009545 Bacteria 95150
2 SwRhRL2b_contig_837821 2162886007 Bacteria 855
3 MRS1b_contig_6140196 2162886011 Bacteria 1619
4 rootH2_10005684 3300003320 Bacteria 48336
5 rootH2_10021815 3300003320 Bacteria 13880
6 rootL2_10230187 3300003322 Bacteria 4465
7 rootH1_10147333 3300003323 Bacteria 6826
8 Ga0065704_10158252 3300005289 Unclassified 1374
9 Ga0065712_10091050 3300005290 Bacteria 2393
10 Ga0065715_10754771 3300005293 Bacteria 628
11 Ga0070676_10022207 3300005328 Bacteria 3558
12 Ga0070676_10108393 3300005328 Bacteria 1726
13 Ga0070676_10402901 3300005328 Unclassified 952
14 Ga0070683_100000569 3300005329 Bacteria 26292
15 Ga0070683_100005570 3300005329 Bacteria 10515
16 Ga0070683_100172535 3300005329 Unclassified 2053
17 Ga0070683_100207905 3300005329 Unclassified 1859
18 Ga0070677_10063490 3300005333 Bacteria 1531
19 Ga0068869_100039493 3300005334 Bacteria 3370
20 Ga0068869_100782197 3300005334 Bacteria 819
21 Ga0070666_10012266 3300005335 Bacteria 5401
22 Ga0070666_10073318 3300005335 Unclassified 2332
23 Ga0070680_100246187 3300005336 Unclassified 1511
24 Ga0070682_100000018 3300005337 Bacteria 229427
25 Ga0070682_100552778 3300005337 Bacteria 901
26 Ga0070682_100743071 3300005337 Unclassified 791
27 Ga0068868_100028574 3300005338 Bacteria 4264
28 Ga0068868_100206833 3300005338 Unclassified 1638
29 Ga0068868_100554176 3300005338 Bacteria 1013
30 Ga0068868_101074521 3300005338 Unclassified 739
31 Ga0070689_100112323 3300005340 Bacteria 2169
32 Ga0070691_10016499 3300005341 Unclassified 3393
33 Ga0070687_100160664 3300005343 Bacteria 1328
34 Ga0070661_100001256 3300005344 Bacteria 17803
35 Ga0070668_100039596 3300005347 Unclassified 3604
36 Ga0070668_100221928 3300005347 Bacteria 1559
37 Ga0070675_100123957 3300005354 Unclassified 2197
38 Ga0070675_101201701 3300005354 Bacteria 698
39 Ga0070671_100001485 3300005355 Bacteria 17518
40 Ga0070671_100313268 3300005355 Bacteria 1337
41 Ga0070673_100048792 3300005364 Unclassified 3302
42 Ga0070673_100062340 3300005364 Unclassified 2962
43 Ga0070673_100193863 3300005364 Bacteria 1746
44 Ga0070688_100040738 3300005365 Bacteria 2848
45 Ga0070688_100457705 3300005365 Unclassified 955
46 Ga0070688_100848433 3300005365 Unclassified 717
47 Ga0070659_100319259 3300005366 Unclassified 1298
48 Ga0070667_100183666 3300005367 Bacteria 1850
49 Ga0070713_100506066 3300005436 Unclassified 1140
50 Ga0070700_100015168 3300005441 Bacteria 4364
51 Ga0070678_100025461 3300005456 Bacteria 3981
52 Ga0070662_100058904 3300005457 Unclassified 2796
53 Ga0070662_100087175 3300005457 Bacteria 2336
54 Ga0070662_100240385 3300005457 Bacteria 1452
55 Ga0070681_10326422 3300005458 Bacteria 1444
56 Ga0068867_100033035 3300005459 Bacteria 3744
57 Ga0068867_100621010 3300005459 Unclassified 945
58 Ga0070684_100004258 3300005535 Bacteria 10844
59 Ga0070684_100026359 3300005535 Bacteria 4896
60 Ga0070684_100322544 3300005535 Unclassified 1419
61 Ga0068853_100012488 3300005539 Bacteria 6909
62 Ga0068853_100176752 3300005539 Bacteria 1934
63 Ga0068853_100231119 3300005539 Bacteria 1692
64 Ga0068853_100405082 3300005539 Unclassified 1277
65 Ga0068853_101450919 3300005539 Bacteria 664
66 Ga0070672_100072930 3300005543 Bacteria 2735
67 Ga0070686_100071948 3300005544 Bacteria 2266
68 Ga0070686_100225023 3300005544 Bacteria 1358
69 Ga0070665_100000008 3300005548 Bacteria 606341
70 Ga0068855_100025226 3300005563 Bacteria 7118
71 Ga0070664_100026810 3300005564 Bacteria 4784
72 Ga0070664_100116459 3300005564 Unclassified 2337
73 Ga0070664_100390910 3300005564 Bacteria 1271
74 Ga0070664_101180015 3300005564 Unclassified 722
75 Ga0070664_102009477 3300005564 Bacteria 549
76 Ga0068857_100001389 3300005577 Bacteria 19094
77 Ga0068857_100001441 3300005577 Bacteria 18869
78 Ga0068854_100302052 3300005578 Bacteria 1295
79 Ga0068856_100010129 3300005614 Bacteria 9161
80 Ga0070702_100027817 3300005615 Bacteria 3056
81 Ga0070702_100433526 3300005615 Bacteria 949
82 Ga0068852_100000485 3300005616 Bacteria 26052
83 Ga0068852_100651577 3300005616 Unclassified 1061
84 Ga0068852_101383898 3300005616 Unclassified 725
85 Ga0068852_101884658 3300005616 Unclassified 620
86 Ga0068866_10128676 3300005718 Bacteria 1437
87 Ga0068866_10339183 3300005718 Unclassified 951
88 Ga0068861_100064124 3300005719 Bacteria 2826
89 Ga0068861_101175027 3300005719 Unclassified 741
90 Ga0068851_10178881 3300005834 Unclassified 1174
91 Ga0068870_10379012 3300005840 Unclassified 915
92 Ga0068858_100818253 3300005842 Unclassified 909
93 Ga0068860_100000458 3300005843 Bacteria 51184
94 Ga0068860_100434466 3300005843 Bacteria 1303
95 Ga0081540_1006986 3300005983 Bacteria 8124
96 Ga0097621_100495992 3300006237 Unclassified 1105
97 Ga0105240_10000086 3300009093 Bacteria 188623
98 Ga0105240_10000105 3300009093 Bacteria 172035
99 Ga0105240_10008896 3300009093 Bacteria 14292
100 Ga0105240_10011084 3300009093 Bacteria 12604
101 Ga0105240_10018412 3300009093 Bacteria 9379
102 Ga0105240_10026028 3300009093 Bacteria 7684
103 Ga0105240_10708089 3300009093 Bacteria 1098
104 Ga0105240_11550856 3300009093 Unclassified 694
105 Ga0105245_11671275 3300009098 Unclassified 689
106 Ga0105247_10725066 3300009101 Bacteria 751
107 Ga0105242_10298761 3300009176 Bacteria 1469
108 Ga0105242_10380049 3300009176 Unclassified 1313
109 Ga0105237_10001742 3300009545 Bacteria 28101
110 Ga0105237_10020081 3300009545 Bacteria 6896
111 Ga0105238_10001252 3300009551 Bacteria 25549
112 Ga0105238_10010351 3300009551 Bacteria 9359
113 Ga0105238_10023404 3300009551 Bacteria 6296
114 Ga0105238_10160272 3300009551 Bacteria 2225
115 Ga0105238_10922502 3300009551 Bacteria 892
116 Ga0105239_10000215 3300010375 Bacteria 85485
117 Ga0105239_10000295 3300010375 Bacteria 73415
118 Ga0105239_10008486 3300010375 Bacteria 11681
119 Ga0105239_10086873 3300010375 Bacteria 3447
120 Ga0105239_10605251 3300010375 Unclassified 1250
121 Ga0105239_10895341 3300010375 Unclassified 1018
122 Ga0105246_10121098 3300011119 Unclassified 1939
123 Ga0157373_10037894 3300013100 Bacteria 3455
124 Ga0157373_10159437 3300013100 Unclassified 1587
125 Ga0157371_10287777 3300013102 Unclassified 1188
126 Ga0157370_10037999 3300013104 Bacteria 4660
127 Ga0157370_10837608 3300013104 Bacteria 836
128 Ga0157370_11087160 3300013104 Unclassified 723
129 Ga0157369_10006320 3300013105 Bacteria 13752
130 Ga0157369_11271030 3300013105 Bacteria 750
131 Ga0157374_10196622 3300013296 Unclassified 1973
132 Ga0157374_10715663 3300013296 Bacteria 1015
133 Ga0157374_11639227 3300013296 Bacteria 668
134 Ga0163162_10005707 3300013306 Bacteria 12032
135 Ga0163162_10042979 3300013306 Bacteria 4523
136 Ga0163162_10132330 3300013306 Unclassified 2603
137 Ga0163162_11714341 3300013306 Bacteria 718
138 Ga0163162_12103699 3300013306 Unclassified 647
139 Ga0163162_12674301 3300013306 Bacteria 574
140 Ga0157372_10001891 3300013307 Bacteria 22726
141 Ga0157372_10003419 3300013307 Bacteria 17129
142 Ga0157372_10044658 3300013307 Bacteria 4911
143 Ga0157372_10105926 3300013307 Bacteria 3216
144 Ga0157372_10168595 3300013307 Bacteria 2533
145 Ga0157372_10322805 3300013307 Bacteria 1798
146 Ga0157372_10491786 3300013307 Bacteria 1430
147 Ga0157375_10051752 3300013308 Bacteria 4035
148 Ga0157375_10272287 3300013308 Bacteria 1855
149 Ga0163163_10615310 3300014325 Unclassified 1149
150 Ga0157380_10004590 3300014326 Bacteria 9590
151 Ga0157377_10013529 3300014745 Bacteria 4131
152 Ga0157377_10263084 3300014745 Unclassified 1123
153 Ga0163161_10178003 3300017792 Bacteria 1629
154 Ga0163161_11086134 3300017792 Bacteria 687
155 Ga0207680_10131334 3300025903 Unclassified 1651
156 Ga0207680_10241384 3300025903 Unclassified 1245
157 Ga0207647_10063863 3300025904 Unclassified 2238
158 Ga0207645_10024330 3300025907 Unclassified 3928
159 Ga0207645_10103931 3300025907 Bacteria 1834
160 Ga0207643_10456340 3300025908 Unclassified 813
161 Ga0207654_10067258 3300025911 Bacteria 2116
162 Ga0207654_10172465 3300025911 Unclassified 1405
163 Ga0207654_10829183 3300025911 Bacteria 669
164 Ga0207707_10034727 3300025912 Bacteria 4411
165 Ga0207695_10000175 3300025913 Bacteria 188658
166 Ga0207695_10000193 3300025913 Bacteria 172070
167 Ga0207695_10000394 3300025913 Bacteria 98403
168 Ga0207695_10000686 3300025913 Bacteria 66411
169 Ga0207695_10027019 3300025913 Bacteria 6395
170 Ga0207695_10035881 3300025913 Bacteria 5368
171 Ga0207695_10056229 3300025913 Bacteria 4095
172 Ga0207671_10001182 3300025914 Bacteria 31075
173 Ga0207671_10004868 3300025914 Bacteria 12634
174 Ga0207671_10096814 3300025914 Unclassified 2230
175 Ga0207662_10206651 3300025918 Bacteria 1273
176 Ga0207649_11055386 3300025920 Unclassified 640
177 Ga0207649_11163925 3300025920 Bacteria 609
178 Ga0207694_10026366 3300025924 Bacteria 4421
179 Ga0207694_10036665 3300025924 Bacteria 3764
180 Ga0207694_10091199 3300025924 Bacteria 2405
181 Ga0207694_10139496 3300025924 Bacteria 1949
182 Ga0207694_10583737 3300025924 Bacteria 939
183 Ga0207659_10075631 3300025926 Bacteria 2472
184 Ga0207659_10407321 3300025926 Bacteria 1138
185 Ga0207644_10010434 3300025931 Bacteria 6122
186 Ga0207690_10070355 3300025932 Bacteria 2410
187 Ga0207706_10006814 3300025933 Bacteria 10563
188 Ga0207706_11499267 3300025933 Bacteria 550
189 Ga0207686_10345133 3300025934 Bacteria 1119
190 Ga0207704_11193718 3300025938 Unclassified 649
191 Ga0207691_10040773 3300025940 Unclassified 4289
192 Ga0207689_10090382 3300025942 Bacteria 2516
193 Ga0207661_10003137 3300025944 Bacteria 11456
194 Ga0207661_10020858 3300025944 Bacteria 4905
195 Ga0207679_10000561 3300025945 Bacteria 24990
196 Ga0207679_10275570 3300025945 Bacteria 1440
197 Ga0207667_10001698 3300025949 Bacteria 27706
198 Ga0207667_10003771 3300025949 Bacteria 18668
199 Ga0207667_10021675 3300025949 Bacteria 7118
200 Ga0207667_10227392 3300025949 Unclassified 1911
201 Ga0207651_10058179 3300025960 Bacteria 2670
202 Ga0207651_10058580 3300025960 Unclassified 2663
203 Ga0207651_10090408 3300025960 Bacteria 2238
204 Ga0207712_10233309 3300025961 Bacteria 1478
205 Ga0207668_10564962 3300025972 Bacteria 987
206 Ga0207677_10475790 3300026023 Unclassified 1075
207 Ga0207677_10738730 3300026023 Bacteria 876
208 Ga0207677_10942461 3300026023 Bacteria 780
209 Ga0207703_10048451 3300026035 Bacteria 3430
210 Ga0207703_11249148 3300026035 Unclassified 714
211 Ga0207639_10003933 3300026041 Bacteria 10029
212 Ga0207639_10012586 3300026041 Bacteria 5895
213 Ga0207639_10054218 3300026041 Bacteria 3064
214 Ga0207639_11397922 3300026041 Bacteria 657
215 Ga0207708_10441321 3300026075 Bacteria 1082
216 Ga0207702_10017026 3300026078 Bacteria 6014
217 Ga0207702_11580031 3300026078 Bacteria 649
218 Ga0207641_10275328 3300026088 Bacteria 1581
219 Ga0207648_10012546 3300026089 Bacteria 7928
220 Ga0207648_10129598 3300026089 Bacteria 2220
221 Ga0207648_10582396 3300026089 Bacteria 1030
222 Ga0207674_10002677 3300026116 Bacteria 22225
223 Ga0207674_10021361 3300026116 Bacteria 6972
224 Ga0207674_10193859 3300026116 Unclassified 1982
225 Ga0207675_100232368 3300026118 Unclassified 1779
226 Ga0207675_101880494 3300026118 Bacteria 617
227 Ga0207683_10016784 3300026121 Bacteria 6232
228 Ga0207683_10025634 3300026121 Bacteria 5087
229 Ga0207698_10000364 3300026142 Bacteria 26611
230 Ga0207698_10540798 3300026142 Bacteria 1140
231 Ga0207698_10891525 3300026142 Bacteria 896
232 Ga0207698_11997481 3300026142 Unclassified 594
233 Ga0268266_10000016 3300028379 Bacteria 629101
234 Ga0268264_10000080 3300028381 Bacteria 249126
235 Ga0307517_10129264 3300028786 Unclassified 1827
236 Ga0307516_10021700 3300031730 Bacteria 6602
237 Ga0307412_10420562 3300031911 Unclassified 1093
238 Ga0307414_10356660 3300032004 Unclassified 1257
239 Ga0307415_101623235 3300032126 Bacteria 622
240 Ga0373934_0111390 3300035086 Bacteria 1110
241 Ga0373944_0261425 3300035089 Unclassified 641
242 Ga0373954_0443006 3300035118 Bacteria 643
243 Ga0373956_0028979 3300035119 Bacteria 2413
244 Ga0373943_0394017 3300035170 Unclassified 799
245 Ga0373955_0152702 3300035172 Bacteria 1360
246 Ga0373935_0312734 3300035692 Bacteria 1113
247 Ga0373933_0083062 3300035724 Bacteria 1967
248 Ga0373937_0443461 3300036401 Bacteria 1232
249 Ga0395905_1188524 3300037471 Unclassified 666
250 Ga0451800_0038373 3300041459 Bacteria 964
251 Ga0451802_0427002 3300041460 Bacteria 636
252 Ga0451839_1033477 3300041496 Bacteria 783
253 Ga0466972_0000025 3300044658 Bacteria 186601
254 Ga0466965_0167905 3300044683 Bacteria 1153
255 Ga0466964_0018640 3300044706 Bacteria 2665
256 Ga0466970_0000671 3300044765 Bacteria 16793
257 Ga0466970_0343730 3300044765 Unclassified 846
258 Ga0466957_0058886 3300044842 Unclassified 2354
259 Ga0466958_0373505 3300045836 Unclassified 919
260 Ga0495592_0653552 3300046454 Bacteria 636
261 Ga0495638_0127540 3300046460 Bacteria 1498
262 Ga0495653_0379339 3300046463 Bacteria 903
263 Ga0495580_0835507 3300046472 Bacteria 595
264 Ga0495608_0280943 3300046511 Bacteria 1033
265 Ga0495618_0050512 3300046514 Bacteria 2627
266 Ga0495628_0044364 3300046516 Bacteria 3538
267 Ga0495630_0078582 3300046517 Unclassified 2488
268 Ga0495648_0000633 3300046524 Bacteria 37557
269 Ga0495648_0229475 3300046524 Bacteria 910
270 Ga0495587_0048867 3300046536 Bacteria 2505
271 Ga0495598_0192645 3300046537 Unclassified 733
272 Ga0495645_0176082 3300046543 Bacteria 1469
273 Ga0495668_0000172 3300046616 Bacteria 96882
274 Ga0495634_0148471 3300046642 Bacteria 1484
275 Ga0495611_0000010 3300046648 Bacteria 156661
276 Ga0495611_0268291 3300046648 Bacteria 789
277 Ga0495625_0051816 3300046660 Bacteria 2941
278 Ga0495625_0833342 3300046660 Bacteria 534
279 Ga0495599_0341920 3300046678 Bacteria 898
280 Ga0495658_0150366 3300046683 Unclassified 1430
281 Ga0495624_0281176 3300046690 Bacteria 1005
282 Ga0495649_0010228 3300046694 Bacteria 5541
283 Ga0495600_0193635 3300046809 Bacteria 1307
284 Ga0495674_0023254 3300047319 Bacteria 5714
285 Ga0495683_0362178 3300047323 Bacteria 610
286 Ga0495687_000004 3300047443 Bacteria 779298
287 Ga0495684_0257123 3300047471 Bacteria 1268
288 Ga0495686_0000061 3300047472 Bacteria 236734
289 Ga0496114_0483389 3300048917 Unclassified 1096
290 Ga0495682_0100934 3300049460 Unclassified 1035
291 Ga0501292_016681 3300049515 Unclassified 1157
292 Ga0501293_015138 3300049516 Unclassified 707
293 Ga0501298_014217 3300049521 Unclassified 1419
294 Ga0501031_0056215 3300049568 Unclassified 2563
295 Ga0501034_0000111 3300049571 Bacteria 150159
296 Ga0501034_0013417 3300049571 Bacteria 8433
297 Ga0501036_0009047 3300049572 Bacteria 8190
298 Ga0501037_0514658 3300049573 Bacteria 811
299 Ga0501038_0295782 3300049574 Bacteria 1271
300 Ga0501039_0335239 3300049575 Unclassified 1188
301 Ga0501040_0370516 3300049576 Bacteria 1027
302 Ga0501043_0014276 3300049579 Bacteria 6216
303 Ga0501046_0118218 3300049580 Bacteria 2019
304 Ga0501072_0134698 3300049588 Unclassified 1970
305 Ga0501198_020540 3300049649 Unclassified 1047
306 Ga0501201_013688 3300049651 Bacteria 816
307 Ga0501202_009038 3300049652 Unclassified 1824
308 Ga0501202_013579 3300049652 Unclassified 1551
309 Ga0501206_034652 3300049653 Unclassified 761
310 Ga0501207_002367 3300049654 Unclassified 2429
311 Ga0501209_089003 3300049656 Bacteria 896
312 Ga0501217_011433 3300049661 Unclassified 1964
313 Ga0501217_047082 3300049661 Unclassified 1115
314 Ga0501223_036666 3300049663 Unclassified 953
315 Ga0501224_031366 3300049664 Unclassified 796
316 Ga0501228_018116 3300049666 Unclassified 773
317 Ga0501233_054678 3300049668 Bacteria 976
318 Ga0501246_013085 3300049676 Bacteria 786
319 Ga0501253_033331 3300049683 Bacteria 996
320 Ga0501255_081733 3300049684 Unclassified 544
321 Ga0501257_030750 3300049686 Unclassified 1293
322 Ga0501259_003405 3300049688 Unclassified 2538
323 Ga0501260_019695 3300049689 Unclassified 725
324 Ga0501261_012617 3300049690 Unclassified 1139
325 Ga0501225_0025569 3300049705 Unclassified 1623
326 Ga0501234_015884 3300049707 Bacteria 1186
327 Ga0501234_025423 3300049707 Unclassified 950
328 Ga0501245_004378 3300049708 Unclassified 1936
329 Ga0501035_0200865 3300049822 Unclassified 1710
330 Ga0501035_0250333 3300049822 Bacteria 1505
331 Ga0501044_0086913 3300049823 Unclassified 3158
332 nmdc:mga05p37_171877_c1 3300050507 Bacteria 2642
333 Ga0500646_0209402 3300053090 Bacteria 672
334 Ga0500583_0007023 3300053092 Bacteria 3927
335 Ga0500583_0090138 3300053092 Bacteria 1492
336 Ga0500642_0211925 3300053130 Bacteria 899
337 Ga0500568_0060596 3300053139 Bacteria 1465
338 Ga0500616_0021116 3300053153 Unclassified 3655
339 Ga0500622_0003053 3300053156 Bacteria 11571
340 Ga0500637_0108558 3300053178 Bacteria 1610
341 Ga0500611_000027 3300053727 Bacteria 93704
342 Ga0466962_0006052 3300061719 Bacteria 5818
343 2839990249 2839989709 Bacteria 3773432
344 Ga0105237_10000161
345 SwRhRL2b_contig_837821
346 MRS1b_contig_6140196
347 rootH2_10005684
348 rootH2_10021815
349 rootL2_10230187
350 rootH1_10147333
351 Ga0065704_10158252
352 Ga0065712_10091050
353 Ga0065715_10754771
354 Ga0070676_10022207
355 Ga0070676_10108393
356 Ga0070676_10402901
357 Ga0070683_100000569
358 Ga0070683_100005570
359 Ga0070683_100172535
360 Ga0070683_100207905
361 Ga0070677_10063490
362 Ga0068869_100039493
363 Ga0068869_100782197
364 Ga0070666_10012266
365 Ga0070666_10073318
366 Ga0070680_100246187
367 Ga0070682_100000018
368 Ga0070682_100552778
369 Ga0070682_100743071
370 Ga0068868_100028574
371 Ga0068868_100206833
372 Ga0068868_100554176
373 Ga0068868_101074521
374 Ga0070689_100112323
375 Ga0070691_10016499
376 Ga0070687_100160664
377 Ga0070661_100001256
378 Ga0070668_100039596
379 Ga0070668_100221928
380 Ga0070675_100123957
381 Ga0070675_101201701
382 Ga0070671_100001485
383 Ga0070671_100313268
384 Ga0070673_100048792
385 Ga0070673_100062340
386 Ga0070673_100193863
387 Ga0070688_100040738
388 Ga0070688_100457705
389 Ga0070688_100848433
390 Ga0070659_100319259
391 Ga0070667_100183666
392 Ga0070713_100506066
393 Ga0070700_100015168
394 Ga0070678_100025461
395 Ga0070662_100058904
396 Ga0070662_100087175
397 Ga0070662_100240385
398 Ga0070681_10326422
399 Ga0068867_100033035
400 Ga0068867_100621010
401 Ga0070684_100004258
402 Ga0070684_100026359
403 Ga0070684_100322544
404 Ga0068853_100012488
405 Ga0068853_100176752
406 Ga0068853_100231119
407 Ga0068853_100405082
408 Ga0068853_101450919
409 Ga0070672_100072930
410 Ga0070686_100071948
411 Ga0070686_100225023
412 Ga0070665_100000008
413 Ga0068855_100025226
414 Ga0070664_100026810
415 Ga0070664_100116459
416 Ga0070664_100390910
417 Ga0070664_101180015
418 Ga0070664_102009477
419 Ga0068857_100001389
420 Ga0068857_100001441
421 Ga0068854_100302052
422 Ga0068856_100010129
423 Ga0070702_100027817
424 Ga0070702_100433526
425 Ga0068852_100000485
426 Ga0068852_100651577
427 Ga0068852_101383898
428 Ga0068852_101884658
429 Ga0068866_10128676
430 Ga0068866_10339183
431 Ga0068861_100064124
432 Ga0068861_101175027
433 Ga0068851_10178881
434 Ga0068870_10379012
435 Ga0068858_100818253
436 Ga0068860_100000458
437 Ga0068860_100434466
438 Ga0081540_1006986
439 Ga0097621_100495992
440 Ga0105240_10000086
441 Ga0105240_10000105
442 Ga0105240_10008896
443 Ga0105240_10011084
444 Ga0105240_10018412
445 Ga0105240_10026028
446 Ga0105240_10708089
447 Ga0105240_11550856
448 Ga0105245_11671275
449 Ga0105247_10725066
450 Ga0105242_10298761
451 Ga0105242_10380049
452 Ga0105237_10001742
453 Ga0105237_10020081
454 Ga0105238_10001252
455 Ga0105238_10010351
456 Ga0105238_10023404
457 Ga0105238_10160272
458 Ga0105238_10922502
459 Ga0105239_10000215
460 Ga0105239_10000295
461 Ga0105239_10008486
462 Ga0105239_10086873
463 Ga0105239_10605251
464 Ga0105239_10895341
465 Ga0105246_10121098
466 Ga0157373_10037894
467 Ga0157373_10159437
468 Ga0157371_10287777
469 Ga0157370_10037999
470 Ga0157370_10837608
471 Ga0157370_11087160
472 Ga0157369_10006320
473 Ga0157369_11271030
474 Ga0157374_10196622
475 Ga0157374_10715663
476 Ga0157374_11639227
477 Ga0163162_10005707
478 Ga0163162_10042979
479 Ga0163162_10132330
480 Ga0163162_11714341
481 Ga0163162_12103699
482 Ga0163162_12674301
483 Ga0157372_10001891
484 Ga0157372_10003419
485 Ga0157372_10044658
486 Ga0157372_10105926
487 Ga0157372_10168595
488 Ga0157372_10322805
489 Ga0157372_10491786
490 Ga0157375_10051752
491 Ga0157375_10272287
492 Ga0163163_10615310
493 Ga0157380_10004590
494 Ga0157377_10013529
495 Ga0157377_10263084
496 Ga0163161_10178003
497 Ga0163161_11086134
498 Ga0207680_10131334
499 Ga0207680_10241384
500 Ga0207647_10063863
501 Ga0207645_10024330
502 Ga0207645_10103931
503 Ga0207643_10456340
504 Ga0207654_10067258
505 Ga0207654_10172465
506 Ga0207654_10829183
507 Ga0207707_10034727
508 Ga0207695_10000175
509 Ga0207695_10000193
510 Ga0207695_10000394
511 Ga0207695_10000686
512 Ga0207695_10027019
513 Ga0207695_10035881
514 Ga0207695_10056229
515 Ga0207671_10001182
516 Ga0207671_10004868
517 Ga0207671_10096814
518 Ga0207662_10206651
519 Ga0207649_11055386
520 Ga0207649_11163925
521 Ga0207694_10026366
522 Ga0207694_10036665
523 Ga0207694_10091199
524 Ga0207694_10139496
525 Ga0207694_10583737
526 Ga0207659_10075631
527 Ga0207659_10407321
528 Ga0207644_10010434
529 Ga0207690_10070355
530 Ga0207706_10006814
531 Ga0207706_11499267
532 Ga0207686_10345133
533 Ga0207704_11193718
534 Ga0207691_10040773
535 Ga0207689_10090382
536 Ga0207661_10003137
537 Ga0207661_10020858
538 Ga0207679_10000561
539 Ga0207679_10275570
540 Ga0207667_10001698
541 Ga0207667_10003771
542 Ga0207667_10021675
543 Ga0207667_10227392
544 Ga0207651_10058179
545 Ga0207651_10058580
546 Ga0207651_10090408
547 Ga0207712_10233309
548 Ga0207668_10564962
549 Ga0207677_10475790
550 Ga0207677_10738730
551 Ga0207677_10942461
552 Ga0207703_10048451
553 Ga0207703_11249148
554 Ga0207639_10003933
555 Ga0207639_10012586
556 Ga0207639_10054218
557 Ga0207639_11397922
558 Ga0207708_10441321
559 Ga0207702_10017026
560 Ga0207702_11580031
561 Ga0207641_10275328
562 Ga0207648_10012546
563 Ga0207648_10129598
564 Ga0207648_10582396
565 Ga0207674_10002677
566 Ga0207674_10021361
567 Ga0207674_10193859
568 Ga0207675_100232368
569 Ga0207675_101880494
570 Ga0207683_10016784
571 Ga0207683_10025634
572 Ga0207698_10000364
573 Ga0207698_10540798
574 Ga0207698_10891525
575 Ga0207698_11997481
576 Ga0268266_10000016
577 Ga0268264_10000080
578 Ga0307517_10129264
579 Ga0307516_10021700
580 Ga0307412_10420562
581 Ga0307414_10356660
582 Ga0307415_101623235
583 Ga0373934_0111390
584 Ga0373944_0261425
585 Ga0373954_0443006
586 Ga0373956_0028979
587 Ga0373943_0394017
588 Ga0373955_0152702
589 Ga0373935_0312734
590 Ga0373933_0083062
591 Ga0373937_0443461
592 Ga0395905_1188524
593 Ga0451800_0038373
594 Ga0451802_0427002
595 Ga0451839_1033477
596 Ga0466972_0000025
597 Ga0466965_0167905
598 Ga0466964_0018640
599 Ga0466970_0000671
600 Ga0466970_0343730
601 Ga0466957_0058886
602 Ga0466958_0373505
603 Ga0495592_0653552
604 Ga0495638_0127540
605 Ga0495653_0379339
606 Ga0495580_0835507
607 Ga0495608_0280943
608 Ga0495618_0050512
609 Ga0495628_0044364
610 Ga0495630_0078582
611 Ga0495648_0000633
612 Ga0495648_0229475
613 Ga0495587_0048867
614 Ga0495598_0192645
615 Ga0495645_0176082
616 Ga0495668_0000172
617 Ga0495634_0148471
618 Ga0495611_0000010
619 Ga0495611_0268291
620 Ga0495625_0051816
621 Ga0495625_0833342
622 Ga0495599_0341920
623 Ga0495658_0150366
624 Ga0495624_0281176
625 Ga0495649_0010228
626 Ga0495600_0193635
627 Ga0495674_0023254
628 Ga0495683_0362178
629 Ga0495687_000004
630 Ga0495684_0257123
631 Ga0495686_0000061
632 Ga0496114_0483389
633 Ga0495682_0100934
634 Ga0501292_016681
635 Ga0501293_015138
636 Ga0501298_014217
637 Ga0501031_0056215
638 Ga0501034_0000111
639 Ga0501034_0013417
640 Ga0501036_0009047
641 Ga0501037_0514658
642 Ga0501038_0295782
643 Ga0501039_0335239
644 Ga0501040_0370516
645 Ga0501043_0014276
646 Ga0501046_0118218
647 Ga0501072_0134698
648 Ga0501198_020540
649 Ga0501201_013688
650 Ga0501202_009038
651 Ga0501202_013579
652 Ga0501206_034652
653 Ga0501207_002367
654 Ga0501209_089003
655 Ga0501217_011433
656 Ga0501217_047082
657 Ga0501223_036666
658 Ga0501224_031366
659 Ga0501228_018116
660 Ga0501233_054678
661 Ga0501246_013085
662 Ga0501253_033331
663 Ga0501255_081733
664 Ga0501257_030750
665 Ga0501259_003405
666 Ga0501260_019695
667 Ga0501261_012617
668 Ga0501225_0025569
669 Ga0501234_015884
670 Ga0501234_025423
671 Ga0501245_004378
672 Ga0501035_0200865
673 Ga0501035_0250333
674 Ga0501044_0086913
675 nmdc:mga05p37_171877_c1
676 Ga0500646_0209402
677 Ga0500583_0007023
678 Ga0500583_0090138
679 Ga0500642_0211925
680 Ga0500568_0060596
681 Ga0500616_0021116
682 Ga0500622_0003053
683 Ga0500637_0108558
684 Ga0500611_000027
685 Ga0466962_0006052
686 2839990249

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tea-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase double mutant q58e/e73a complexed with 4-hydroxyphenacyl coa 0.8604 34 165
3r3d-assembly1.cif.gz_B-2 crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant t77s complexed with 4-hydroxyphenacyl coa 0.8574 34 165
1sh8-assembly1.cif.gz_B 1.5 a crystal structure of a protein of unknown function pa5026 from pseudomonas aeruginosa, probable thioesterase 0.8492 19 164
3r34-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73d complexed with coa 0.8486 34 164
3r37-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73q complexed with 4-hydroxyphenacyl coa 0.8481 34 164
ID Description Score Start End Superfamily
1yocA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8883 17 164 3.10.129.10
1sh8B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8492 19 164 3.10.129.10
3r32A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8463 28 165 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8281 30 165 3.10.129.10
1yocA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.826 17 164 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2T6CM00-F1-model_v4 Thioesterase 0.9879 8 165 GO:0016020
AF-A0A4Q5R6E9-F1-model_v4 DUF4442 domain-containing protein 0.9872 11 165
AF-A0A1F3QCL5-F1-model_v4 deleted 0.9844 33 165
AF-A0A357Z7F2-F1-model_v4 Thioesterase 0.9836 8 164 GO:0016020
AF-A0A848SZB4-F1-model_v4 DUF4442 domain-containing protein 0.9832 2 165

Map