F415670

General Info

Members Datasets Scaffolds Average Seq Length
343 213 686 302

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0000336|Ga0395898_0000336_52262_53224
Length 320
Sequence MKQPSNGNSPTQASPMTHDGFNLRIGINPIGWSNDDLPSLGGETPLSTALSEGREIGYQGFELGNKFPREPAALRQLMAGYGLEVVSGWYSGCLAARSVEEEIAAVEPHLRLLAENGCKVMVYGEVADSIQGERRIPLNKRPRFRDEDAFKRYGDRLTAFGRHLLGHGVRLAYHHHMGAYVEAPADIDRLMLHTGEDVGLLFDSGHAYFGGGDPVAMLSKHIDRVCHVHCKDVRPAIVRHARNRHWSFLDSVLNGVFTVPGDGAIDFAGIVAVLRTHRYHGWLVVEAEQDPALAPSYAYAQKGYRTLRALVDGAPLQEVA

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
107 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
108 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
109 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
110 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
111 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
114 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
117 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
200 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
201 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
202 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
203 2643221593 Lysobacter sp. Root690 Isolate Unclassified
204 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
205 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
206 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
207 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
208 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
209 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
210 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
211 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
212 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
213 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.63
Metatranscriptomes 0
Isolates 4.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.16
Nodule 1.46
Rhizoplane 4.66
Rhizosphere 67.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0000336 3300037466 Bacteria 106457
2 JGI25156J39149_1000831 3300002705 Bacteria 15594
3 JGI25156J39149_1001033 3300002705 Bacteria 12987
4 JGI25156J39149_1001077 3300002705 Bacteria 12517
5 JGI25156J39149_1002462 3300002705 Bacteria 6622
6 JGI25162J39368_1002225 3300002737 Bacteria 7964
7 JGI25157J39369_1000115 3300002741 Bacteria 68467
8 JGI25157J39369_1000816 3300002741 Bacteria 15579
9 JGI25157J39369_1001349 3300002741 Bacteria 9682
10 JGI25164J39214_1000111 3300002772 Bacteria 78179
11 JGI25151J46595_10000214 3300003187 Bacteria 69921
12 JGI25165J46597_1000103 3300003214 Bacteria 153193
13 rootL2_10037632 3300003322 Bacteria 2165
14 rootL2_10037633 3300003322 Bacteria 4746
15 JGI25160J50197_1001191 3300003354 Bacteria 13257
16 Ga0055539_1005936 3300003752 Bacteria 1573
17 Ga0055525_1000055 3300003759 Bacteria 215181
18 Ga0055527_1000068 3300003760 Bacteria 87357
19 Ga0055527_1000129 3300003760 Bacteria 53184
20 Ga0055527_1000137 3300003760 Bacteria 52010
21 Ga0055535_1000081 3300003761 Bacteria 107148
22 Ga0055535_1000112 3300003761 Bacteria 87296
23 Ga0055535_1000312 3300003761 Bacteria 49164
24 Ga0055535_1001018 3300003761 Bacteria 17808
25 Ga0055542_1000093 3300003762 Bacteria 120262
26 Ga0055542_1000113 3300003762 Bacteria 107148
27 Ga0055542_1000154 3300003762 Bacteria 87295
28 Ga0055542_1000217 3300003762 Bacteria 70030
29 Ga0055529_1000067 3300003763 Bacteria 165941
30 Ga0055529_1000104 3300003763 Bacteria 126692
31 Ga0055529_1000389 3300003763 Bacteria 47286
32 Ga0065165_1000679 3300005262 Bacteria 49025
33 Ga0070658_10003155 3300005327 Bacteria 13601
34 Ga0070666_10022585 3300005335 Bacteria 4087
35 Ga0070689_100241384 3300005340 Bacteria 1488
36 Ga0070687_100100255 3300005343 Bacteria 1620
37 Ga0070674_100469768 3300005356 Bacteria 1042
38 Ga0070659_100163785 3300005366 Bacteria 1819
39 Ga0070714_100002894 3300005435 Bacteria 12705
40 Ga0070714_100115580 3300005435 Bacteria 2381
41 Ga0070713_100026010 3300005436 Bacteria 4587
42 Ga0070713_100191622 3300005436 Bacteria 1842
43 Ga0070711_100023932 3300005439 Bacteria 3979
44 Ga0070700_100373675 3300005441 Bacteria 1064
45 Ga0070663_100104842 3300005455 Bacteria 2115
46 Ga0070662_100202198 3300005457 Bacteria 1577
47 Ga0070681_10001458 3300005458 Bacteria 20859
48 Ga0070706_100489045 3300005467 Bacteria 1145
49 Ga0070679_100116632 3300005530 Bacteria 2655
50 Ga0070684_100132469 3300005535 Bacteria 2249
51 Ga0068853_100015811 3300005539 Bacteria 6197
52 Ga0068857_100009051 3300005577 Bacteria 8637
53 Ga0068856_100042324 3300005614 Bacteria 4480
54 Ga0081538_10014820 3300005981 Bacteria 6077
55 Ga0070717_10047252 3300006028 Bacteria 3526
56 Ga0075428_100435516 3300006844 Bacteria 1405
57 Ga0075431_100515899 3300006847 Bacteria 1185
58 Ga0105240_10000179 3300009093 Bacteria 128695
59 Ga0105240_10000346 3300009093 Bacteria 86815
60 Ga0105240_10230365 3300009093 Bacteria 2153
61 Ga0114129_10000156 3300009147 Bacteria 72734
62 Ga0114129_10314493 3300009147 Bacteria 2084
63 Ga0114129_10546670 3300009147 Bacteria 1507
64 Ga0105237_10098162 3300009545 Bacteria 2920
65 Ga0105238_10159314 3300009551 Bacteria 2232
66 Ga0105147_102240 3300009982 Bacteria 1598
67 Ga0105239_10000273 3300010375 Bacteria 75974
68 Ga0105246_10234807 3300011119 Bacteria 1446
69 Ga0157373_10023536 3300013100 Bacteria 4464
70 Ga0157371_10024701 3300013102 Bacteria 4384
71 Ga0157369_10000149 3300013105 Bacteria 99754
72 Ga0157380_10137247 3300014326 Bacteria 2095
73 Ga0157380_10471318 3300014326 Bacteria 1212
74 Ga0182007_10016142 3300015262 Bacteria 2764
75 Ga0183361_10014 3300016635 Bacteria 171033
76 Ga0213872_10041653 3300021361 Bacteria 2095
77 Ga0209674_100059 3300025226 Bacteria 282517
78 Ga0209672_100004 3300025228 Bacteria 1467504
79 Ga0209672_100008 3300025228 Bacteria 946876
80 Ga0209672_100212 3300025228 Bacteria 45556
81 Ga0209672_101558 3300025228 Bacteria 7846
82 Ga0209563_100076 3300025230 Bacteria 215269
83 Ga0207427_100155 3300025231 Bacteria 78235
84 Ga0209437_100186 3300025233 Bacteria 126133
85 Ga0209258_100003 3300025242 Bacteria 1467504
86 Ga0209258_100004 3300025242 Bacteria 1376422
87 Ga0209258_100008 3300025242 Bacteria 1009355
88 Ga0209258_100057 3300025242 Bacteria 334259
89 Ga0209258_100106 3300025242 Bacteria 206622
90 Ga0207425_1000732 3300025245 Bacteria 17322
91 Ga0209646_1004424 3300025246 Bacteria 2563
92 Ga0209026_1000010 3300025250 Bacteria 511986
93 Ga0209026_1000081 3300025250 Bacteria 196861
94 Ga0209026_1000797 3300025250 Bacteria 17218
95 Ga0209677_103591 3300025253 Bacteria 4924
96 Ga0209148_1000025 3300025254 Bacteria 663262
97 Ga0209148_1000042 3300025254 Bacteria 464111
98 Ga0209148_1000068 3300025254 Bacteria 335510
99 Ga0209148_1000200 3300025254 Bacteria 107200
100 Ga0209759_1000117 3300025256 Bacteria 141785
101 Ga0209759_1001022 3300025256 Bacteria 18779
102 Ga0209759_1010733 3300025256 Bacteria 2662
103 Ga0209233_1000265 3300025261 Bacteria 78235
104 Ga0209455_1000004 3300025272 Bacteria 1467504
105 Ga0209455_1000007 3300025272 Bacteria 1157983
106 Ga0209455_1000016 3300025272 Bacteria 753097
107 Ga0209455_1000103 3300025272 Bacteria 201664
108 Ga0209455_1019560 3300025272 Bacteria 1364
109 Ga0209025_1000005 3300025294 Bacteria 1272149
110 Ga0209564_1012773 3300025295 Bacteria 3629
111 Ga0207426_1000432 3300025302 Bacteria 68470
112 Ga0207692_10118089 3300025898 Bacteria 1481
113 Ga0207699_10099820 3300025906 Bacteria 1840
114 Ga0207684_10568545 3300025910 Bacteria 969
115 Ga0207707_10086240 3300025912 Bacteria 2744
116 Ga0207695_10000100 3300025913 Bacteria 258626
117 Ga0207695_10000265 3300025913 Bacteria 132524
118 Ga0207695_10063328 3300025913 Bacteria 3814
119 Ga0207662_10034861 3300025918 Bacteria 2938
120 Ga0207652_10119900 3300025921 Bacteria 2340
121 Ga0207681_10050992 3300025923 Bacteria 2802
122 Ga0207681_10183644 3300025923 Bacteria 1595
123 Ga0207694_10254034 3300025924 Bacteria 1439
124 Ga0207700_10037809 3300025928 Bacteria 3499
125 Ga0207706_10131685 3300025933 Bacteria 2199
126 Ga0207670_10120708 3300025936 Bacteria 1905
127 Ga0207639_10018850 3300026041 Bacteria 4911
128 Ga0207678_10134234 3300026067 Bacteria 2112
129 Ga0207702_10001305 3300026078 Bacteria 24986
130 Ga0207674_10004329 3300026116 Bacteria 17120
131 Ga0207675_100049285 3300026118 Bacteria 3931
132 Ga0207675_100376035 3300026118 Bacteria 1396
133 Ga0209971_1010641 3300027682 Bacteria 2179
134 Ga0307515_10327972 3300028794 Bacteria 1192
135 Ga0307408_100013863 3300031548 Bacteria 5351
136 Ga0307408_100119008 3300031548 Bacteria 2043
137 Ga0307405_10008504 3300031731 Bacteria 5208
138 Ga0307405_10038905 3300031731 Bacteria 2870
139 Ga0307413_10000009 3300031824 Bacteria 62408
140 Ga0307410_10000430 3300031852 Bacteria 16734
141 Ga0307410_10023957 3300031852 Bacteria 3806
142 Ga0307410_10069687 3300031852 Bacteria 2433
143 Ga0307410_10073338 3300031852 Bacteria 2380
144 Ga0307406_10013573 3300031901 Bacteria 4669
145 Ga0307407_10020024 3300031903 Bacteria 3418
146 Ga0307409_100033393 3300031995 Bacteria 3744
147 Ga0307409_100048241 3300031995 Bacteria 3238
148 Ga0307416_100002147 3300032002 Bacteria 11164
149 Ga0307416_100053616 3300032002 Bacteria 3236
150 Ga0307416_100255190 3300032002 Bacteria 1710
151 Ga0307416_100277656 3300032002 Bacteria 1650
152 Ga0307414_10062554 3300032004 Bacteria 2642
153 Ga0307411_10000058 3300032005 Bacteria 32882
154 Ga0307411_10001324 3300032005 Bacteria 9976
155 Ga0307411_10002070 3300032005 Bacteria 8626
156 Ga0307415_100011716 3300032126 Bacteria 5033
157 Ga0395899_0008349 3300037312 Bacteria 7973
158 Ga0395899_0046594 3300037312 Bacteria 3229
159 Ga0395900_0152013 3300037418 Bacteria 2364
160 Ga0395898_0000029 3300037466 Bacteria 370667
161 Ga0395898_0001642 3300037466 Bacteria 30276
162 Ga0395905_0000206 3300037471 Bacteria 91775
163 Ga0395901_0014374 3300038443 Bacteria 8057
164 Ga0436361_0236139 3300039447 Bacteria 2038
165 Ga0439461_0001347 3300041410 Bacteria 3781
166 Ga0439433_0012740 3300041999 Bacteria 1845
167 Ga0439454_010321 3300042011 Bacteria 1229
168 Ga0450896_003608 3300042133 Bacteria 2065
169 Ga0450898_001938 3300042134 Bacteria 2819
170 Ga0450899_002188 3300042135 Bacteria 2131
171 Ga0439446_0005346 3300042156 Bacteria 3300
172 Ga0439446_0015412 3300042156 Bacteria 2120
173 Ga0450908_002078 3300042184 Bacteria 3920
174 Ga0439434_0000191 3300042435 Bacteria 16808
175 Ga0439435_0006483 3300042436 Bacteria 2632
176 Ga0439444_0000576 3300042437 Bacteria 4195
177 Ga0439459_0004297 3300042438 Bacteria 2288
178 Ga0439460_0021920 3300042461 Bacteria 1749
179 Ga0466969_0000876 3300044656 Bacteria 16310
180 Ga0466969_0003614 3300044656 Bacteria 8231
181 Ga0466965_0001105 3300044683 Bacteria 10524
182 Ga0466966_0040377 3300044684 Bacteria 3003
183 Ga0466961_0000103 3300044693 Bacteria 55501
184 Ga0466961_0000387 3300044693 Bacteria 28307
185 Ga0466961_0032021 3300044693 Bacteria 3379
186 Ga0453684_0391564 3300044712 Bacteria 1558
187 Ga0466971_0023153 3300044719 Bacteria 2768
188 Ga0466970_0001434 3300044765 Bacteria 11535
189 Ga0466970_0075532 3300044765 Bacteria 1815
190 Ga0466957_0036042 3300044842 Bacteria 2971
191 Ga0466957_0164442 3300044842 Bacteria 1443
192 Ga0466959_0000006 3300045049 Bacteria 192678
193 Ga0466959_0046823 3300045049 Bacteria 3182
194 Ga0466958_0025127 3300045836 Bacteria 3509
195 Ga0466958_0084666 3300045836 Bacteria 1955
196 Ga0466967_0009969 3300045976 Bacteria 7092
197 Ga0495603_0020325 3300046455 Bacteria 4024
198 Ga0495638_0000060 3300046460 Bacteria 190580
199 Ga0495580_0000344 3300046472 Bacteria 37930
200 Ga0495664_0002924 3300046477 Bacteria 9220
201 Ga0495583_0003347 3300046506 Bacteria 12355
202 Ga0495652_0227806 3300046529 Bacteria 1396
203 Ga0495623_0129060 3300046679 Bacteria 1516
204 Ga0495589_0036481 3300046794 Bacteria 2464
205 Ga0495600_0125518 3300046809 Bacteria 1669
206 Ga0495581_0005299 3300047315 Bacteria 7460
207 Ga0495674_0023857 3300047319 Bacteria 5630
208 Ga0495674_0050664 3300047319 Bacteria 3663
209 Ga0495672_0017217 3300047320 Bacteria 4838
210 Ga0495677_0037438 3300047445 Bacteria 1772
211 Ga0495673_0010019 3300047469 Bacteria 5190
212 Ga0496100_0003501 3300048903 Bacteria 8197
213 Ga0496100_0029410 3300048903 Bacteria 3398
214 Ga0496100_0039905 3300048903 Bacteria 2983
215 Ga0496101_0005300 3300048904 Bacteria 8213
216 Ga0496101_0033180 3300048904 Bacteria 3639
217 Ga0496102_0002574 3300048905 Bacteria 15465
218 Ga0496103_0001740 3300048906 Bacteria 14220
219 Ga0496103_0071212 3300048906 Bacteria 2176
220 Ga0496104_0006865 3300048907 Bacteria 10036
221 Ga0496105_0002161 3300048908 Bacteria 14235
222 Ga0496106_0022513 3300048909 Bacteria 4683
223 Ga0496107_0146294 3300048910 Bacteria 1747
224 Ga0496112_0018066 3300048915 Bacteria 6637
225 Ga0496112_0194555 3300048915 Bacteria 1989
226 Ga0496113_0038629 3300048916 Bacteria 3510
227 Ga0496115_0105367 3300048918 Bacteria 2314
228 Ga0496116_0031544 3300048919 Bacteria 3792
229 Ga0496117_0004871 3300048920 Bacteria 14488
230 Ga0496117_0019398 3300048920 Bacteria 5585
231 Ga0496117_0022901 3300048920 Bacteria 5001
232 Ga0496118_0001566 3300048921 Bacteria 33975
233 Ga0496118_0005247 3300048921 Bacteria 14811
234 Ga0496118_0009396 3300048921 Bacteria 9882
235 Ga0496119_0000135 3300048922 Bacteria 103577
236 Ga0496119_0002269 3300048922 Bacteria 21378
237 Ga0496120_0000013 3300048923 Bacteria 331109
238 Ga0496120_0000311 3300048923 Bacteria 80971
239 Ga0496121_0000162 3300048924 Bacteria 145682
240 Ga0496121_0008730 3300048924 Bacteria 11827
241 Ga0496121_0014463 3300048924 Bacteria 8369
242 Ga0496121_0014860 3300048924 Bacteria 8213
243 Ga0496122_0071513 3300048925 Bacteria 2472
244 Ga0496126_0001671 3300048929 Bacteria 33293
245 Ga0496126_0263247 3300048929 Bacteria 1433
246 Ga0495682_0004246 3300049460 Bacteria 6194
247 Ga0501031_0108878 3300049568 Bacteria 1809
248 Ga0501031_0112844 3300049568 Bacteria 1775
249 Ga0501032_0067800 3300049569 Bacteria 2383
250 Ga0501032_0178626 3300049569 Bacteria 1390
251 Ga0501033_0011402 3300049570 Bacteria 6803
252 Ga0501033_0019155 3300049570 Bacteria 5175
253 Ga0501034_0576494 3300049571 Bacteria 1032
254 Ga0501036_0082090 3300049572 Bacteria 2724
255 Ga0501036_0105510 3300049572 Bacteria 2383
256 Ga0501037_0054792 3300049573 Bacteria 2916
257 Ga0501037_0070309 3300049573 Bacteria 2547
258 Ga0501037_0085022 3300049573 Bacteria 2290
259 Ga0501038_0067637 3300049574 Bacteria 3039
260 Ga0501038_0094773 3300049574 Bacteria 2495
261 Ga0501038_0146659 3300049574 Bacteria 1926
262 Ga0501039_0022807 3300049575 Bacteria 4802
263 Ga0501039_0092584 3300049575 Bacteria 2356
264 Ga0501039_0108083 3300049575 Bacteria 2174
265 Ga0501039_0190862 3300049575 Bacteria 1611
266 Ga0501039_0412428 3300049575 Bacteria 1061
267 Ga0501040_0020547 3300049576 Bacteria 4402
268 Ga0501040_0025697 3300049576 Bacteria 3961
269 Ga0501041_0032717 3300049577 Bacteria 3143
270 Ga0501041_0090660 3300049577 Bacteria 1887
271 Ga0501042_0048375 3300049578 Bacteria 3032
272 Ga0501042_0084875 3300049578 Bacteria 2271
273 Ga0501042_0201243 3300049578 Bacteria 1436
274 Ga0501043_0180208 3300049579 Bacteria 1646
275 Ga0501046_0021436 3300049580 Bacteria 5332
276 Ga0501046_0058339 3300049580 Bacteria 3026
277 Ga0501046_0200598 3300049580 Bacteria 1484
278 Ga0501047_0030802 3300049581 Bacteria 5171
279 Ga0501047_0063321 3300049581 Bacteria 3567
280 Ga0501047_0124373 3300049581 Bacteria 2460
281 Ga0501047_0133308 3300049581 Bacteria 2364
282 Ga0501048_0097934 3300049582 Bacteria 2069
283 Ga0501048_0183931 3300049582 Bacteria 1481
284 Ga0501048_0202233 3300049582 Bacteria 1408
285 Ga0501067_0009246 3300049583 Bacteria 5458
286 Ga0501068_0124113 3300049584 Bacteria 1612
287 Ga0501068_0274767 3300049584 Bacteria 1076
288 Ga0501069_0284035 3300049585 Bacteria 969
289 Ga0501071_0011125 3300049587 Bacteria 6051
290 Ga0501071_0051596 3300049587 Bacteria 2965
291 Ga0501073_0003385 3300049589 Bacteria 11988
292 Ga0501073_0007251 3300049589 Bacteria 8255
293 Ga0501073_0056585 3300049589 Bacteria 2743
294 Ga0501075_0031975 3300049591 Bacteria 3909
295 Ga0501075_0172129 3300049591 Bacteria 1653
296 Ga0501076_0053693 3300049592 Bacteria 3194
297 Ga0501076_0061828 3300049592 Bacteria 2981
298 Ga0501076_0077253 3300049592 Bacteria 2671
299 Ga0501079_0002801 3300049741 Bacteria 12710
300 Ga0501079_0009603 3300049741 Bacteria 7336
301 Ga0501079_0046421 3300049741 Bacteria 3352
302 Ga0501080_0011968 3300049742 Bacteria 7947
303 Ga0501080_0024670 3300049742 Bacteria 5577
304 Ga0501080_0029197 3300049742 Bacteria 5134
305 Ga0501081_0003627 3300049743 Bacteria 9882
306 Ga0501081_0007747 3300049743 Bacteria 6962
307 Ga0501081_0019601 3300049743 Bacteria 4505
308 Ga0501081_0050762 3300049743 Bacteria 2858
309 Ga0501081_0153234 3300049743 Bacteria 1657
310 Ga0501083_0099914 3300049744 Bacteria 1914
311 Ga0501083_0285464 3300049744 Bacteria 1073
312 Ga0501035_0024682 3300049822 Bacteria 5511
313 Ga0501044_0050671 3300049823 Bacteria 4282
314 Ga0501044_0133802 3300049823 Bacteria 2472
315 Ga0501045_0004132 3300049824 Bacteria 10030
316 Ga0501045_0058277 3300049824 Bacteria 2828
317 Ga0501045_0145435 3300049824 Bacteria 1763
318 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
319 Ga0500622_0003621 3300053156 Bacteria 10156
320 Ga0500622_0018383 3300053156 Bacteria 3717
321 Ga0501084_0011145 3300054114 Bacteria 7447
322 Ga0501082_0012389 3300060353 Bacteria 7329
323 Ga0501082_0021906 3300060353 Bacteria 5509
324 Ga0501082_0194758 3300060353 Bacteria 1763
325 Ga0466962_0007574 3300061719 Bacteria 5208
326 Ga0530510_0012410 3300061734 Bacteria 5986
327 Ga0530510_0041965 3300061734 Bacteria 3304
328 Ga0530510_0165775 3300061734 Bacteria 1635
329 2514054241 2513237166 Bacteria 10373764
330 2515687342 2515154123 Bacteria 6387382
331 2527075718 2526164713 Bacteria 6780608
332 2563059111 2562617112 Bacteria 10918404
333 2643976612 2643221593 Bacteria 6296053
334 2713479963 2711768613 Bacteria 11048459
335 2792834119 2791355137 Bacteria 9654227
336 2808971216 2808606384 Bacteria 8474373
337 2809005881 2808606390 Bacteria 8476311
338 2809013183 2808606391 Bacteria 8308166
339 2904439116 2904434214 Bacteria 6230908
340 2904623428 2904615490 Bacteria 10047340
341 2921653941 2921643360 Bacteria 11448031
342 2939671721 2939669807 Bacteria 5028511
343 642593388 642555112 Bacteria 8676562
344 Ga0395898_0000336
345 JGI25156J39149_1000831
346 JGI25156J39149_1001033
347 JGI25156J39149_1001077
348 JGI25156J39149_1002462
349 JGI25162J39368_1002225
350 JGI25157J39369_1000115
351 JGI25157J39369_1000816
352 JGI25157J39369_1001349
353 JGI25164J39214_1000111
354 JGI25151J46595_10000214
355 JGI25165J46597_1000103
356 rootL2_10037632
357 rootL2_10037633
358 JGI25160J50197_1001191
359 Ga0055539_1005936
360 Ga0055525_1000055
361 Ga0055527_1000068
362 Ga0055527_1000129
363 Ga0055527_1000137
364 Ga0055535_1000081
365 Ga0055535_1000112
366 Ga0055535_1000312
367 Ga0055535_1001018
368 Ga0055542_1000093
369 Ga0055542_1000113
370 Ga0055542_1000154
371 Ga0055542_1000217
372 Ga0055529_1000067
373 Ga0055529_1000104
374 Ga0055529_1000389
375 Ga0065165_1000679
376 Ga0070658_10003155
377 Ga0070666_10022585
378 Ga0070689_100241384
379 Ga0070687_100100255
380 Ga0070674_100469768
381 Ga0070659_100163785
382 Ga0070714_100002894
383 Ga0070714_100115580
384 Ga0070713_100026010
385 Ga0070713_100191622
386 Ga0070711_100023932
387 Ga0070700_100373675
388 Ga0070663_100104842
389 Ga0070662_100202198
390 Ga0070681_10001458
391 Ga0070706_100489045
392 Ga0070679_100116632
393 Ga0070684_100132469
394 Ga0068853_100015811
395 Ga0068857_100009051
396 Ga0068856_100042324
397 Ga0081538_10014820
398 Ga0070717_10047252
399 Ga0075428_100435516
400 Ga0075431_100515899
401 Ga0105240_10000179
402 Ga0105240_10000346
403 Ga0105240_10230365
404 Ga0114129_10000156
405 Ga0114129_10314493
406 Ga0114129_10546670
407 Ga0105237_10098162
408 Ga0105238_10159314
409 Ga0105147_102240
410 Ga0105239_10000273
411 Ga0105246_10234807
412 Ga0157373_10023536
413 Ga0157371_10024701
414 Ga0157369_10000149
415 Ga0157380_10137247
416 Ga0157380_10471318
417 Ga0182007_10016142
418 Ga0183361_10014
419 Ga0213872_10041653
420 Ga0209674_100059
421 Ga0209672_100004
422 Ga0209672_100008
423 Ga0209672_100212
424 Ga0209672_101558
425 Ga0209563_100076
426 Ga0207427_100155
427 Ga0209437_100186
428 Ga0209258_100003
429 Ga0209258_100004
430 Ga0209258_100008
431 Ga0209258_100057
432 Ga0209258_100106
433 Ga0207425_1000732
434 Ga0209646_1004424
435 Ga0209026_1000010
436 Ga0209026_1000081
437 Ga0209026_1000797
438 Ga0209677_103591
439 Ga0209148_1000025
440 Ga0209148_1000042
441 Ga0209148_1000068
442 Ga0209148_1000200
443 Ga0209759_1000117
444 Ga0209759_1001022
445 Ga0209759_1010733
446 Ga0209233_1000265
447 Ga0209455_1000004
448 Ga0209455_1000007
449 Ga0209455_1000016
450 Ga0209455_1000103
451 Ga0209455_1019560
452 Ga0209025_1000005
453 Ga0209564_1012773
454 Ga0207426_1000432
455 Ga0207692_10118089
456 Ga0207699_10099820
457 Ga0207684_10568545
458 Ga0207707_10086240
459 Ga0207695_10000100
460 Ga0207695_10000265
461 Ga0207695_10063328
462 Ga0207662_10034861
463 Ga0207652_10119900
464 Ga0207681_10050992
465 Ga0207681_10183644
466 Ga0207694_10254034
467 Ga0207700_10037809
468 Ga0207706_10131685
469 Ga0207670_10120708
470 Ga0207639_10018850
471 Ga0207678_10134234
472 Ga0207702_10001305
473 Ga0207674_10004329
474 Ga0207675_100049285
475 Ga0207675_100376035
476 Ga0209971_1010641
477 Ga0307515_10327972
478 Ga0307408_100013863
479 Ga0307408_100119008
480 Ga0307405_10008504
481 Ga0307405_10038905
482 Ga0307413_10000009
483 Ga0307410_10000430
484 Ga0307410_10023957
485 Ga0307410_10069687
486 Ga0307410_10073338
487 Ga0307406_10013573
488 Ga0307407_10020024
489 Ga0307409_100033393
490 Ga0307409_100048241
491 Ga0307416_100002147
492 Ga0307416_100053616
493 Ga0307416_100255190
494 Ga0307416_100277656
495 Ga0307414_10062554
496 Ga0307411_10000058
497 Ga0307411_10001324
498 Ga0307411_10002070
499 Ga0307415_100011716
500 Ga0395899_0008349
501 Ga0395899_0046594
502 Ga0395900_0152013
503 Ga0395898_0000029
504 Ga0395898_0001642
505 Ga0395905_0000206
506 Ga0395901_0014374
507 Ga0436361_0236139
508 Ga0439461_0001347
509 Ga0439433_0012740
510 Ga0439454_010321
511 Ga0450896_003608
512 Ga0450898_001938
513 Ga0450899_002188
514 Ga0439446_0005346
515 Ga0439446_0015412
516 Ga0450908_002078
517 Ga0439434_0000191
518 Ga0439435_0006483
519 Ga0439444_0000576
520 Ga0439459_0004297
521 Ga0439460_0021920
522 Ga0466969_0000876
523 Ga0466969_0003614
524 Ga0466965_0001105
525 Ga0466966_0040377
526 Ga0466961_0000103
527 Ga0466961_0000387
528 Ga0466961_0032021
529 Ga0453684_0391564
530 Ga0466971_0023153
531 Ga0466970_0001434
532 Ga0466970_0075532
533 Ga0466957_0036042
534 Ga0466957_0164442
535 Ga0466959_0000006
536 Ga0466959_0046823
537 Ga0466958_0025127
538 Ga0466958_0084666
539 Ga0466967_0009969
540 Ga0495603_0020325
541 Ga0495638_0000060
542 Ga0495580_0000344
543 Ga0495664_0002924
544 Ga0495583_0003347
545 Ga0495652_0227806
546 Ga0495623_0129060
547 Ga0495589_0036481
548 Ga0495600_0125518
549 Ga0495581_0005299
550 Ga0495674_0023857
551 Ga0495674_0050664
552 Ga0495672_0017217
553 Ga0495677_0037438
554 Ga0495673_0010019
555 Ga0496100_0003501
556 Ga0496100_0029410
557 Ga0496100_0039905
558 Ga0496101_0005300
559 Ga0496101_0033180
560 Ga0496102_0002574
561 Ga0496103_0001740
562 Ga0496103_0071212
563 Ga0496104_0006865
564 Ga0496105_0002161
565 Ga0496106_0022513
566 Ga0496107_0146294
567 Ga0496112_0018066
568 Ga0496112_0194555
569 Ga0496113_0038629
570 Ga0496115_0105367
571 Ga0496116_0031544
572 Ga0496117_0004871
573 Ga0496117_0019398
574 Ga0496117_0022901
575 Ga0496118_0001566
576 Ga0496118_0005247
577 Ga0496118_0009396
578 Ga0496119_0000135
579 Ga0496119_0002269
580 Ga0496120_0000013
581 Ga0496120_0000311
582 Ga0496121_0000162
583 Ga0496121_0008730
584 Ga0496121_0014463
585 Ga0496121_0014860
586 Ga0496122_0071513
587 Ga0496126_0001671
588 Ga0496126_0263247
589 Ga0495682_0004246
590 Ga0501031_0108878
591 Ga0501031_0112844
592 Ga0501032_0067800
593 Ga0501032_0178626
594 Ga0501033_0011402
595 Ga0501033_0019155
596 Ga0501034_0576494
597 Ga0501036_0082090
598 Ga0501036_0105510
599 Ga0501037_0054792
600 Ga0501037_0070309
601 Ga0501037_0085022
602 Ga0501038_0067637
603 Ga0501038_0094773
604 Ga0501038_0146659
605 Ga0501039_0022807
606 Ga0501039_0092584
607 Ga0501039_0108083
608 Ga0501039_0190862
609 Ga0501039_0412428
610 Ga0501040_0020547
611 Ga0501040_0025697
612 Ga0501041_0032717
613 Ga0501041_0090660
614 Ga0501042_0048375
615 Ga0501042_0084875
616 Ga0501042_0201243
617 Ga0501043_0180208
618 Ga0501046_0021436
619 Ga0501046_0058339
620 Ga0501046_0200598
621 Ga0501047_0030802
622 Ga0501047_0063321
623 Ga0501047_0124373
624 Ga0501047_0133308
625 Ga0501048_0097934
626 Ga0501048_0183931
627 Ga0501048_0202233
628 Ga0501067_0009246
629 Ga0501068_0124113
630 Ga0501068_0274767
631 Ga0501069_0284035
632 Ga0501071_0011125
633 Ga0501071_0051596
634 Ga0501073_0003385
635 Ga0501073_0007251
636 Ga0501073_0056585
637 Ga0501075_0031975
638 Ga0501075_0172129
639 Ga0501076_0053693
640 Ga0501076_0061828
641 Ga0501076_0077253
642 Ga0501079_0002801
643 Ga0501079_0009603
644 Ga0501079_0046421
645 Ga0501080_0011968
646 Ga0501080_0024670
647 Ga0501080_0029197
648 Ga0501081_0003627
649 Ga0501081_0007747
650 Ga0501081_0019601
651 Ga0501081_0050762
652 Ga0501081_0153234
653 Ga0501083_0099914
654 Ga0501083_0285464
655 Ga0501035_0024682
656 Ga0501044_0050671
657 Ga0501044_0133802
658 Ga0501045_0004132
659 Ga0501045_0058277
660 Ga0501045_0145435
661 nmdc:mga08y16_16_c1
662 Ga0500622_0003621
663 Ga0500622_0018383
664 Ga0501084_0011145
665 Ga0501082_0012389
666 Ga0501082_0021906
667 Ga0501082_0194758
668 Ga0466962_0007574
669 Ga0530510_0012410
670 Ga0530510_0041965
671 Ga0530510_0165775
672 2514054241
673 2515687342
674 2527075718
675 2563059111
676 2643976612
677 2713479963
678 2792834119
679 2808971216
680 2809005881
681 2809013183
682 2904439116
683 2904623428
684 2921653941
685 2939671721
686 642593388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

50

310

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.9545 6 296
3cny-assembly2.cif.gz_B crystal structure of a putative inositol catabolism protein iole (iole, lp_3607) from lactobacillus plantarum wcfs1 at 1.85 a resolution 0.9237 6 296
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8219 6 296
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.7859 6 296
5hmq-assembly1.cif.gz_C xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.7849 5 292
ID Description Score Start End Superfamily
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9487 6 296 3.20.20.150
3cnyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9237 6 296 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8088 5 296 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7786 5 296 3.20.20.150
1i60A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7692 7 293 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A536T8V3-F1-model_v4 Myo-inosose-2 dehydratase (EC 4.2.1.44) 0.9987 3 294 GO:0050114
AF-A0A7W1QWJ2-F1-model_v4 TIM barrel protein 0.9967 5 215
AF-A0A7I0J6L8-F1-model_v4 Myo-inosose-2 dehydratase 0.9964 180 287
AF-A0A3D4NKJ4-F1-model_v4 Myo-inosose-2 dehydratase 0.9958 26 294
AF-A0A2X2D1N5-F1-model_v4 AP endonuclease (EC 4.2.1.44) 0.9947 78 293 GO:0004519
GO:0050114

Map