F415568

General Info

Members Datasets Scaffolds Average Seq Length
343 183 323 132

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10017054|Ga0105237_100170545
Length 159
Sequence MLYITENDLPVLSSSLCFKNKNMWWLYALLSAFFAALXXXFAKLGVKNVDSDLATAIRTVVILIIAWLIAFAKGSVSSIVVLSRQNLLFLCLSGIATGLSWIFYFKALQLGKVSQVAPVDKLSVALAIVLSVLFLGEALSWKNAVGAVLIIAGTLVLIL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
6 2738543023 Pedobacter sp. OK628 Isolate Unclassified
7 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
8 2818991444 Filimonas endophytica 3197 Isolate Unclassified
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
11 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
12 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
13 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
14 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
18 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
19 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
20 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
21 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
22 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
125 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.88
Metatranscriptomes 0
Isolates 6.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 0.58
Rhizosphere 87.76
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_800227 2162886007 Bacteria 26519
2 JGI24739J22299_10015296 3300001989 Bacteria 2787
3 JGI24737J22298_10000018 3300001990 Bacteria 46940
4 JGI24735J21928_10000016 3300002067 Bacteria 157028
5 JGI24735J21928_10159594 3300002067 Bacteria 651
6 rootH1_10003646 3300003316 Bacteria 13039
7 rootH1_10003646 3300003323 Bacteria 25405
8 rootH1_10016375 3300003316 Bacteria 9346
9 rootH2_10163882 3300003320 Bacteria 1366
10 rootL2_10028295 3300003322 Bacteria 1705
11 rootL2_10028296 3300003322 Bacteria 2651
12 rootL2_10174216 3300003322 Bacteria 3580
13 rootL2_10190226 3300003322 Bacteria 1269
14 rootH1_10251106 3300003323 Bacteria 4247
15 Ga0065714_10002915 3300005288 Bacteria 20937
16 Ga0065714_10082001 3300005288 Bacteria 2337
17 Ga0065714_10110755 3300005288 Bacteria 1481
18 Ga0065704_10070586 3300005289 Bacteria 19697
19 Ga0065712_10025059 3300005290 Bacteria 1246
20 Ga0070658_10000028 3300005327 Bacteria 157278
21 Ga0070658_10040893 3300005327 Bacteria 3740
22 Ga0070658_10102088 3300005327 Bacteria 2371
23 Ga0070658_10172699 3300005327 Bacteria 1816
24 Ga0070658_10668783 3300005327 Bacteria 901
25 Ga0070658_11485212 3300005327 Bacteria 588
26 Ga0070680_100029806 3300005336 Bacteria 4380
27 Ga0070682_100035278 3300005337 Bacteria 3053
28 Ga0070682_100043648 3300005337 Bacteria 2773
29 Ga0068868_100778695 3300005338 Bacteria 861
30 Ga0070660_100020369 3300005339 Bacteria 4874
31 Ga0070660_100047033 3300005339 Bacteria 3309
32 Ga0070660_101795617 3300005339 Viruses 522
33 Ga0070691_10150055 3300005341 Bacteria 1194
34 Ga0070661_100038489 3300005344 Bacteria 3482
35 Ga0070675_100016835 3300005354 Bacteria 5805
36 Ga0070674_101979003 3300005356 Viruses 530
37 Ga0070659_100060292 3300005366 Bacteria 2997
38 Ga0070714_101804967 3300005435 Bacteria 597
39 Ga0070678_101504476 3300005456 Bacteria 630
40 Ga0070681_10044202 3300005458 Bacteria 4458
41 Ga0070681_10091409 3300005458 Bacteria 2994
42 Ga0068867_101052798 3300005459 Bacteria 740
43 Ga0070684_100275745 3300005535 Bacteria 1540
44 Ga0068853_100011673 3300005539 Bacteria 7140
45 Ga0068853_100057786 3300005539 Bacteria 3348
46 Ga0068853_100312893 3300005539 Bacteria 1454
47 Ga0068853_100472563 3300005539 Bacteria 1181
48 Ga0070672_100772611 3300005543 Unclassified 844
49 Ga0070665_100845444 3300005548 Bacteria 928
50 Ga0068855_100000052 3300005563 Bacteria 140781
51 Ga0068855_100000354 3300005563 Bacteria 56753
52 Ga0068855_100029860 3300005563 Bacteria 6519
53 Ga0068855_100075139 3300005563 Bacteria 3924
54 Ga0068855_100090811 3300005563 Bacteria 3524
55 Ga0068855_100217769 3300005563 Bacteria 2143
56 Ga0068855_100774803 3300005563 Bacteria 1021
57 Ga0068855_102003784 3300005563 Bacteria 585
58 Ga0070664_100317562 3300005564 Bacteria 1411
59 Ga0070664_101167599 3300005564 Bacteria 726
60 Ga0070664_102201089 3300005564 Bacteria 523
61 Ga0068857_100083069 3300005577 Bacteria 2861
62 Ga0068857_100171178 3300005577 Bacteria 1974
63 Ga0068857_100726019 3300005577 Bacteria 945
64 Ga0068857_100836421 3300005577 Bacteria 880
65 Ga0068854_101322044 3300005578 Bacteria 649
66 Ga0068856_100000005 3300005614 Bacteria 225505
67 Ga0068856_100216781 3300005614 Bacteria 1929
68 Ga0068856_101767430 3300005614 Bacteria 630
69 Ga0068852_100002124 3300005616 Bacteria 13577
70 Ga0068852_100007671 3300005616 Bacteria 7894
71 Ga0068852_100200363 3300005616 Bacteria 1889
72 Ga0068852_100322673 3300005616 Bacteria 1500
73 Ga0068852_100984072 3300005616 Bacteria 862
74 Ga0068852_101198033 3300005616 Bacteria 780
75 Ga0068852_101467168 3300005616 Bacteria 704
76 Ga0068863_100218140 3300005841 Bacteria 1837
77 Ga0068863_101660787 3300005841 Bacteria 648
78 Ga0068863_102182559 3300005841 Bacteria 564
79 Ga0070715_10580178 3300006163 Bacteria 654
80 Ga0075366_10001641 3300006195 Bacteria 11229
81 Ga0075366_10004640 3300006195 Bacteria 7382
82 Ga0075366_10051033 3300006195 Bacteria 2458
83 Ga0105240_10133124 3300009093 Bacteria 2979
84 Ga0105240_10421028 3300009093 Bacteria 1500
85 Ga0105240_10693912 3300009093 Bacteria 1112
86 Ga0105240_11701771 3300009093 Bacteria 658
87 Ga0111539_11004121 3300009094 Bacteria 970
88 Ga0105245_10844773 3300009098 Bacteria 955
89 Ga0105247_10272447 3300009101 Unclassified 1165
90 Ga0105241_10027639 3300009174 Bacteria 4225
91 Ga0105241_10029123 3300009174 Bacteria 4117
92 Ga0105241_10316943 3300009174 Bacteria 1343
93 Ga0105237_10017054 3300009545 Bacteria 7538
94 Ga0105237_10029490 3300009545 Bacteria 5577
95 Ga0105237_10039326 3300009545 Bacteria 4775
96 Ga0105237_10900571 3300009545 Bacteria 892
97 Ga0105249_10236687 3300009553 Bacteria 1803
98 Ga0105249_10893697 3300009553 Bacteria 955
99 Ga0105239_10000001 3300010375 Bacteria 617353
100 Ga0105239_10000280 3300010375 Bacteria 75222
101 Ga0105239_10006704 3300010375 Bacteria 13301
102 Ga0105239_10046660 3300010375 Bacteria 4747
103 Ga0105239_10107356 3300010375 Bacteria 3093
104 Ga0105239_10130366 3300010375 Bacteria 2796
105 Ga0105239_10547952 3300010375 Bacteria 1317
106 Ga0157373_10000116 3300013100 Bacteria 63277
107 Ga0157371_10000178 3300013102 Bacteria 92872
108 Ga0157371_10000355 3300013102 Bacteria 58322
109 Ga0157371_10011979 3300013102 Bacteria 6649
110 Ga0157371_10019418 3300013102 Bacteria 5014
111 Ga0157371_10024190 3300013102 Bacteria 4437
112 Ga0157371_10029151 3300013102 Bacteria 3995
113 Ga0157371_10831265 3300013102 Bacteria 697
114 Ga0157370_10001208 3300013104 Bacteria 32283
115 Ga0157370_10051456 3300013104 Bacteria 3935
116 Ga0157370_10262911 3300013104 Bacteria 1595
117 Ga0157370_10991378 3300013104 Unclassified 761
118 Ga0157369_10048589 3300013105 Bacteria 4603
119 Ga0157369_10072731 3300013105 Bacteria 3690
120 Ga0157369_10099433 3300013105 Bacteria 3101
121 Ga0157369_10133763 3300013105 Bacteria 2626
122 Ga0157369_10188844 3300013105 Bacteria 2165
123 Ga0157374_10035654 3300013296 Bacteria 4552
124 Ga0157374_10059594 3300013296 Bacteria 3570
125 Ga0157374_10097504 3300013296 Bacteria 2813
126 Ga0157374_10295828 3300013296 Bacteria 1601
127 Ga0157374_11006586 3300013296 Bacteria 853
128 Ga0157378_11700800 3300013297 Bacteria 678
129 Ga0157378_12231052 3300013297 Bacteria 599
130 Ga0163162_11978481 3300013306 Bacteria 668
131 Ga0157372_10002489 3300013307 Bacteria 19976
132 Ga0157372_10007153 3300013307 Bacteria 11879
133 Ga0157372_10088777 3300013307 Bacteria 3511
134 Ga0157372_10103840 3300013307 Bacteria 3248
135 Ga0157372_10205760 3300013307 Bacteria 2280
136 Ga0157372_10316008 3300013307 Bacteria 1818
137 Ga0157372_10353585 3300013307 Bacteria 1712
138 Ga0157372_10526207 3300013307 Bacteria 1378
139 Ga0157372_10534708 3300013307 Bacteria 1366
140 Ga0157372_10641186 3300013307 Bacteria 1237
141 Ga0157372_10982158 3300013307 Bacteria 978
142 Ga0157372_11239201 3300013307 Bacteria 861
143 Ga0163163_10068758 3300014325 Unclassified 3525
144 Ga0163163_10417808 3300014325 Bacteria 1400
145 Ga0157380_10067888 3300014326 Bacteria 2872
146 Ga0182008_10050299 3300014497 Bacteria 2068
147 Ga0182008_10254871 3300014497 Bacteria 906
148 Ga0157376_10024129 3300014969 Bacteria 4771
149 Ga0182006_1026190 3300015261 Bacteria 2389
150 Ga0182007_10001266 3300015262 Bacteria 13725
151 Ga0182007_10005588 3300015262 Bacteria 5500
152 Ga0163161_10053248 3300017792 Bacteria 2934
153 Ga0209437_100089 3300025233 Bacteria 250476
154 Ga0209026_1000219 3300025250 Bacteria 78822
155 Ga0209233_1000738 3300025261 Bacteria 14916
156 Ga0209455_1013389 3300025272 Bacteria 1906
157 Ga0209455_1014111 3300025272 Bacteria 1823
158 Ga0207647_10000154 3300025904 Bacteria 54378
159 Ga0207647_10000456 3300025904 Bacteria 33289
160 Ga0207647_10026907 3300025904 Bacteria 3757
161 Ga0207705_10000045 3300025909 Bacteria 180625
162 Ga0207705_10031225 3300025909 Bacteria 3800
163 Ga0207705_10323036 3300025909 Bacteria 1186
164 Ga0207705_10732618 3300025909 Bacteria 768
165 Ga0207654_10323556 3300025911 Bacteria 1055
166 Ga0207707_10035237 3300025912 Bacteria 4377
167 Ga0207707_10400053 3300025912 Bacteria 1179
168 Ga0207695_10021088 3300025913 Bacteria 7442
169 Ga0207671_10069718 3300025914 Bacteria 2620
170 Ga0207671_10534749 3300025914 Bacteria 934
171 Ga0207657_10002190 3300025919 Bacteria 21175
172 Ga0207657_10097941 3300025919 Bacteria 2438
173 Ga0207657_10134545 3300025919 Unclassified 2024
174 Ga0207657_11250851 3300025919 Bacteria 562
175 Ga0207652_10001587 3300025921 Bacteria 20010
176 Ga0207681_10414305 3300025923 Bacteria 1090
177 Ga0207650_10010108 3300025925 Bacteria 6465
178 Ga0207650_10556929 3300025925 Bacteria 961
179 Ga0207659_10337601 3300025926 Bacteria 1247
180 Ga0207690_10037139 3300025932 Bacteria 3161
181 Ga0207690_10043961 3300025932 Bacteria 2943
182 Ga0207669_10184314 3300025937 Bacteria 1500
183 Ga0207661_10181766 3300025944 Bacteria 1838
184 Ga0207661_11041096 3300025944 Bacteria 754
185 Ga0207661_11410356 3300025944 Bacteria 639
186 Ga0207679_10163232 3300025945 Bacteria 1826
187 Ga0207679_10342227 3300025945 Unclassified 1301
188 Ga0207667_10000039 3300025949 Bacteria 278843
189 Ga0207667_10000463 3300025949 Bacteria 54624
190 Ga0207667_10033005 3300025949 Bacteria 5571
191 Ga0207667_10089622 3300025949 Bacteria 3179
192 Ga0207667_10112686 3300025949 Bacteria 2805
193 Ga0207667_10631368 3300025949 Bacteria 1078
194 Ga0207677_10614517 3300026023 Bacteria 955
195 Ga0207639_10007694 3300026041 Bacteria 7355
196 Ga0207639_10114151 3300026041 Bacteria 2207
197 Ga0207639_10190406 3300026041 Bacteria 1752
198 Ga0207639_10289152 3300026041 Bacteria 1444
199 Ga0207702_10000249 3300026078 Bacteria 62542
200 Ga0207702_10232119 3300026078 Bacteria 1725
201 Ga0207702_10534413 3300026078 Bacteria 1146
202 Ga0207702_11733078 3300026078 Bacteria 617
203 Ga0207648_10117895 3300026089 Bacteria 2333
204 Ga0207676_10350230 3300026095 Bacteria 1366
205 Ga0207674_10076253 3300026116 Unclassified 3361
206 Ga0207674_10357890 3300026116 Bacteria 1411
207 Ga0207674_11366437 3300026116 Bacteria 678
208 Ga0207698_10105952 3300026142 Bacteria 2343
209 Ga0207698_10202352 3300026142 Bacteria 1779
210 Ga0207698_10853581 3300026142 Bacteria 916
211 Ga0207698_11477666 3300026142 Bacteria 695
212 Ga0207698_12449210 3300026142 Bacteria 533
213 Ga0307515_10000144 3300028794 Bacteria 170910
214 Ga0307515_10007764 3300028794 Bacteria 21113
215 Ga0307515_10062769 3300028794 Bacteria 5238
216 Ga0265338_10022520 3300028800 Bacteria 6520
217 Ga0265338_10064451 3300028800 Bacteria 3186
218 Ga0265324_10178514 3300029957 Bacteria 721
219 Ga0265327_10000714 3300031251 Bacteria 52495
220 Ga0307508_10568511 3300031616 Unclassified 733
221 Ga0307412_10000018 3300031911 Bacteria 284374
222 Ga0307414_10007335 3300032004 Bacteria 6196
223 Ga0307414_11131605 3300032004 Bacteria 724
224 Ga0307507_10000217 3300033179 Bacteria 109884
225 Ga0373950_0020140 3300034818 Bacteria 1171
226 Ga0373955_0811692 3300035172 Bacteria 575
227 Ga0373933_0074398 3300035724 Bacteria 2072
228 Ga0373937_0073186 3300036401 Bacteria 3161
229 Ga0373937_0694567 3300036401 Bacteria 964
230 Ga0395900_0007398 3300037418 Bacteria 11352
231 Ga0395900_0015509 3300037418 Bacteria 7768
232 Ga0395900_0301820 3300037418 Bacteria 1587
233 Ga0395900_0662099 3300037418 Bacteria 980
234 Ga0395900_1253965 3300037418 Bacteria 656
235 Ga0395905_0007390 3300037471 Bacteria 10923
236 Ga0395905_0177167 3300037471 Bacteria 2001
237 Ga0395905_0504758 3300037471 Bacteria 1110
238 Ga0395905_0762177 3300037471 Bacteria 870
239 Ga0451787_147847 3300041441 Bacteria 796
240 Ga0451833_1412682 3300041491 Bacteria 562
241 Ga0466966_0539075 3300044684 Bacteria 702
242 Ga0453684_0002754 3300044712 Bacteria 41627
243 Ga0466957_0000330 3300044842 Bacteria 23053
244 Ga0495629_0102070 3300046459 Bacteria 2001
245 Ga0495638_0188658 3300046460 Unclassified 1171
246 Ga0495650_0000198 3300046471 Bacteria 130455
247 Ga0495650_0122828 3300046471 Bacteria 954
248 Ga0495580_0020657 3300046472 Bacteria 4871
249 Ga0495582_0084659 3300046473 Bacteria 1763
250 Ga0495639_0018605 3300046475 Bacteria 3027
251 Ga0495585_0000354 3300046492 Bacteria 44420
252 Ga0495585_0007253 3300046492 Bacteria 6807
253 Ga0495583_0158696 3300046506 Bacteria 934
254 Ga0495606_0000003 3300046507 Bacteria 449402
255 Ga0495606_0006183 3300046507 Bacteria 11144
256 Ga0495606_0180807 3300046507 Bacteria 1216
257 Ga0495610_0001577 3300046512 Bacteria 20053
258 Ga0495610_0133182 3300046512 Bacteria 1077
259 Ga0495616_0271936 3300046513 Bacteria 722
260 Ga0495630_0345403 3300046517 Bacteria 1139
261 Ga0495637_0029117 3300046520 Bacteria 2460
262 Ga0495644_0009398 3300046523 Bacteria 3771
263 Ga0495648_0104970 3300046524 Bacteria 1550
264 Ga0495648_0135900 3300046524 Bacteria 1300
265 Ga0495652_0466550 3300046529 Bacteria 881
266 Ga0495652_0889767 3300046529 Bacteria 588
267 Ga0495654_0190237 3300046530 Bacteria 884
268 Ga0495665_0104125 3300046531 Bacteria 1489
269 Ga0495586_0040462 3300046535 Bacteria 2508
270 Ga0495587_0089682 3300046536 Bacteria 1777
271 Ga0495609_0009640 3300046538 Bacteria 4663
272 Ga0495609_0020221 3300046538 Bacteria 3077
273 Ga0495622_0148913 3300046557 Bacteria 1060
274 Ga0495633_0000029 3300046558 Bacteria 200381
275 Ga0495633_0004633 3300046558 Bacteria 8660
276 Ga0495633_0525431 3300046558 Bacteria 533
277 Ga0495668_0000044 3300046616 Bacteria 227585
278 Ga0495625_0000013 3300046660 Bacteria 345151
279 Ga0495625_0000934 3300046660 Bacteria 39261
280 Ga0495625_0015482 3300046660 Bacteria 6039
281 Ga0495625_0042570 3300046660 Bacteria 3299
282 Ga0495625_0294049 3300046660 Bacteria 1041
283 Ga0495661_0001067 3300046665 Bacteria 24211
284 Ga0495661_0002103 3300046665 Bacteria 15631
285 Ga0495657_0859702 3300046675 Bacteria 517
286 Ga0495647_0015844 3300046681 Bacteria 2646
287 Ga0495658_0301544 3300046683 Bacteria 1013
288 Ga0495649_0000010 3300046694 Bacteria 430552
289 Ga0495604_0530613 3300047317 Bacteria 761
290 Ga0495674_0126450 3300047319 Bacteria 2156
291 Ga0495676_0160066 3300047321 Bacteria 1594
292 Ga0495687_000995 3300047443 Bacteria 28431
293 Ga0495687_137034 3300047443 Unclassified 857
294 Ga0495675_0171651 3300047444 Bacteria 1332
295 Ga0495685_036702 3300047447 Bacteria 1682
296 Ga0495681_0136647 3300047470 Bacteria 1039
297 Ga0495686_0000283 3300047472 Bacteria 89298
298 Ga0495686_0009585 3300047472 Bacteria 6961
299 Ga0495686_0025971 3300047472 Bacteria 3835
300 Ga0495686_0039030 3300047472 Bacteria 3035
301 Ga0495686_0075034 3300047472 Bacteria 2074
302 Ga0495686_0097668 3300047472 Bacteria 1775
303 Ga0495593_0317197 3300047673 Bacteria 779
304 Ga0495614_0012850 3300048089 Bacteria 3673
305 Ga0501033_0214763 3300049570 Bacteria 1371
306 Ga0501034_0747497 3300049571 Bacteria 873
307 Ga0501034_0931164 3300049571 Bacteria 755
308 Ga0501036_0007931 3300049572 Bacteria 8687
309 Ga0501037_0080202 3300049573 Bacteria 2368
310 Ga0501038_0014021 3300049574 Bacteria 7305
311 Ga0501080_0042273 3300049742 Bacteria 4244
312 Ga0501044_0001628 3300049823 Bacteria 26315
313 Ga0501045_0000006 3300049824 Bacteria 83115
314 nmdc:mga0k408_207_c1 3300050493 Bacteria 31446
315 nmdc:mga0k408_54324_c1 3300050493 Bacteria 2321
316 nmdc:mga0k408_574_c3 3300050493 Bacteria 6199
317 nmdc:mga08y16_1015842_c1 3300050511 Bacteria 808
318 Ga0500635_0000493 3300053080 Bacteria 10969
319 Ga0495619_0348547 3300053085 Bacteria 1024
320 Ga0500651_0000459 3300053093 Bacteria 21612
321 Ga0500618_041121 3300053125 Bacteria 1061
322 Ga0500622_0001079 3300053156 Bacteria 22688
323 Ga0500622_0181328 3300053156 Bacteria 973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100218140 Ga0068863_1002181403 127
2 3300009101 Ga0105247_10272447 Ga0105247_102724471 127
3 3300009545 Ga0105237_10039326 Ga0105237_100393263 127
4 3300010375 Ga0105239_10006704 Ga0105239_100067048 127
5 3300013296 Ga0157374_10059594 Ga0157374_100595944 127
6 3300013306 Ga0163162_11978481 Ga0163162_119784811 127
7 3300014969 Ga0157376_10024129 Ga0157376_100241294 127
8 3300001989 JGI24739J22299_10015296 JGI24739J22299_100152963 128
9 3300001990 JGI24737J22298_10000018 JGI24737J22298_1000001832 128
10 3300002067 JGI24735J21928_10000016 JGI24735J21928_10000016146 128
11 3300003316 rootH1_10016375 rootH1_100163752 128
12 3300003320 rootH2_10163882 rootH2_101638821 128
13 3300003322 rootL2_10028295 rootL2_100282952 128
14 3300003322 rootL2_10028296 rootL2_100282963 128
15 3300003322 rootL2_10174216 rootL2_101742161 128
16 3300003323 rootH1_10251106 rootH1_102511063 128
17 3300005288 Ga0065714_10082001 Ga0065714_100820013 128
18 3300005288 Ga0065714_10110755 Ga0065714_101107552 128
19 3300005327 Ga0070658_10000028 Ga0070658_1000002836 128
20 3300005327 Ga0070658_10040893 Ga0070658_100408931 128
21 3300005327 Ga0070658_10102088 Ga0070658_101020881 128
22 3300005327 Ga0070658_10172699 Ga0070658_101726992 128
23 3300005336 Ga0070680_100029806 Ga0070680_1000298065 128
24 3300005337 Ga0070682_100035278 Ga0070682_1000352782 128
25 3300005337 Ga0070682_100043648 Ga0070682_1000436484 128
26 3300005338 Ga0068868_100778695 Ga0068868_1007786952 128
27 3300005339 Ga0070660_100020369 Ga0070660_1000203692 128
28 3300005339 Ga0070660_100047033 Ga0070660_1000470332 128
29 3300005341 Ga0070691_10150055 Ga0070691_101500552 128
30 3300005456 Ga0070678_101504476 Ga0070678_1015044761 128
31 3300005458 Ga0070681_10044202 Ga0070681_100442022 128
32 3300005458 Ga0070681_10091409 Ga0070681_100914092 128
33 3300005459 Ga0068867_101052798 Ga0068867_1010527981 128
34 3300005539 Ga0068853_100011673 Ga0068853_1000116733 128
35 3300005539 Ga0068853_100057786 Ga0068853_1000577865 128
36 3300005539 Ga0068853_100312893 Ga0068853_1003128932 128
37 3300005539 Ga0068853_100472563 Ga0068853_1004725633 128
38 3300005548 Ga0070665_100845444 Ga0070665_1008454441 128
39 3300005563 Ga0068855_100029860 Ga0068855_1000298605 128
40 3300005563 Ga0068855_100075139 Ga0068855_1000751393 128
41 3300005563 Ga0068855_100090811 Ga0068855_1000908113 128
42 3300005563 Ga0068855_100217769 Ga0068855_1002177691 128
43 3300005563 Ga0068855_100774803 Ga0068855_1007748031 128
44 3300005563 Ga0068855_102003784 Ga0068855_1020037841 128
45 3300005564 Ga0070664_102201089 Ga0070664_1022010891 128
46 3300005577 Ga0068857_100726019 Ga0068857_1007260192 128
47 3300005578 Ga0068854_101322044 Ga0068854_1013220441 128
48 3300005614 Ga0068856_101767430 Ga0068856_1017674301 128
49 3300005616 Ga0068852_100007671 Ga0068852_1000076712 128
50 3300005616 Ga0068852_100200363 Ga0068852_1002003631 128
51 3300005616 Ga0068852_101198033 Ga0068852_1011980332 128
52 3300006195 Ga0075366_10001641 Ga0075366_1000164111 128
53 3300006195 Ga0075366_10004640 Ga0075366_100046402 128
54 3300006195 Ga0075366_10051033 Ga0075366_100510333 128
55 3300009093 Ga0105240_10133124 Ga0105240_101331242 128
56 3300009093 Ga0105240_10421028 Ga0105240_104210282 128
57 3300009093 Ga0105240_10693912 Ga0105240_106939121 128
58 3300009174 Ga0105241_10027639 Ga0105241_100276394 128
59 3300009174 Ga0105241_10029123 Ga0105241_100291234 128
60 3300009174 Ga0105241_10316943 Ga0105241_103169432 128
61 3300009545 Ga0105237_10029490 Ga0105237_100294902 128
62 3300009553 Ga0105249_10236687 Ga0105249_102366871 128
63 3300009553 Ga0105249_10893697 Ga0105249_108936971 128
64 3300010375 Ga0105239_10000001 Ga0105239_10000001121 128
65 3300010375 Ga0105239_10000280 Ga0105239_1000028049 128
66 3300010375 Ga0105239_10107356 Ga0105239_101073561 128
67 3300010375 Ga0105239_10130366 Ga0105239_101303663 128
68 3300010375 Ga0105239_10547952 Ga0105239_105479522 128
69 3300013102 Ga0157371_10024190 Ga0157371_100241901 128
70 3300013102 Ga0157371_10029151 Ga0157371_100291512 128
71 3300013102 Ga0157371_10831265 Ga0157371_108312651 128
72 3300013104 Ga0157370_10001208 Ga0157370_1000120825 128
73 3300013105 Ga0157369_10048589 Ga0157369_100485895 128
74 3300013105 Ga0157369_10072731 Ga0157369_100727313 128
75 3300013105 Ga0157369_10099433 Ga0157369_100994332 128
76 3300013296 Ga0157374_10097504 Ga0157374_100975042 128
77 3300013296 Ga0157374_10295828 Ga0157374_102958282 128
78 3300013297 Ga0157378_11700800 Ga0157378_117008001 128
79 3300013297 Ga0157378_12231052 Ga0157378_122310521 128
80 3300013307 Ga0157372_10002489 Ga0157372_1000248913 128
81 3300013307 Ga0157372_10205760 Ga0157372_102057604 128
82 3300013307 Ga0157372_10526207 Ga0157372_105262072 128
83 3300013307 Ga0157372_10641186 Ga0157372_106411862 128
84 3300013307 Ga0157372_10982158 Ga0157372_109821582 128
85 3300014325 Ga0163163_10417808 Ga0163163_104178083 128
86 3300017792 Ga0163161_10053248 Ga0163161_100532481 128
87 3300025233 Ga0209437_100089 Ga0209437_10008967 128
88 3300025904 Ga0207647_10026907 Ga0207647_100269074 128
89 3300025909 Ga0207705_10000045 Ga0207705_1000004536 128
90 3300025909 Ga0207705_10031225 Ga0207705_100312252 128
91 3300025909 Ga0207705_10323036 Ga0207705_103230362 128
92 3300025909 Ga0207705_10732618 Ga0207705_107326181 128
93 3300025911 Ga0207654_10323556 Ga0207654_103235562 128
94 3300025912 Ga0207707_10400053 Ga0207707_104000531 128
95 3300025913 Ga0207695_10021088 Ga0207695_100210884 128
96 3300025919 Ga0207657_10097941 Ga0207657_100979412 128
97 3300025919 Ga0207657_10134545 Ga0207657_101345453 128
98 3300025919 Ga0207657_11250851 Ga0207657_112508512 128
99 3300025921 Ga0207652_10001587 Ga0207652_1000158715 128
100 3300025944 Ga0207661_10181766 Ga0207661_101817663 128
101 3300025944 Ga0207661_11041096 Ga0207661_110410961 128
102 3300025949 Ga0207667_10033005 Ga0207667_100330052 128
103 3300025949 Ga0207667_10089622 Ga0207667_100896224 128
104 3300025949 Ga0207667_10112686 Ga0207667_101126865 128
105 3300025949 Ga0207667_10631368 Ga0207667_106313682 128
106 3300026023 Ga0207677_10614517 Ga0207677_106145172 128
107 3300026041 Ga0207639_10007694 Ga0207639_100076944 128
108 3300026041 Ga0207639_10114151 Ga0207639_101141511 128
109 3300026041 Ga0207639_10190406 Ga0207639_101904062 128
110 3300026078 Ga0207702_10534413 Ga0207702_105344132 128
111 3300026089 Ga0207648_10117895 Ga0207648_101178955 128
112 3300026116 Ga0207674_11366437 Ga0207674_113664372 128
113 3300026142 Ga0207698_10202352 Ga0207698_102023522 128
114 3300026142 Ga0207698_10853581 Ga0207698_108535812 128
115 3300028794 Ga0307515_10000144 Ga0307515_1000014467 128
116 3300028794 Ga0307515_10007764 Ga0307515_1000776416 128
117 3300028794 Ga0307515_10062769 Ga0307515_100627691 128
118 3300033179 Ga0307507_10000217 Ga0307507_1000021789 128
119 3300037418 Ga0395900_0007398 Ga0395900_0007398_5496_5909 128
120 3300037418 Ga0395900_0662099 Ga0395900_0662099_311_724 128
121 3300041441 Ga0451787_147847 Ga0451787_147847_294_707 128
122 3300041491 Ga0451833_1412682 Ga0451833_1412682_27_440 128
123 3300044684 Ga0466966_0539075 Ga0466966_0539075_159_572 128
124 3300044842 Ga0466957_0000330 Ga0466957_0000330_11323_11736 128
125 3300046471 Ga0495650_0000198 Ga0495650_0000198_103450_103863 128
126 3300046492 Ga0495585_0000354 Ga0495585_0000354_28922_29335 128
127 3300046492 Ga0495585_0007253 Ga0495585_0007253_6197_6610 128
128 3300046507 Ga0495606_0000003 Ga0495606_0000003_83070_83483 128
129 3300046507 Ga0495606_0006183 Ga0495606_0006183_3598_4011 128
130 3300046507 Ga0495606_0180807 Ga0495606_0180807_427_840 128
131 3300046512 Ga0495610_0001577 Ga0495610_0001577_3506_3919 128
132 3300046512 Ga0495610_0133182 Ga0495610_0133182_166_579 128
133 3300046513 Ga0495616_0271936 Ga0495616_0271936_205_618 128
134 3300046520 Ga0495637_0029117 Ga0495637_0029117_799_1212 128
135 3300046524 Ga0495648_0104970 Ga0495648_0104970_246_659 128
136 3300046524 Ga0495648_0135900 Ga0495648_0135900_30_443 128
137 3300046530 Ga0495654_0190237 Ga0495654_0190237_376_789 128
138 3300046538 Ga0495609_0009640 Ga0495609_0009640_4134_4547 128
139 3300046538 Ga0495609_0020221 Ga0495609_0020221_1075_1488 128
140 3300046557 Ga0495622_0148913 Ga0495622_0148913_479_892 128
141 3300046558 Ga0495633_0000029 Ga0495633_0000029_85313_85726 128
142 3300046558 Ga0495633_0004633 Ga0495633_0004633_6452_6865 128
143 3300046558 Ga0495633_0525431 Ga0495633_0525431_66_479 128
144 3300046616 Ga0495668_0000044 Ga0495668_0000044_179127_179540 128
145 3300046660 Ga0495625_0000013 Ga0495625_0000013_321809_322222 128
146 3300046660 Ga0495625_0000934 Ga0495625_0000934_35950_36363 128
147 3300046660 Ga0495625_0015482 Ga0495625_0015482_5385_5798 128
148 3300046665 Ga0495661_0001067 Ga0495661_0001067_19465_19878 128
149 3300046665 Ga0495661_0002103 Ga0495661_0002103_1735_2148 128
150 3300046683 Ga0495658_0301544 Ga0495658_0301544_350_763 128
151 3300046694 Ga0495649_0000010 Ga0495649_0000010_22930_23343 128
152 3300047443 Ga0495687_000995 Ga0495687_000995_17897_18310 128
153 3300047443 Ga0495687_137034 Ga0495687_137034_195_608 128
154 3300047470 Ga0495681_0136647 Ga0495681_0136647_406_819 128
155 3300047472 Ga0495686_0000283 Ga0495686_0000283_47292_47705 128
156 3300047472 Ga0495686_0009585 Ga0495686_0009585_6405_6818 128
157 3300047472 Ga0495686_0025971 Ga0495686_0025971_2969_3382 128
158 3300047472 Ga0495686_0075034 Ga0495686_0075034_510_923 128
159 3300048089 Ga0495614_0012850 Ga0495614_0012850_218_631 128
160 3300050493 nmdc:mga0k408_207_c1 nmdc:mga0k408_207_c1_18109_18522 128
161 3300050493 nmdc:mga0k408_54324_c1 nmdc:mga0k408_54324_c1_586_999 128
162 3300050493 nmdc:mga0k408_574_c3 nmdc:mga0k408_574_c3_418_834 128
163 3300053080 Ga0500635_0000493 Ga0500635_0000493_8313_8726 128
164 3300053125 Ga0500618_041121 Ga0500618_041121_313_726 128
165 3300053156 Ga0500622_0181328 Ga0500622_0181328_428_841 128
166 3300002067 JGI24735J21928_10159594 JGI24735J21928_101595942 129
167 3300003316 rootH1_10003646 rootH1_100036465 129
168 3300005327 Ga0070658_11485212 Ga0070658_114852121 129
169 3300005366 Ga0070659_100060292 Ga0070659_1000602923 129
170 3300005577 Ga0068857_100083069 Ga0068857_1000830691 129
171 3300005616 Ga0068852_100322673 Ga0068852_1003226733 129
172 3300005616 Ga0068852_101467168 Ga0068852_1014671682 129
173 3300009545 Ga0105237_10900571 Ga0105237_109005711 129
174 3300010375 Ga0105239_10046660 Ga0105239_100466603 129
175 3300013102 Ga0157371_10000178 Ga0157371_1000017849 129
176 3300013102 Ga0157371_10000355 Ga0157371_1000035549 129
177 3300013105 Ga0157369_10188844 Ga0157369_101888442 129
178 3300013307 Ga0157372_10007153 Ga0157372_100071539 129
179 3300025261 Ga0209233_1000738 Ga0209233_100073812 129
180 3300025904 Ga0207647_10000154 Ga0207647_100001545 129
181 3300025914 Ga0207671_10534749 Ga0207671_105347491 129
182 3300025932 Ga0207690_10037139 Ga0207690_100371392 129
183 3300026041 Ga0207639_10289152 Ga0207639_102891521 129
184 3300026116 Ga0207674_10076253 Ga0207674_100762532 129
185 3300026142 Ga0207698_11477666 Ga0207698_114776661 129
186 3300037418 Ga0395900_0301820 Ga0395900_0301820_76_489 129
187 3300044712 Ga0453684_0002754 Ga0453684_0002754_14450_14863 129
188 3300003322 rootL2_10190226 rootL2_101902263 130
189 3300005616 Ga0068852_100984072 Ga0068852_1009840722 130
190 3300049570 Ga0501033_0214763 Ga0501033_0214763_717_1130 130
191 3300005339 Ga0070660_101795617 Ga0070660_1017956171 131
192 3300032004 Ga0307414_11131605 Ga0307414_111316052 131
193 iso_pu_bacteria 2929239360 2929243880 132
194 iso_pu_bacteria 2599185184 2599479020 133
195 iso_pu_bacteria 2738541283 2738757156 133
196 iso_pu_bacteria 2818991444 2819589471 133
197 iso_pu_bacteria 2852623160 2852627015 133
198 iso_pu_bacteria 2884933994 2884935852 133
199 iso_pu_bacteria 2928078545 2928082669 133
200 iso_pu_bacteria 2928147474 2928148747 133
201 iso_pu_bacteria 2932082852 2932086459 133
202 iso_pu_bacteria 2738541273 2738700842 134
203 iso_pu_bacteria 2738543014 2739254591 134
204 iso_pu_bacteria 2738543023 2739299978 134
205 iso_pu_bacteria 2739367866 2740033347 134
206 iso_pu_bacteria 2852627209 2852628287 134
207 iso_pu_bacteria 2919414237 2919418644 135
208 3300025923 Ga0207681_10414305 Ga0207681_104143051 136
209 3300005290 Ga0065712_10025059 Ga0065712_100250592 137
210 3300005327 Ga0070658_10668783 Ga0070658_106687832 137
211 3300005344 Ga0070661_100038489 Ga0070661_1000384894 137
212 3300005354 Ga0070675_100016835 Ga0070675_1000168352 137
213 3300005543 Ga0070672_100772611 Ga0070672_1007726112 137
214 3300005563 Ga0068855_100000354 Ga0068855_10000035444 137
215 3300005564 Ga0070664_101167599 Ga0070664_1011675992 137
216 3300005577 Ga0068857_100171178 Ga0068857_1001711783 137
217 3300005577 Ga0068857_100836421 Ga0068857_1008364212 137
218 3300005614 Ga0068856_100000005 Ga0068856_100000005144 137
219 3300005616 Ga0068852_100002124 Ga0068852_10000212412 137
220 3300005841 Ga0068863_101660787 Ga0068863_1016607872 137
221 3300005841 Ga0068863_102182559 Ga0068863_1021825591 137
222 3300006163 Ga0070715_10580178 Ga0070715_105801781 137
223 3300009093 Ga0105240_11701771 Ga0105240_117017712 137
224 3300009094 Ga0111539_11004121 Ga0111539_110041211 137
225 3300009098 Ga0105245_10844773 Ga0105245_108447732 137
226 3300009545 Ga0105237_10017054 Ga0105237_100170545 137
227 3300013102 Ga0157371_10019418 Ga0157371_100194182 137
228 3300013104 Ga0157370_10051456 Ga0157370_100514564 137
229 3300013104 Ga0157370_10991378 Ga0157370_109913782 137
230 3300013105 Ga0157369_10133763 Ga0157369_101337633 137
231 3300013296 Ga0157374_10035654 Ga0157374_100356543 137
232 3300013307 Ga0157372_10088777 Ga0157372_100887773 137
233 3300013307 Ga0157372_10103840 Ga0157372_101038403 137
234 3300013307 Ga0157372_10316008 Ga0157372_103160082 137
235 3300013307 Ga0157372_10353585 Ga0157372_103535852 137
236 3300013307 Ga0157372_10534708 Ga0157372_105347083 137
237 3300013307 Ga0157372_11239201 Ga0157372_112392012 137
238 3300014325 Ga0163163_10068758 Ga0163163_100687583 137
239 3300014326 Ga0157380_10067888 Ga0157380_100678882 137
240 3300025272 Ga0209455_1014111 Ga0209455_10141112 137
241 3300025904 Ga0207647_10000456 Ga0207647_1000045611 137
242 3300025912 Ga0207707_10035237 Ga0207707_100352375 137
243 3300025914 Ga0207671_10069718 Ga0207671_100697181 137
244 3300025919 Ga0207657_10002190 Ga0207657_100021903 137
245 3300025925 Ga0207650_10010108 Ga0207650_100101083 137
246 3300025925 Ga0207650_10556929 Ga0207650_105569292 137
247 3300025926 Ga0207659_10337601 Ga0207659_103376012 137
248 3300025932 Ga0207690_10043961 Ga0207690_100439613 137
249 3300025937 Ga0207669_10184314 Ga0207669_101843143 137
250 3300025945 Ga0207679_10342227 Ga0207679_103422271 137
251 3300025949 Ga0207667_10000463 Ga0207667_1000046317 137
252 3300026078 Ga0207702_10000249 Ga0207702_1000024957 137
253 3300026078 Ga0207702_11733078 Ga0207702_117330782 137
254 3300026116 Ga0207674_10357890 Ga0207674_103578902 137
255 3300026142 Ga0207698_10105952 Ga0207698_101059523 137
256 3300028800 Ga0265338_10064451 Ga0265338_100644511 137
257 3300031251 Ga0265327_10000714 Ga0265327_1000071410 137
258 3300034818 Ga0373950_0020140 Ga0373950_0020140_625_1038 137
259 3300035172 Ga0373955_0811692 Ga0373955_0811692_99_512 137
260 3300035724 Ga0373933_0074398 Ga0373933_0074398_372_785 137
261 3300036401 Ga0373937_0073186 Ga0373937_0073186_1272_1685 137
262 3300036401 Ga0373937_0694567 Ga0373937_0694567_467_880 137
263 3300037418 Ga0395900_0015509 Ga0395900_0015509_33_446 137
264 3300037418 Ga0395900_1253965 Ga0395900_1253965_110_523 137
265 3300037471 Ga0395905_0007390 Ga0395905_0007390_2780_3193 137
266 3300037471 Ga0395905_0177167 Ga0395905_0177167_1402_1815 137
267 3300037471 Ga0395905_0504758 Ga0395905_0504758_52_531 137
268 3300037471 Ga0395905_0762177 Ga0395905_0762177_382_795 137
269 3300046459 Ga0495629_0102070 Ga0495629_0102070_1216_1629 137
270 3300046460 Ga0495638_0188658 Ga0495638_0188658_85_498 137
271 3300046471 Ga0495650_0122828 Ga0495650_0122828_393_809 137
272 3300046472 Ga0495580_0020657 Ga0495580_0020657_4272_4685 137
273 3300046473 Ga0495582_0084659 Ga0495582_0084659_763_1176 137
274 3300046475 Ga0495639_0018605 Ga0495639_0018605_1198_1611 137
275 3300046506 Ga0495583_0158696 Ga0495583_0158696_370_786 137
276 3300046517 Ga0495630_0345403 Ga0495630_0345403_320_733 137
277 3300046523 Ga0495644_0009398 Ga0495644_0009398_806_1219 137
278 3300046529 Ga0495652_0889767 Ga0495652_0889767_62_475 137
279 3300046531 Ga0495665_0104125 Ga0495665_0104125_168_581 137
280 3300046535 Ga0495586_0040462 Ga0495586_0040462_1874_2287 137
281 3300046536 Ga0495587_0089682 Ga0495587_0089682_728_1141 137
282 3300046660 Ga0495625_0042570 Ga0495625_0042570_1558_1974 137
283 3300046675 Ga0495657_0859702 Ga0495657_0859702_37_450 137
284 3300046681 Ga0495647_0015844 Ga0495647_0015844_486_899 137
285 3300047317 Ga0495604_0530613 Ga0495604_0530613_225_638 137
286 3300047319 Ga0495674_0126450 Ga0495674_0126450_516_929 137
287 3300047321 Ga0495676_0160066 Ga0495676_0160066_227_640 137
288 3300047444 Ga0495675_0171651 Ga0495675_0171651_899_1312 137
289 3300047447 Ga0495685_036702 Ga0495685_036702_1048_1461 137
290 3300047472 Ga0495686_0039030 Ga0495686_0039030_709_1122 137
291 3300047472 Ga0495686_0097668 Ga0495686_0097668_1067_1480 137
292 3300047673 Ga0495593_0317197 Ga0495593_0317197_203_616 137
293 3300049571 Ga0501034_0931164 Ga0501034_0931164_327_740 137
294 3300049742 Ga0501080_0042273 Ga0501080_0042273_343_756 137
295 3300050511 nmdc:mga08y16_1015842_c1 nmdc:mga08y16_1015842_c1_114_527 137
296 3300053085 Ga0495619_0348547 Ga0495619_0348547_541_954 137
297 3300053156 Ga0500622_0001079 Ga0500622_0001079_17508_17924 137
298 iso_pu_bacteria 2864997549 2864998183 137
299 iso_pu_bacteria 2889295896 2889299153 137
300 iso_pu_bacteria 2981284811 2981288456 137
301 iso_pu_bacteria 2981289755 2981293278 137
302 iso_pu_bacteria 2981980479 2981984037 137
303 iso_pu_bacteria 2981985349 2981988961 137
304 2162886007 SwRhRL2b_contig_800227 SwRhRL2b_0619.00005540 138
305 3300005288 Ga0065714_10002915 Ga0065714_100029152 138
306 3300005289 Ga0065704_10070586 Ga0065704_1007058615 138
307 3300005356 Ga0070674_101979003 Ga0070674_1019790031 138
308 3300005435 Ga0070714_101804967 Ga0070714_1018049671 138
309 3300005535 Ga0070684_100275745 Ga0070684_1002757452 138
310 3300005563 Ga0068855_100000052 Ga0068855_10000005281 138
311 3300005564 Ga0070664_100317562 Ga0070664_1003175622 138
312 3300005614 Ga0068856_100216781 Ga0068856_1002167813 138
313 3300013100 Ga0157373_10000116 Ga0157373_100001165 138
314 3300013102 Ga0157371_10011979 Ga0157371_100119794 138
315 3300013104 Ga0157370_10262911 Ga0157370_102629111 138
316 3300013296 Ga0157374_11006586 Ga0157374_110065862 138
317 3300014497 Ga0182008_10050299 Ga0182008_100502992 138
318 3300014497 Ga0182008_10254871 Ga0182008_102548712 138
319 3300015261 Ga0182006_1026190 Ga0182006_10261902 138
320 3300015262 Ga0182007_10001266 Ga0182007_1000126613 138
321 3300015262 Ga0182007_10005588 Ga0182007_100055884 138
322 3300025250 Ga0209026_1000219 Ga0209026_100021932 138
323 3300025272 Ga0209455_1013389 Ga0209455_10133892 138
324 3300025944 Ga0207661_11410356 Ga0207661_114103561 138
325 3300025945 Ga0207679_10163232 Ga0207679_101632321 138
326 3300025949 Ga0207667_10000039 Ga0207667_10000039216 138
327 3300026078 Ga0207702_10232119 Ga0207702_102321193 138
328 3300026095 Ga0207676_10350230 Ga0207676_103502302 138
329 3300026142 Ga0207698_12449210 Ga0207698_124492101 138
330 3300028800 Ga0265338_10022520 Ga0265338_100225203 138
331 3300029957 Ga0265324_10178514 Ga0265324_101785141 138
332 3300031616 Ga0307508_10568511 Ga0307508_105685111 138
333 3300031911 Ga0307412_10000018 Ga0307412_1000001835 138
334 3300032004 Ga0307414_10007335 Ga0307414_100073353 138
335 3300046529 Ga0495652_0466550 Ga0495652_0466550_413_829 138
336 3300046660 Ga0495625_0294049 Ga0495625_0294049_189_605 138
337 3300049571 Ga0501034_0747497 Ga0501034_0747497_236_652 138
338 3300049572 Ga0501036_0007931 Ga0501036_0007931_5855_6271 138
339 3300049573 Ga0501037_0080202 Ga0501037_0080202_1161_1577 138
340 3300049574 Ga0501038_0014021 Ga0501038_0014021_6226_6642 138
341 3300049823 Ga0501044_0001628 Ga0501044_0001628_14367_14783 138
342 3300049824 Ga0501045_0000006 Ga0501045_0000006_68560_68976 138
343 3300053093 Ga0500651_0000459 Ga0500651_0000459_15651_16067 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

22

159

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.9184 14 135
5i20-assembly2.cif.gz_B crystal structure of protein 0.8551 61 132
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.8115 14 135
2yfc-assembly1.cif.gz_B structural and functional insights of dr2231 protein, the mazg-like nucleoside triphosphate pyrophosphohydrolase from deinococcus radiodurans, complexed with mn and dump 0.6541 84 135
5hva-assembly1.cif.gz_A crystal structure of dr2231 in complex with dumpnpp and magnesium. 0.6537 84 135
ID Description Score Start End Superfamily
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8215 13 135 1.20.1740.10
af_Q8RWH8_5_118_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8214 74 135 1.10.3730.20
af_Q2FUS1_154_287_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8137 4 134 1.25.10.10
af_P27844_148_285_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7839 4 134 1.25.10.10
af_Q2FUS1_154_287_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7822 4 134 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A7H8W3I2-F1-model_v4 EamA family transporter 0.9729 1 138 GO:0016020
AF-A0A0X8JIY0-F1-model_v4 EamA domain-containing protein 0.9719 1 136 GO:0016020
AF-A0A519VE27-F1-model_v4 EamA family transporter 0.971 1 136 GO:0016020
AF-A0A2R3MXU3-F1-model_v4 EamA domain-containing protein 0.969 1 136 GO:0016020
AF-A0A512RPW6-F1-model_v4 Membrane protein 0.9686 1 136 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.38 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map