F415671

General Info

Members Datasets Scaffolds Average Seq Length
343 231 686 282

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0072605|Ga0395905_0072605_241_1203
Length 320
Sequence LYLGGKPADFYSVFHTLPRRPFQPRRGPHSGHQEEPPLKLASFTHQGRATYGVAQPEHCLVPPAEFLSRFPDLASVLRAGALQQLDQAVRSGGTKVQADAVQALPVIPAPGKIFCVGLNYKTHVAEMKRPDADHPAIFVRFADSLIAAGDTLLRPSFSERFDYEGELAIVIGKGGRHIAQADAFDHIAGYACFNDGSVRDWQRHTHQWTPGKNFPSTGAFGPYLVTADEVADINQLTLETRLNGEVVQRASLSDLIFTLPVIIEYISRFTPLSPGDVIATGTPGGVGDKRNPPLYMKDGDVVEVEITGLGTLRNPVGTAA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
111 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
138 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
195 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
199 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
207 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
208 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
211 2643221556 Massilia sp. Root1485 Isolate Unclassified
212 2643221580 Devosia sp. Root635 Isolate Unclassified
213 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
214 2643221674 Devosia sp. Root436 Isolate Unclassified
215 2643221684 Massilia sp. Root133 Isolate Unclassified
216 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
217 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
218 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
219 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
220 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
221 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
222 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
223 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
224 2904424332 Duganella sp. 1411 Isolate Rhizosphere
225 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
226 2904456579 Variovorax sp. 2002 Isolate Unclassified
227 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
228 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
229 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
230 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
231 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.13
Metatranscriptomes 1.17
Isolates 6.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.03
Nodule 1.75
Rhizoplane 13.41
Rhizosphere 46.94
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0072605 3300037471 Bacteria 3226
2 JGI25152J39213_1000928 3300002773 Bacteria 14374
3 JGI25152J39213_1008592 3300002773 Bacteria 2519
4 JGI25152J39213_1008593 3300002773 Bacteria 2519
5 JGI25150J39212_1000534 3300002774 Bacteria 15414
6 JGI25150J39212_1006193 3300002774 Bacteria 2491
7 JGI25159J45721_1009691 3300002987 Bacteria 2519
8 JGI25159J45721_1009693 3300002987 Bacteria 2519
9 JGI25159J45721_1009732 3300002987 Bacteria 2513
10 JGI25151J46595_10008704 3300003187 Bacteria 4858
11 JGI25151J46595_10023749 3300003187 Bacteria 2519
12 JGI25151J46595_10023756 3300003187 Bacteria 2519
13 JGI25153J46596_10020261 3300003215 Bacteria 2519
14 JGI25153J46596_10020262 3300003215 Bacteria 2519
15 rootH1_10001372 3300003316 Bacteria 14493
16 rootH2_10028409 3300003320 Bacteria 11980
17 rootL2_10057068 3300003322 Bacteria 21869
18 JGI25160J50197_1008654 3300003354 Bacteria 3858
19 JGI25160J50197_1014038 3300003354 Bacteria 2698
20 JGI25161J50226_1000798 3300003374 Bacteria 11862
21 JGI25161J50226_1002478 3300003374 Bacteria 4703
22 JGI25161J50226_1003150 3300003374 Bacteria 3902
23 Ga0055526_1000642 3300003771 Bacteria 27116
24 Ga0055526_1002856 3300003771 Bacteria 11391
25 Ga0055537_1007862 3300003773 Bacteria 2519
26 Ga0055537_1007863 3300003773 Bacteria 2519
27 Ga0055524_1006281 3300003775 Bacteria 5172
28 Ga0055536_1001817 3300003781 Bacteria 12517
29 Ga0055534_1001246 3300003784 Bacteria 10524
30 Ga0055534_1007729 3300003784 Bacteria 2519
31 Ga0055534_1007732 3300003784 Bacteria 2519
32 Ga0055528_1017191 3300003790 Bacteria 2519
33 Ga0055528_1017227 3300003790 Bacteria 2515
34 Ga0055530_10000350 3300003791 Bacteria 41698
35 Ga0055540_1000596 3300003792 Bacteria 26129
36 Ga0055540_1001036 3300003792 Bacteria 17799
37 Ga0055540_1002926 3300003792 Bacteria 8621
38 Ga0055531_10000794 3300003794 Bacteria 26174
39 Ga0055531_10002798 3300003794 Bacteria 11438
40 Ga0058692_1000276 3300003856 Bacteria 27333
41 Ga0055543_1000297 3300004625 Bacteria 35506
42 Ga0055543_1000343 3300004625 Bacteria 31743
43 Ga0065165_1008431 3300005262 Bacteria 4823
44 Ga0065714_10085712 3300005288 Bacteria 2135
45 Ga0070670_100071594 3300005331 Bacteria 2977
46 Ga0070668_100323880 3300005347 Bacteria 1298
47 Ga0070671_100001207 3300005355 Bacteria 19345
48 Ga0070667_100027237 3300005367 Bacteria 4755
49 Ga0070667_100080202 3300005367 Bacteria 2791
50 Ga0070708_100004348 3300005445 Bacteria 11129
51 Ga0070662_100113311 3300005457 Bacteria 2069
52 Ga0070706_100026195 3300005467 Bacteria 5367
53 Ga0070707_100001516 3300005468 Bacteria 22632
54 Ga0070698_100002019 3300005471 Bacteria 22563
55 Ga0070699_100009769 3300005518 Bacteria 8302
56 Ga0070697_100003396 3300005536 Bacteria 12239
57 Ga0068853_100050545 3300005539 Bacteria 3577
58 Ga0070665_100004368 3300005548 Bacteria 14871
59 Ga0068864_100074920 3300005618 Bacteria 2954
60 Ga0068866_10043467 3300005718 Bacteria 2243
61 Ga0070717_10001760 3300006028 Bacteria 15080
62 Ga0070717_10115713 3300006028 Unclassified 2292
63 Ga0075365_10100972 3300006038 Bacteria 1975
64 Ga0075368_10033934 3300006042 Bacteria 1987
65 Ga0075364_10009966 3300006051 Bacteria 5719
66 Ga0075366_10109379 3300006195 Bacteria 1662
67 Ga0068871_100118680 3300006358 Unclassified 2232
68 Ga0075428_100146621 3300006844 Bacteria 2565
69 Ga0075430_100066982 3300006846 Bacteria 3015
70 Ga0105244_10012907 3300009036 Bacteria 4915
71 Ga0105240_10002799 3300009093 Bacteria 27575
72 Ga0105245_10096035 3300009098 Bacteria 2734
73 Ga0105245_10254838 3300009098 Bacteria 1706
74 Ga0105247_10002436 3300009101 Bacteria 12671
75 Ga0105243_10190190 3300009148 Unclassified 1792
76 Ga0105248_10500959 3300009177 Bacteria 1369
77 Ga0105237_10002492 3300009545 Bacteria 22824
78 Ga0105238_10009943 3300009551 Bacteria 9539
79 Ga0105249_10075890 3300009553 Bacteria 3114
80 Ga0105239_10007107 3300010375 Bacteria 12883
81 Ga0157347_1006443 3300012502 Bacteria 1148
82 Ga0157373_10013430 3300013100 Bacteria 6007
83 Ga0157371_10100144 3300013102 Bacteria 2055
84 Ga0157370_10021314 3300013104 Bacteria 6459
85 Ga0157378_10001158 3300013297 Bacteria 23978
86 Ga0157378_10112006 3300013297 Bacteria 2503
87 Ga0157378_10137545 3300013297 Bacteria 2266
88 Ga0163162_10060674 3300013306 Bacteria 3818
89 Ga0163162_10077578 3300013306 Unclassified 3386
90 Ga0163162_10149658 3300013306 Bacteria 2451
91 Ga0157372_10148514 3300013307 Bacteria 2704
92 Ga0157375_10062600 3300013308 Bacteria 3698
93 Ga0157375_10171791 3300013308 Bacteria 2315
94 Ga0182008_10001412 3300014497 Bacteria 16120
95 Ga0157379_10004342 3300014968 Bacteria 12122
96 Ga0157376_10085651 3300014969 Bacteria 2715
97 Ga0157376_10145987 3300014969 Bacteria 2128
98 Ga0183362_10002 3300015683 Bacteria 1432711
99 Ga0163161_10007558 3300017792 Bacteria 7515
100 Ga0163161_10330978 3300017792 Bacteria 1206
101 Ga0163161_10475173 3300017792 Bacteria 1014
102 Ga0209436_101898 3300025208 Bacteria 6743
103 Ga0209436_109672 3300025208 Bacteria 1816
104 Ga0209672_105802 3300025228 Bacteria 2078
105 Ga0207425_1000042 3300025245 Bacteria 210165
106 Ga0207425_1000890 3300025245 Bacteria 14500
107 Ga0209129_1000058 3300025258 Bacteria 252258
108 Ga0209129_1001786 3300025258 Bacteria 11470
109 Ga0209129_1017555 3300025258 Bacteria 1400
110 Ga0209565_1000027 3300025263 Bacteria 360545
111 Ga0209565_1000836 3300025263 Bacteria 17432
112 Ga0209565_1001579 3300025263 Bacteria 9706
113 Ga0209673_1000031 3300025273 Bacteria 347560
114 Ga0209673_1000940 3300025273 Bacteria 36505
115 Ga0209673_1001066 3300025273 Bacteria 31244
116 Ga0209130_1000025 3300025284 Bacteria 336491
117 Ga0209130_1000230 3300025284 Bacteria 73335
118 Ga0209130_1004930 3300025284 Bacteria 4837
119 Ga0209675_1000064 3300025291 Bacteria 177063
120 Ga0209675_1003973 3300025291 Bacteria 6754
121 Ga0209675_1007115 3300025291 Bacteria 4351
122 Ga0209676_1000004 3300025292 Bacteria 1138360
123 Ga0209676_1000633 3300025292 Bacteria 50662
124 Ga0209025_1004793 3300025294 Bacteria 11470
125 Ga0209564_1000040 3300025295 Bacteria 411388
126 Ga0209564_1000319 3300025295 Bacteria 93563
127 Ga0209758_1000050 3300025297 Bacteria 345008
128 Ga0209758_1004519 3300025297 Bacteria 11528
129 Ga0209758_1004540 3300025297 Bacteria 11470
130 Ga0209050_1000002 3300025298 Bacteria 1792849
131 Ga0209050_1012930 3300025298 Bacteria 3774
132 Ga0209256_1000023 3300025299 Bacteria 461150
133 Ga0209256_1000166 3300025299 Bacteria 133549
134 Ga0209256_1019635 3300025299 Bacteria 2143
135 Ga0207426_1000118 3300025302 Bacteria 223341
136 Ga0207426_1000389 3300025302 Bacteria 75042
137 Ga0209051_1000002 3300025303 Bacteria 1631846
138 Ga0209051_1006856 3300025303 Bacteria 6336
139 Ga0209257_1000002 3300025304 Bacteria 1767052
140 Ga0209257_1000566 3300025304 Bacteria 62726
141 Ga0207642_10092147 3300025899 Bacteria 1500
142 Ga0207710_10025068 3300025900 Bacteria 2572
143 Ga0207684_10074974 3300025910 Bacteria 2875
144 Ga0207654_10159983 3300025911 Bacteria 1454
145 Ga0207695_10011154 3300025913 Bacteria 10906
146 Ga0207671_10002960 3300025914 Bacteria 17471
147 Ga0207646_10011904 3300025922 Bacteria 8391
148 Ga0207694_10010320 3300025924 Bacteria 7043
149 Ga0207650_10111006 3300025925 Bacteria 2123
150 Ga0207687_10197633 3300025927 Bacteria 1569
151 Ga0207644_10005300 3300025931 Bacteria 8417
152 Ga0207706_10059920 3300025933 Bacteria 3352
153 Ga0207704_10092090 3300025938 Bacteria 1994
154 Ga0207711_10537058 3300025941 Bacteria 1091
155 Ga0207712_10074392 3300025961 Bacteria 2453
156 Ga0207658_10037679 3300025986 Bacteria 3477
157 Ga0207658_10057209 3300025986 Bacteria 2897
158 Ga0207676_10343570 3300026095 Bacteria 1378
159 Ga0207675_100076657 3300026118 Unclassified 3131
160 Ga0207683_10068209 3300026121 Unclassified 3139
161 Ga0209371_1000064 3300027312 Bacteria 218637
162 Ga0268266_10264041 3300028379 Bacteria 1596
163 Ga0268256_1000028 3300030500 Bacteria 433179
164 Ga0307511_10000357 3300030521 Bacteria 48459
165 Ga0316182_1143076 3300030745 Bacteria 3453
166 Ga0265760_10042806 3300031090 Bacteria 1353
167 Ga0307408_100113546 3300031548 Bacteria 2085
168 Ga0307412_10051136 3300031911 Bacteria 2730
169 Ga0307416_100271511 3300032002 Bacteria 1665
170 Ga0307414_10385470 3300032004 Bacteria 1213
171 Ga0373943_0186945 3300035170 Unclassified 1141
172 Ga0373935_0005021 3300035692 Bacteria 7795
173 Ga0373927_0010053 3300035695 Bacteria 6335
174 Ga0373947_0032487 3300035725 Bacteria 3076
175 Ga0373925_0010738 3300037068 Bacteria 6641
176 Ga0373925_0211475 3300037068 Bacteria 1545
177 Ga0395899_0000509 3300037312 Bacteria 43082
178 Ga0395900_0001796 3300037418 Bacteria 24602
179 Ga0395898_0052240 3300037466 Bacteria 3992
180 Ga0395898_0479624 3300037466 Bacteria 1183
181 Ga0395905_0001775 3300037471 Bacteria 25025
182 Ga0395905_0003282 3300037471 Bacteria 17376
183 Ga0395905_0010805 3300037471 Bacteria 8846
184 Ga0395905_0122779 3300037471 Bacteria 2442
185 Ga0395905_0264397 3300037471 Bacteria 1606
186 Ga0395905_0323191 3300037471 Bacteria 1433
187 Ga0395901_0061285 3300038443 Bacteria 3914
188 Ga0395901_0539814 3300038443 Bacteria 1183
189 Ga0439466_0001297 3300041411 Bacteria 9728
190 Ga0439465_0000760 3300041413 Bacteria 9997
191 Ga0466957_0045007 3300044842 Bacteria 2675
192 Ga0495603_0012495 3300046455 Bacteria 5141
193 Ga0495629_0193285 3300046459 Bacteria 1408
194 Ga0495605_0010418 3300046474 Bacteria 5201
195 Ga0495639_0003198 3300046475 Bacteria 7115
196 Ga0495584_0048334 3300046491 Bacteria 2144
197 Ga0495585_0006960 3300046492 Bacteria 6966
198 Ga0495594_0248649 3300046499 Unclassified 1013
199 Ga0495607_0000768 3300046501 Bacteria 30781
200 Ga0495607_0008520 3300046501 Bacteria 7009
201 Ga0495610_0015531 3300046512 Bacteria 4420
202 Ga0495616_0000142 3300046513 Bacteria 62829
203 Ga0495632_0001190 3300046519 Bacteria 22089
204 Ga0495637_0000103 3300046520 Bacteria 63100
205 Ga0495637_0002576 3300046520 Bacteria 9967
206 Ga0495643_0054127 3300046522 Bacteria 2150
207 Ga0495644_0000073 3300046523 Bacteria 49382
208 Ga0495654_0038989 3300046530 Bacteria 2373
209 Ga0495609_0000198 3300046538 Bacteria 59995
210 Ga0495621_0021284 3300046539 Bacteria 2137
211 Ga0495656_0003472 3300046615 Bacteria 5333
212 Ga0495611_0000143 3300046648 Bacteria 50526
213 Ga0495661_0000660 3300046665 Bacteria 34588
214 Ga0495661_0006425 3300046665 Bacteria 8264
215 Ga0495661_0029719 3300046665 Bacteria 3486
216 Ga0495588_0000099 3300046674 Bacteria 164015
217 Ga0495588_0004546 3300046674 Bacteria 6133
218 Ga0495588_0149950 3300046674 Bacteria 1232
219 Ga0495647_0109457 3300046681 Bacteria 1152
220 Ga0495658_0320591 3300046683 Bacteria 982
221 Ga0495589_0000168 3300046794 Bacteria 59857
222 Ga0495676_0019623 3300047321 Bacteria 5944
223 Ga0495687_000313 3300047443 Bacteria 63173
224 Ga0495677_0000062 3300047445 Bacteria 60952
225 Ga0495677_0000189 3300047445 Bacteria 28413
226 Ga0495686_0011667 3300047472 Bacteria 6187
227 Ga0495593_0011378 3300047673 Bacteria 5111
228 Ga0495614_0007845 3300048089 Bacteria 4745
229 Ga0495626_0000253 3300048091 Bacteria 61301
230 Ga0496100_0002053 3300048903 Bacteria 10102
231 Ga0496100_0301101 3300048903 Bacteria 1200
232 Ga0496101_0003904 3300048904 Bacteria 9318
233 Ga0496101_0352275 3300048904 Bacteria 1157
234 Ga0496102_0002407 3300048905 Bacteria 15975
235 Ga0496102_0003799 3300048905 Bacteria 12766
236 Ga0496103_0002290 3300048906 Bacteria 12101
237 Ga0496103_0062643 3300048906 Bacteria 2315
238 Ga0496103_0118680 3300048906 Bacteria 1684
239 Ga0496104_0004101 3300048907 Bacteria 12642
240 Ga0496104_0009639 3300048907 Bacteria 8599
241 Ga0496104_0014987 3300048907 Bacteria 7011
242 Ga0496104_0019917 3300048907 Bacteria 6144
243 Ga0496104_0053456 3300048907 Bacteria 3816
244 Ga0496104_0089018 3300048907 Bacteria 2949
245 Ga0496104_0163685 3300048907 Unclassified 2133
246 Ga0496105_0000423 3300048908 Bacteria 27810
247 Ga0496105_0005108 3300048908 Bacteria 9950
248 Ga0496105_0021802 3300048908 Bacteria 5186
249 Ga0496105_0081702 3300048908 Bacteria 2669
250 Ga0496105_0233183 3300048908 Bacteria 1495
251 Ga0496106_0048742 3300048909 Bacteria 3191
252 Ga0496106_0095742 3300048909 Bacteria 2297
253 Ga0496106_0317142 3300048909 Bacteria 1251
254 Ga0496108_0003638 3300048911 Bacteria 12355
255 Ga0496108_0005300 3300048911 Bacteria 10408
256 Ga0496108_0131649 3300048911 Bacteria 2150
257 Ga0496109_0001159 3300048912 Bacteria 21930
258 Ga0496109_0004434 3300048912 Bacteria 11723
259 Ga0496109_0145404 3300048912 Bacteria 2218
260 Ga0496109_0157650 3300048912 Bacteria 2126
261 Ga0496109_0177475 3300048912 Bacteria 2000
262 Ga0496109_0250996 3300048912 Unclassified 1666
263 Ga0496110_0003733 3300048913 Bacteria 11732
264 Ga0496110_0140759 3300048913 Unclassified 2181
265 Ga0496111_0010645 3300048914 Bacteria 6181
266 Ga0496111_0019467 3300048914 Bacteria 4714
267 Ga0496111_0226224 3300048914 Unclassified 1389
268 Ga0496112_0019793 3300048915 Bacteria 6365
269 Ga0496113_0013861 3300048916 Bacteria 5478
270 Ga0496114_0050622 3300048917 Bacteria 3458
271 Ga0496114_0218728 3300048917 Unclassified 1672
272 Ga0496115_0039128 3300048918 Bacteria 3765
273 Ga0496115_0117957 3300048918 Unclassified 2183
274 Ga0496115_0139303 3300048918 Bacteria 2001
275 Ga0496115_0211871 3300048918 Bacteria 1600
276 Ga0496116_0031972 3300048919 Bacteria 3757
277 Ga0496121_0152747 3300048924 Bacteria 1697
278 Ga0496122_0006299 3300048925 Bacteria 13680
279 Ga0496122_0019917 3300048925 Bacteria 6100
280 Ga0496123_0011764 3300048926 Bacteria 7539
281 Ga0496124_0004131 3300048927 Bacteria 17151
282 Ga0496124_0031311 3300048927 Bacteria 4710
283 Ga0496124_0059978 3300048927 Bacteria 3194
284 Ga0496125_0005718 3300048928 Bacteria 13695
285 Ga0496125_0049084 3300048928 Bacteria 3511
286 Ga0496125_0054512 3300048928 Bacteria 3266
287 Ga0496125_0153272 3300048928 Bacteria 1579
288 Ga0496126_0034630 3300048929 Bacteria 4741
289 Ga0496126_0126757 3300048929 Bacteria 2209
290 Ga0501304_003604 3300049160 Bacteria 1141
291 Ga0501321_012553 3300049537 Bacteria 961
292 Ga0501034_0052798 3300049571 Bacteria 4094
293 Ga0501043_0098943 3300049579 Bacteria 2293
294 Ga0501269_000480 3300049766 Bacteria 8517
295 Ga0501035_0000673 3300049822 Bacteria 37395
296 nmdc:mga03683_965_c1 3300050489 Bacteria 8362
297 nmdc:mga03n38_11169_c1 3300050490 Bacteria 3337
298 nmdc:mga00v17_1795_c1 3300050491 Bacteria 11116
299 nmdc:mga0yw44_77862_c1 3300050492 Bacteria 2072
300 nmdc:mga0yw44_8961_c1 3300050492 Bacteria 5023
301 nmdc:mga0k408_20722_c1 3300050493 Bacteria 3688
302 nmdc:mga06r32_206380_c1 3300050510 Bacteria 1953
303 Ga0500610_0008165 3300053079 Bacteria 4539
304 Ga0500643_001989 3300053087 Bacteria 11057
305 Ga0500651_0000063 3300053093 Bacteria 70772
306 Ga0500566_0016607 3300053094 Bacteria 4321
307 Ga0500571_000022 3300053110 Bacteria 56973
308 Ga0500597_000456 3300053120 Bacteria 8674
309 Ga0500658_0000125 3300053134 Bacteria 36384
310 Ga0500658_0000804 3300053134 Bacteria 12998
311 Ga0500559_0058272 3300053136 Bacteria 1717
312 Ga0500564_013358 3300053138 Bacteria 3674
313 Ga0500568_0001840 3300053139 Bacteria 13074
314 Ga0500568_0011146 3300053139 Bacteria 4186
315 Ga0500574_000185 3300053141 Bacteria 7291
316 Ga0500577_0095223 3300053142 Bacteria 1210
317 Ga0500634_0154263 3300053161 Bacteria 1069
318 Ga0500638_000424 3300053162 Bacteria 10110
319 Ga0587125_000653 3300059607 Bacteria 2172
320 Ga0466962_0117504 3300061719 Bacteria 1282
321 2515686101 2515154122 Bacteria 8609520
322 2643796652 2643221556 Bacteria 7251154
323 2643910452 2643221580 Bacteria 3816678
324 2644158765 2643221628 Bacteria 5745828
325 2644411641 2643221674 Bacteria 3919126
326 2644470243 2643221684 Bacteria 7145183
327 2776910915 2775507049 Bacteria 6284736
328 2809146953 2808606418 Bacteria 6724496
329 2831267561 2831265667 Bacteria 7184833
330 2838027302 2838022645 Bacteria 6494267
331 2838056052 2838054893 Bacteria 7451788
332 2838060712 2838054893 Bacteria 7451788
333 2842203325 2842198810 Bacteria 6608673
334 2881101488 2881101125 Bacteria 4590519
335 2902689464 2902682994 Bacteria 8951596
336 2904424731 2904424332 Bacteria 7633521
337 2904453841 2904449895 Bacteria 6927402
338 2904462316 2904456579 Bacteria 6819253
339 2928088781 2928084124 Bacteria 7159212
340 2928117533 2928115317 Bacteria 6477646
341 2945972543 2945972063 Bacteria 6086495
342 2954770684 2954767861 Bacteria 5535784
343 8002288195 8002285264 Bacteria 6717907
344 Ga0395905_0072605
345 JGI25152J39213_1000928
346 JGI25152J39213_1008592
347 JGI25152J39213_1008593
348 JGI25150J39212_1000534
349 JGI25150J39212_1006193
350 JGI25159J45721_1009691
351 JGI25159J45721_1009693
352 JGI25159J45721_1009732
353 JGI25151J46595_10008704
354 JGI25151J46595_10023749
355 JGI25151J46595_10023756
356 JGI25153J46596_10020261
357 JGI25153J46596_10020262
358 rootH1_10001372
359 rootH2_10028409
360 rootL2_10057068
361 JGI25160J50197_1008654
362 JGI25160J50197_1014038
363 JGI25161J50226_1000798
364 JGI25161J50226_1002478
365 JGI25161J50226_1003150
366 Ga0055526_1000642
367 Ga0055526_1002856
368 Ga0055537_1007862
369 Ga0055537_1007863
370 Ga0055524_1006281
371 Ga0055536_1001817
372 Ga0055534_1001246
373 Ga0055534_1007729
374 Ga0055534_1007732
375 Ga0055528_1017191
376 Ga0055528_1017227
377 Ga0055530_10000350
378 Ga0055540_1000596
379 Ga0055540_1001036
380 Ga0055540_1002926
381 Ga0055531_10000794
382 Ga0055531_10002798
383 Ga0058692_1000276
384 Ga0055543_1000297
385 Ga0055543_1000343
386 Ga0065165_1008431
387 Ga0065714_10085712
388 Ga0070670_100071594
389 Ga0070668_100323880
390 Ga0070671_100001207
391 Ga0070667_100027237
392 Ga0070667_100080202
393 Ga0070708_100004348
394 Ga0070662_100113311
395 Ga0070706_100026195
396 Ga0070707_100001516
397 Ga0070698_100002019
398 Ga0070699_100009769
399 Ga0070697_100003396
400 Ga0068853_100050545
401 Ga0070665_100004368
402 Ga0068864_100074920
403 Ga0068866_10043467
404 Ga0070717_10001760
405 Ga0070717_10115713
406 Ga0075365_10100972
407 Ga0075368_10033934
408 Ga0075364_10009966
409 Ga0075366_10109379
410 Ga0068871_100118680
411 Ga0075428_100146621
412 Ga0075430_100066982
413 Ga0105244_10012907
414 Ga0105240_10002799
415 Ga0105245_10096035
416 Ga0105245_10254838
417 Ga0105247_10002436
418 Ga0105243_10190190
419 Ga0105248_10500959
420 Ga0105237_10002492
421 Ga0105238_10009943
422 Ga0105249_10075890
423 Ga0105239_10007107
424 Ga0157347_1006443
425 Ga0157373_10013430
426 Ga0157371_10100144
427 Ga0157370_10021314
428 Ga0157378_10001158
429 Ga0157378_10112006
430 Ga0157378_10137545
431 Ga0163162_10060674
432 Ga0163162_10077578
433 Ga0163162_10149658
434 Ga0157372_10148514
435 Ga0157375_10062600
436 Ga0157375_10171791
437 Ga0182008_10001412
438 Ga0157379_10004342
439 Ga0157376_10085651
440 Ga0157376_10145987
441 Ga0183362_10002
442 Ga0163161_10007558
443 Ga0163161_10330978
444 Ga0163161_10475173
445 Ga0209436_101898
446 Ga0209436_109672
447 Ga0209672_105802
448 Ga0207425_1000042
449 Ga0207425_1000890
450 Ga0209129_1000058
451 Ga0209129_1001786
452 Ga0209129_1017555
453 Ga0209565_1000027
454 Ga0209565_1000836
455 Ga0209565_1001579
456 Ga0209673_1000031
457 Ga0209673_1000940
458 Ga0209673_1001066
459 Ga0209130_1000025
460 Ga0209130_1000230
461 Ga0209130_1004930
462 Ga0209675_1000064
463 Ga0209675_1003973
464 Ga0209675_1007115
465 Ga0209676_1000004
466 Ga0209676_1000633
467 Ga0209025_1004793
468 Ga0209564_1000040
469 Ga0209564_1000319
470 Ga0209758_1000050
471 Ga0209758_1004519
472 Ga0209758_1004540
473 Ga0209050_1000002
474 Ga0209050_1012930
475 Ga0209256_1000023
476 Ga0209256_1000166
477 Ga0209256_1019635
478 Ga0207426_1000118
479 Ga0207426_1000389
480 Ga0209051_1000002
481 Ga0209051_1006856
482 Ga0209257_1000002
483 Ga0209257_1000566
484 Ga0207642_10092147
485 Ga0207710_10025068
486 Ga0207684_10074974
487 Ga0207654_10159983
488 Ga0207695_10011154
489 Ga0207671_10002960
490 Ga0207646_10011904
491 Ga0207694_10010320
492 Ga0207650_10111006
493 Ga0207687_10197633
494 Ga0207644_10005300
495 Ga0207706_10059920
496 Ga0207704_10092090
497 Ga0207711_10537058
498 Ga0207712_10074392
499 Ga0207658_10037679
500 Ga0207658_10057209
501 Ga0207676_10343570
502 Ga0207675_100076657
503 Ga0207683_10068209
504 Ga0209371_1000064
505 Ga0268266_10264041
506 Ga0268256_1000028
507 Ga0307511_10000357
508 Ga0316182_1143076
509 Ga0265760_10042806
510 Ga0307408_100113546
511 Ga0307412_10051136
512 Ga0307416_100271511
513 Ga0307414_10385470
514 Ga0373943_0186945
515 Ga0373935_0005021
516 Ga0373927_0010053
517 Ga0373947_0032487
518 Ga0373925_0010738
519 Ga0373925_0211475
520 Ga0395899_0000509
521 Ga0395900_0001796
522 Ga0395898_0052240
523 Ga0395898_0479624
524 Ga0395905_0001775
525 Ga0395905_0003282
526 Ga0395905_0010805
527 Ga0395905_0122779
528 Ga0395905_0264397
529 Ga0395905_0323191
530 Ga0395901_0061285
531 Ga0395901_0539814
532 Ga0439466_0001297
533 Ga0439465_0000760
534 Ga0466957_0045007
535 Ga0495603_0012495
536 Ga0495629_0193285
537 Ga0495605_0010418
538 Ga0495639_0003198
539 Ga0495584_0048334
540 Ga0495585_0006960
541 Ga0495594_0248649
542 Ga0495607_0000768
543 Ga0495607_0008520
544 Ga0495610_0015531
545 Ga0495616_0000142
546 Ga0495632_0001190
547 Ga0495637_0000103
548 Ga0495637_0002576
549 Ga0495643_0054127
550 Ga0495644_0000073
551 Ga0495654_0038989
552 Ga0495609_0000198
553 Ga0495621_0021284
554 Ga0495656_0003472
555 Ga0495611_0000143
556 Ga0495661_0000660
557 Ga0495661_0006425
558 Ga0495661_0029719
559 Ga0495588_0000099
560 Ga0495588_0004546
561 Ga0495588_0149950
562 Ga0495647_0109457
563 Ga0495658_0320591
564 Ga0495589_0000168
565 Ga0495676_0019623
566 Ga0495687_000313
567 Ga0495677_0000062
568 Ga0495677_0000189
569 Ga0495686_0011667
570 Ga0495593_0011378
571 Ga0495614_0007845
572 Ga0495626_0000253
573 Ga0496100_0002053
574 Ga0496100_0301101
575 Ga0496101_0003904
576 Ga0496101_0352275
577 Ga0496102_0002407
578 Ga0496102_0003799
579 Ga0496103_0002290
580 Ga0496103_0062643
581 Ga0496103_0118680
582 Ga0496104_0004101
583 Ga0496104_0009639
584 Ga0496104_0014987
585 Ga0496104_0019917
586 Ga0496104_0053456
587 Ga0496104_0089018
588 Ga0496104_0163685
589 Ga0496105_0000423
590 Ga0496105_0005108
591 Ga0496105_0021802
592 Ga0496105_0081702
593 Ga0496105_0233183
594 Ga0496106_0048742
595 Ga0496106_0095742
596 Ga0496106_0317142
597 Ga0496108_0003638
598 Ga0496108_0005300
599 Ga0496108_0131649
600 Ga0496109_0001159
601 Ga0496109_0004434
602 Ga0496109_0145404
603 Ga0496109_0157650
604 Ga0496109_0177475
605 Ga0496109_0250996
606 Ga0496110_0003733
607 Ga0496110_0140759
608 Ga0496111_0010645
609 Ga0496111_0019467
610 Ga0496111_0226224
611 Ga0496112_0019793
612 Ga0496113_0013861
613 Ga0496114_0050622
614 Ga0496114_0218728
615 Ga0496115_0039128
616 Ga0496115_0117957
617 Ga0496115_0139303
618 Ga0496115_0211871
619 Ga0496116_0031972
620 Ga0496121_0152747
621 Ga0496122_0006299
622 Ga0496122_0019917
623 Ga0496123_0011764
624 Ga0496124_0004131
625 Ga0496124_0031311
626 Ga0496124_0059978
627 Ga0496125_0005718
628 Ga0496125_0049084
629 Ga0496125_0054512
630 Ga0496125_0153272
631 Ga0496126_0034630
632 Ga0496126_0126757
633 Ga0501304_003604
634 Ga0501321_012553
635 Ga0501034_0052798
636 Ga0501043_0098943
637 Ga0501269_000480
638 Ga0501035_0000673
639 nmdc:mga03683_965_c1
640 nmdc:mga03n38_11169_c1
641 nmdc:mga00v17_1795_c1
642 nmdc:mga0yw44_77862_c1
643 nmdc:mga0yw44_8961_c1
644 nmdc:mga0k408_20722_c1
645 nmdc:mga06r32_206380_c1
646 Ga0500610_0008165
647 Ga0500643_001989
648 Ga0500651_0000063
649 Ga0500566_0016607
650 Ga0500571_000022
651 Ga0500597_000456
652 Ga0500658_0000125
653 Ga0500658_0000804
654 Ga0500559_0058272
655 Ga0500564_013358
656 Ga0500568_0001840
657 Ga0500568_0011146
658 Ga0500574_000185
659 Ga0500577_0095223
660 Ga0500634_0154263
661 Ga0500638_000424
662 Ga0587125_000653
663 Ga0466962_0117504
664 2515686101
665 2643796652
666 2643910452
667 2644158765
668 2644411641
669 2644470243
670 2776910915
671 2809146953
672 2831267561
673 2838027302
674 2838056052
675 2838060712
676 2842203325
677 2881101488
678 2902689464
679 2904424731
680 2904453841
681 2904462316
682 2928088781
683 2928117533
684 2945972543
685 2954770684
686 8002288195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

112

317

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9425 75 282
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9423 73 282
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.942 73 282
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9395 73 282
6sbj-assembly1.cif.gz_B x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9332 73 282
ID Description Score Start End Superfamily
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9633 70 281 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.963 51 280 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9603 75 280 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9524 73 279 3.90.850.10
af_Q9VU50_128_337_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9499 70 281 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2D9WDD8-F1-model_v4 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase 0.9884 94 282 GO:0003824
GO:0044281
AF-A0A7H4K325-F1-model_v4 deleted 0.9881 1 282
AF-A0A2E0YJ46-F1-model_v4 deleted 0.9874 115 282
AF-X6KQM0-F1-model_v4 5-carboxymethyl-2-hydroxymuconate isomerase 0.9867 67 282 GO:0016853
GO:0044281
AF-A0A485BLC9-F1-model_v4 4-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase 0.9848 1 282 GO:0008514
GO:0016020
GO:0016853
GO:0044281

Map