F415674

General Info

Members Datasets Scaffolds Average Seq Length
343 220 343 172

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0595527|Ga0395905_0595527_181_789
Length 202
Sequence LQRLKRVQIERLAGVRDGSVTVFGTGVCGVVLAAGASSRFGSPKQRLLLEPVLSRVRRSSVDDVVVVLGAHEVETSARTVRCPEWERGPGASLRCGLEALPPETEAAIVVLGDGPDLAPEAIDRVIATWRSTDAEVIAATYGGVRLHPLLIARAQWPAVPDEGLRSLAAVLVPCDDLGPPGDVDFSDEIPESLRPKPPTAES

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
181 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.75
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10678891 3300005328 Bacteria 750
2 Ga0070683_100009377 3300005329 Bacteria 8368
3 Ga0070683_100145347 3300005329 Bacteria 2247
4 Ga0070666_10074623 3300005335 Bacteria 2312
5 Ga0070680_100201981 3300005336 Bacteria 1676
6 Ga0070682_100032133 3300005337 Bacteria 3180
7 Ga0068868_100213442 3300005338 Bacteria 1614
8 Ga0068868_100497545 3300005338 Unclassified 1067
9 Ga0070691_10124062 3300005341 Unclassified 1303
10 Ga0070687_100234275 3300005343 Bacteria 1132
11 Ga0070692_10209349 3300005345 Bacteria 1146
12 Ga0070668_100021194 3300005347 Bacteria 4912
13 Ga0070668_100219745 3300005347 Bacteria 1567
14 Ga0070669_100422661 3300005353 Bacteria 1094
15 Ga0070673_100112702 3300005364 Bacteria 2258
16 Ga0070673_100201850 3300005364 Bacteria 1713
17 Ga0070688_100007444 3300005365 Bacteria 5903
18 Ga0070659_100365789 3300005366 Bacteria 1212
19 Ga0070667_100342136 3300005367 Bacteria 1353
20 Ga0070703_10090500 3300005406 Unclassified 1060
21 Ga0070709_10067463 3300005434 Bacteria 2297
22 Ga0070714_100038155 3300005435 Bacteria 4040
23 Ga0070714_100215918 3300005435 Bacteria 1760
24 Ga0070713_100114582 3300005436 Bacteria 2355
25 Ga0070710_10093085 3300005437 Bacteria 1781
26 Ga0070701_10003678 3300005438 Bacteria 6111
27 Ga0070701_10384518 3300005438 Unclassified 885
28 Ga0070711_100006925 3300005439 Bacteria 6873
29 Ga0070705_100126949 3300005440 Bacteria 1657
30 Ga0070700_100113057 3300005441 Unclassified 1808
31 Ga0070694_100262901 3300005444 Bacteria 1309
32 Ga0070694_100323070 3300005444 Unclassified 1188
33 Ga0070694_100339337 3300005444 Unclassified 1161
34 Ga0070708_100170565 3300005445 Bacteria 2031
35 Ga0070663_100107337 3300005455 Bacteria 2093
36 Ga0070678_100018547 3300005456 Bacteria 4511
37 Ga0070662_100041395 3300005457 Bacteria 3286
38 Ga0070662_100065973 3300005457 Bacteria 2655
39 Ga0070681_11030713 3300005458 Unclassified 743
40 Ga0068867_100054578 3300005459 Bacteria 2952
41 Ga0070685_10027717 3300005466 Bacteria 3134
42 Ga0070685_10048261 3300005466 Bacteria 2452
43 Ga0070706_100248540 3300005467 Bacteria 1661
44 Ga0070707_100014133 3300005468 Bacteria 7481
45 Ga0070707_100545171 3300005468 Bacteria 1122
46 Ga0070698_100006283 3300005471 Bacteria 12909
47 Ga0070679_100688262 3300005530 Bacteria 965
48 Ga0068853_100075864 3300005539 Bacteria 2935
49 Ga0070672_100159215 3300005543 Bacteria 1872
50 Ga0070695_101216808 3300005545 Bacteria 620
51 Ga0070696_100026320 3300005546 Bacteria 3957
52 Ga0070696_100208602 3300005546 Unclassified 1462
53 Ga0070696_100492003 3300005546 Bacteria 974
54 Ga0070693_100250999 3300005547 Bacteria 1173
55 Ga0070665_100033262 3300005548 Bacteria 5188
56 Ga0070704_100039962 3300005549 Bacteria 3225
57 Ga0070704_100089418 3300005549 Bacteria 2291
58 Ga0070704_100576370 3300005549 Bacteria 986
59 Ga0068855_100028306 3300005563 Bacteria 6703
60 Ga0068855_100089423 3300005563 Bacteria 3555
61 Ga0068855_100650758 3300005563 Unclassified 1132
62 Ga0070664_100141132 3300005564 Bacteria 2121
63 Ga0068857_100005679 3300005577 Bacteria 10665
64 Ga0068857_100044120 3300005577 Bacteria 3954
65 Ga0068854_100338803 3300005578 Bacteria 1227
66 Ga0068856_100008762 3300005614 Bacteria 9839
67 Ga0068856_100099403 3300005614 Bacteria 2900
68 Ga0070702_100015066 3300005615 Bacteria 3938
69 Ga0070702_100038105 3300005615 Bacteria 2674
70 Ga0068859_100682419 3300005617 Bacteria 1118
71 Ga0068864_101586657 3300005618 Bacteria 658
72 Ga0068861_100037148 3300005719 Bacteria 3620
73 Ga0068851_10159755 3300005834 Bacteria 1237
74 Ga0068863_100627529 3300005841 Bacteria 1065
75 Ga0068860_101097984 3300005843 Bacteria 815
76 Ga0068862_100548166 3300005844 Unclassified 1104
77 Ga0081455_10088175 3300005937 Bacteria 2522
78 Ga0081538_10001503 3300005981 Bacteria 23933
79 Ga0081540_1001335 3300005983 Bacteria 21496
80 Ga0081540_1143438 3300005983 Unclassified 955
81 Ga0070717_10014733 3300006028 Bacteria 6015
82 Ga0070712_100151956 3300006175 Bacteria 1778
83 Ga0070712_100228327 3300006175 Bacteria 1477
84 Ga0070712_100938831 3300006175 Unclassified 747
85 Ga0097621_100333044 3300006237 Bacteria 1347
86 Ga0075431_100493052 3300006847 Bacteria 1217
87 Ga0075433_11042768 3300006852 Bacteria 712
88 Ga0075434_100581888 3300006871 Bacteria 1139
89 Ga0068865_100006636 3300006881 Bacteria 7079
90 Ga0068865_100138231 3300006881 Bacteria 1834
91 Ga0097620_100682435 3300006931 Bacteria 1118
92 Ga0075435_100185425 3300007076 Bacteria 1759
93 Ga0111539_10012751 3300009094 Bacteria 10523
94 Ga0111539_10367971 3300009094 Bacteria 1673
95 Ga0111539_10431753 3300009094 Bacteria 1534
96 Ga0105245_10006942 3300009098 Bacteria 9925
97 Ga0105245_10007115 3300009098 Bacteria 9814
98 Ga0105245_10079199 3300009098 Bacteria 3000
99 Ga0105245_10116464 3300009098 Bacteria 2492
100 Ga0105245_10297756 3300009098 Bacteria 1582
101 Ga0105245_10532872 3300009098 Unclassified 1194
102 Ga0105247_10148265 3300009101 Bacteria 1544
103 Ga0114129_10877861 3300009147 Unclassified 1138
104 Ga0114129_12099872 3300009147 Unclassified 681
105 Ga0105243_10223161 3300009148 Bacteria 1667
106 Ga0105243_10312219 3300009148 Bacteria 1429
107 Ga0105241_10323876 3300009174 Bacteria 1330
108 Ga0105242_10005237 3300009176 Bacteria 10008
109 Ga0105242_10596934 3300009176 Bacteria 1066
110 Ga0105248_10021199 3300009177 Bacteria 7200
111 Ga0105237_10050681 3300009545 Bacteria 4171
112 Ga0105238_10093471 3300009551 Bacteria 2995
113 Ga0105249_10134928 3300009553 Unclassified 2360
114 Ga0105239_10027132 3300010375 Bacteria 6305
115 Ga0105239_10075392 3300010375 Bacteria 3709
116 Ga0105239_10126649 3300010375 Bacteria 2839
117 Ga0105246_10023947 3300011119 Bacteria 3958
118 Ga0105246_11053723 3300011119 Unclassified 740
119 Ga0157342_1047241 3300012507 Unclassified 595
120 Ga0157374_10028620 3300013296 Bacteria 5035
121 Ga0157374_10082266 3300013296 Bacteria 3057
122 Ga0157378_10009952 3300013297 Bacteria 8289
123 Ga0163162_10007734 3300013306 Bacteria 10474
124 Ga0163162_10106270 3300013306 Bacteria 2902
125 Ga0157372_10056077 3300013307 Bacteria 4402
126 Ga0157372_10721275 3300013307 Bacteria 1160
127 Ga0157375_10007650 3300013308 Bacteria 9451
128 Ga0157375_10231604 3300013308 Bacteria 2006
129 Ga0157380_10217584 3300014326 Bacteria 1707
130 Ga0182008_10250383 3300014497 Bacteria 914
131 Ga0182008_10577195 3300014497 Unclassified 628
132 Ga0157377_10002322 3300014745 Bacteria 8370
133 Ga0157377_10186258 3300014745 Bacteria 1309
134 Ga0157377_10249765 3300014745 Bacteria 1149
135 Ga0157379_10636476 3300014968 Bacteria 998
136 Ga0157376_10077906 3300014969 Bacteria 2837
137 Ga0157376_12499917 3300014969 Unclassified 556
138 Ga0207653_10038906 3300025885 Bacteria 1555
139 Ga0207653_10071443 3300025885 Bacteria 1186
140 Ga0207682_10072077 3300025893 Bacteria 1465
141 Ga0207710_10074368 3300025900 Bacteria 1564
142 Ga0207688_10035921 3300025901 Bacteria 2745
143 Ga0207680_10162961 3300025903 Bacteria 1497
144 Ga0207699_10275150 3300025906 Bacteria 1168
145 Ga0207684_10058034 3300025910 Bacteria 3284
146 Ga0207684_10543239 3300025910 Bacteria 994
147 Ga0207654_10088670 3300025911 Bacteria 1880
148 Ga0207707_10255417 3300025912 Bacteria 1522
149 Ga0207707_11270069 3300025912 Bacteria 593
150 Ga0207671_10261993 3300025914 Bacteria 1361
151 Ga0207693_10001256 3300025915 Bacteria 22567
152 Ga0207693_10533017 3300025915 Bacteria 916
153 Ga0207663_10143550 3300025916 Bacteria 1666
154 Ga0207660_10003185 3300025917 Bacteria 10735
155 Ga0207662_10022505 3300025918 Bacteria 3614
156 Ga0207657_10002716 3300025919 Bacteria 19059
157 Ga0207652_11245557 3300025921 Unclassified 646
158 Ga0207646_10025119 3300025922 Bacteria 5453
159 Ga0207646_10814143 3300025922 Bacteria 831
160 Ga0207646_10871526 3300025922 Bacteria 800
161 Ga0207646_10929062 3300025922 Bacteria 771
162 Ga0207681_10469746 3300025923 Bacteria 1026
163 Ga0207659_10226734 3300025926 Bacteria 1505
164 Ga0207687_10031647 3300025927 Bacteria 3577
165 Ga0207687_10448661 3300025927 Bacteria 1069
166 Ga0207687_10594475 3300025927 Bacteria 932
167 Ga0207687_10625666 3300025927 Bacteria 909
168 Ga0207664_10012259 3300025929 Bacteria 6127
169 Ga0207690_10504957 3300025932 Unclassified 978
170 Ga0207690_11230726 3300025932 Unclassified 625
171 Ga0207706_10010931 3300025933 Bacteria 8278
172 Ga0207706_10034995 3300025933 Bacteria 4468
173 Ga0207706_10342966 3300025933 Bacteria 1299
174 Ga0207686_10085588 3300025934 Bacteria 2068
175 Ga0207686_10260966 3300025934 Bacteria 1270
176 Ga0207709_10117008 3300025935 Bacteria 1793
177 Ga0207670_10212675 3300025936 Bacteria 1475
178 Ga0207669_10111041 3300025937 Bacteria 1837
179 Ga0207704_10125391 3300025938 Bacteria 1767
180 Ga0207661_10068472 3300025944 Bacteria 2891
181 Ga0207679_10307000 3300025945 Bacteria 1369
182 Ga0207667_10072793 3300025949 Bacteria 3571
183 Ga0207667_10074302 3300025949 Bacteria 3531
184 Ga0207667_10126994 3300025949 Bacteria 2627
185 Ga0207651_10400807 3300025960 Unclassified 1167
186 Ga0207712_10036052 3300025961 Bacteria 3366
187 Ga0207712_10096753 3300025961 Unclassified 2186
188 Ga0207668_10011321 3300025972 Bacteria 5415
189 Ga0207640_10155555 3300025981 Bacteria 1685
190 Ga0207677_10267467 3300026023 Bacteria 1397
191 Ga0207677_10421308 3300026023 Unclassified 1137
192 Ga0207639_10298751 3300026041 Bacteria 1423
193 Ga0207678_10006146 3300026067 Bacteria 10683
194 Ga0207708_10000515 3300026075 Bacteria 29848
195 Ga0207702_10028695 3300026078 Bacteria 4627
196 Ga0207702_10038598 3300026078 Bacteria 3999
197 Ga0207648_10000705 3300026089 Bacteria 37489
198 Ga0207648_10092258 3300026089 Bacteria 2648
199 Ga0207674_10000923 3300026116 Bacteria 38278
200 Ga0207674_10002109 3300026116 Bacteria 25169
201 Ga0207675_100002893 3300026118 Bacteria 16878
202 Ga0207683_10023530 3300026121 Bacteria 5299
203 Ga0207428_10601617 3300027907 Bacteria 792
204 Ga0268266_10129141 3300028379 Bacteria 2259
205 Ga0268265_10280354 3300028380 Bacteria 1491
206 Ga0268265_10504374 3300028380 Unclassified 1141
207 Ga0307409_100206850 3300031995 Bacteria 1760
208 Ga0307416_100119096 3300032002 Bacteria 2348
209 Ga0307414_10414655 3300032004 Unclassified 1173
210 Ga0307411_11266505 3300032005 Bacteria 671
211 Ga0373943_0355058 3300035170 Bacteria 841
212 Ga0373935_0123103 3300035692 Bacteria 1735
213 Ga0395899_0010130 3300037312 Bacteria 7228
214 Ga0395899_0041718 3300037312 Bacteria 3428
215 Ga0395899_0481253 3300037312 Unclassified 808
216 Ga0395900_0007148 3300037418 Bacteria 11569
217 Ga0395900_0014100 3300037418 Bacteria 8160
218 Ga0395900_0024887 3300037418 Bacteria 6126
219 Ga0395900_0067530 3300037418 Bacteria 3673
220 Ga0395900_0656132 3300037418 Unclassified 985
221 Ga0395898_0003692 3300037466 Bacteria 17010
222 Ga0395898_0004728 3300037466 Bacteria 14820
223 Ga0395898_0010283 3300037466 Bacteria 9792
224 Ga0395898_0354501 3300037466 Bacteria 1399
225 Ga0395898_1195139 3300037466 Unclassified 692
226 Ga0395898_1502528 3300037466 Bacteria 599
227 Ga0395898_1544755 3300037466 Unclassified 589
228 Ga0395905_0002224 3300037471 Bacteria 21889
229 Ga0395905_0012584 3300037471 Bacteria 8140
230 Ga0395905_0020154 3300037471 Bacteria 6317
231 Ga0395905_0020464 3300037471 Bacteria 6268
232 Ga0395905_0023205 3300037471 Bacteria 5864
233 Ga0395905_0296190 3300037471 Unclassified 1505
234 Ga0395905_0595527 3300037471 Unclassified 1007
235 Ga0395901_0008564 3300038443 Bacteria 10336
236 Ga0395901_0016741 3300038443 Bacteria 7470
237 Ga0395901_0032367 3300038443 Bacteria 5396
238 Ga0395901_0043408 3300038443 Bacteria 4663
239 Ga0395901_0061820 3300038443 Bacteria 3897
240 Ga0395901_0165591 3300038443 Unclassified 2321
241 Ga0395901_0189985 3300038443 Bacteria 2154
242 Ga0395901_0250222 3300038443 Unclassified 1846
243 Ga0395901_0292233 3300038443 Unclassified 1691
244 Ga0395901_0339210 3300038443 Unclassified 1553
245 Ga0439461_0001225 3300041410 Bacteria 3913
246 Ga0439461_0025991 3300041410 Unclassified 1192
247 Ga0439461_0076080 3300041410 Unclassified 785
248 Ga0439466_0029708 3300041411 Unclassified 1879
249 Ga0451853_2640462 3300041512 Bacteria 1467
250 Ga0439431_0053578 3300041997 Unclassified 1051
251 Ga0439445_0005343 3300042004 Bacteria 2926
252 Ga0439446_0006147 3300042156 Bacteria 3119
253 Ga0439434_0004397 3300042435 Bacteria 4122
254 Ga0495603_0014784 3300046455 Bacteria 4721
255 Ga0495641_0007636 3300046461 Bacteria 6722
256 Ga0495651_0094089 3300046462 Bacteria 2243
257 Ga0495582_0006027 3300046473 Bacteria 6759
258 Ga0495605_0055675 3300046474 Unclassified 1910
259 Ga0495605_0182187 3300046474 Unclassified 923
260 Ga0495662_0072609 3300046476 Bacteria 1669
261 Ga0495664_0225539 3300046477 Bacteria 1134
262 Ga0495584_0065705 3300046491 Unclassified 1825
263 Ga0495584_0364690 3300046491 Bacteria 734
264 Ga0495585_0126542 3300046492 Unclassified 1348
265 Ga0495594_0108662 3300046499 Bacteria 1563
266 Ga0495596_0028372 3300046500 Unclassified 2248
267 Ga0495608_0137800 3300046511 Unclassified 1559
268 Ga0495608_0420010 3300046511 Unclassified 816
269 Ga0495616_0217207 3300046513 Bacteria 834
270 Ga0495618_0246035 3300046514 Archaea 1123
271 Ga0495628_0096598 3300046516 Bacteria 2282
272 Ga0495630_0133202 3300046517 Unclassified 1888
273 Ga0495630_0447953 3300046517 Bacteria 989
274 Ga0495631_0133023 3300046518 Unclassified 1069
275 Ga0495663_0016177 3300046525 Bacteria 2108
276 Ga0495663_0019822 3300046525 Unclassified 1928
277 Ga0495609_0034278 3300046538 Unclassified 2302
278 Ga0495645_0449204 3300046543 Unclassified 813
279 Ga0495667_0134965 3300046559 Unclassified 1591
280 Ga0495656_0257582 3300046615 Unclassified 883
281 Ga0495659_0019918 3300046664 Bacteria 2249
282 Ga0495659_0225036 3300046664 Bacteria 776
283 Ga0495588_0048425 3300046674 Bacteria 2183
284 Ga0495646_0098120 3300046680 Unclassified 1683
285 Ga0495647_0434795 3300046681 Bacteria 606
286 Ga0495658_0036580 3300046683 Bacteria 2710
287 Ga0495658_0059273 3300046683 Bacteria 2192
288 Ga0495613_0035137 3300046689 Bacteria 3721
289 Ga0495624_0348473 3300046690 Bacteria 891
290 Ga0495671_0083268 3300046692 Unclassified 1568
291 Ga0495581_0000094 3300047315 Bacteria 36744
292 Ga0495581_0015923 3300047315 Bacteria 4369
293 Ga0495674_0217041 3300047319 Unclassified 1582
294 Ga0495676_0002561 3300047321 Bacteria 16185
295 Ga0495684_0094377 3300047471 Bacteria 2265
296 Ga0495602_0532108 3300048088 Unclassified 817
297 Ga0496100_0032253 3300048903 Bacteria 3264
298 Ga0496102_0042354 3300048905 Bacteria 4125
299 Ga0496102_0631429 3300048905 Bacteria 994
300 Ga0496104_0130032 3300048907 Bacteria 2419
301 Ga0496104_0188746 3300048907 Bacteria 1972
302 Ga0496105_0438374 3300048908 Bacteria 1032
303 Ga0496106_0341443 3300048909 Bacteria 1203
304 Ga0496106_1169520 3300048909 Bacteria 601
305 Ga0496107_0415497 3300048910 Bacteria 1000
306 Ga0496108_0035459 3300048911 Bacteria 4147
307 Ga0496108_0158403 3300048911 Bacteria 1956
308 Ga0496108_0189835 3300048911 Unclassified 1781
309 Ga0496108_0368482 3300048911 Bacteria 1254
310 Ga0496109_0011202 3300048912 Bacteria 7696
311 Ga0496109_0020700 3300048912 Bacteria 5810
312 Ga0496109_0169271 3300048912 Unclassified 2049
313 Ga0496109_0227001 3300048912 Bacteria 1756
314 Ga0496110_0052334 3300048913 Bacteria 3588
315 Ga0496110_0145308 3300048913 Bacteria 2145
316 Ga0496110_0253964 3300048913 Bacteria 1600
317 Ga0496110_0998362 3300048913 Bacteria 744
318 Ga0496110_1043922 3300048913 Unclassified 725
319 Ga0496111_0037524 3300048914 Bacteria 3467
320 Ga0496111_0259350 3300048914 Bacteria 1290
321 Ga0496112_0213064 3300048915 Bacteria 1889
322 Ga0496112_0531457 3300048915 Bacteria 1110
323 Ga0496113_0075814 3300048916 Bacteria 2568
324 Ga0496113_0188615 3300048916 Bacteria 1636
325 Ga0496113_0191412 3300048916 Unclassified 1624
326 Ga0496115_0085981 3300048918 Bacteria 2565
327 Ga0501038_0307833 3300049574 Bacteria 1242
328 Ga0501042_0343692 3300049578 Bacteria 1079
329 Ga0501048_0362021 3300049582 Viruses 1035
330 Ga0501067_0005710 3300049583 Bacteria 6906
331 Ga0501069_0000573 3300049585 Bacteria 17009
332 Ga0501072_0312410 3300049588 Viruses 1249
333 Ga0501077_0672988 3300049593 Bacteria 665
334 nmdc:mga05p37_1792351_c1 3300050507 Unclassified 593
335 nmdc:mga08y16_1061935_c1 3300050511 Bacteria 787
336 nmdc:mga08y16_170311_c1 3300050511 Bacteria 2262
337 nmdc:mga0n895_675832_c1 3300050512 Bacteria 1030
338 nmdc:mga0rr50_708848_c1 3300050513 Unclassified 859
339 Ga0495601_0107062 3300053077 Unclassified 1808
340 Ga0495601_0147513 3300053077 Unclassified 1535
341 Ga0495595_0103221 3300053084 Unclassified 1377
342 Ga0501084_0671726 3300054114 Unclassified 874
343 Ga0530510_0031839 3300061734 Bacteria 3792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10577195 Ga0182008_105771951 143
2 3300005983 Ga0081540_1001335 Ga0081540_100133521 161
3 3300005338 Ga0068868_100213442 Ga0068868_1002134422 163
4 3300005457 Ga0070662_100065973 Ga0070662_1000659733 163
5 3300005530 Ga0070679_100688262 Ga0070679_1006882622 163
6 3300005545 Ga0070695_101216808 Ga0070695_1012168081 163
7 3300005563 Ga0068855_100089423 Ga0068855_1000894233 163
8 3300009098 Ga0105245_10006942 Ga0105245_1000694211 163
9 3300010375 Ga0105239_10126649 Ga0105239_101266493 163
10 3300013307 Ga0157372_10056077 Ga0157372_100560775 163
11 3300014745 Ga0157377_10249765 Ga0157377_102497652 163
12 3300025912 Ga0207707_11270069 Ga0207707_112700691 163
13 3300025933 Ga0207706_10010931 Ga0207706_100109313 163
14 3300025949 Ga0207667_10074302 Ga0207667_100743023 163
15 3300046461 Ga0495641_0007636 Ga0495641_0007636_5694_6185 163
16 3300046473 Ga0495582_0006027 Ga0495582_0006027_4067_4558 163
17 3300046517 Ga0495630_0447953 Ga0495630_0447953_294_785 163
18 3300046683 Ga0495658_0036580 Ga0495658_0036580_523_1014 163
19 3300046689 Ga0495613_0035137 Ga0495613_0035137_332_823 163
20 3300047315 Ga0495581_0000094 Ga0495581_0000094_22589_23080 163
21 3300047321 Ga0495676_0002561 Ga0495676_0002561_10256_10747 163
22 3300006871 Ga0075434_100581888 Ga0075434_1005818882 164
23 3300007076 Ga0075435_100185425 Ga0075435_1001854252 164
24 3300009147 Ga0114129_12099872 Ga0114129_120998721 164
25 3300035170 Ga0373943_0355058 Ga0373943_0355058_56_550 164
26 3300035692 Ga0373935_0123103 Ga0373935_0123103_204_698 164
27 3300037312 Ga0395899_0481253 Ga0395899_0481253_148_642 164
28 3300037418 Ga0395900_0007148 Ga0395900_0007148_431_925 164
29 3300037466 Ga0395898_0354501 Ga0395898_0354501_753_1247 164
30 3300037471 Ga0395905_0020154 Ga0395905_0020154_5092_5586 164
31 3300038443 Ga0395901_0016741 Ga0395901_0016741_6503_6997 164
32 3300038443 Ga0395901_0061820 Ga0395901_0061820_2569_3063 164
33 3300038443 Ga0395901_0189985 Ga0395901_0189985_480_977 164
34 3300049593 Ga0501077_0672988 Ga0501077_0672988_98_595 164
35 3300050507 nmdc:mga05p37_1792351_c1 nmdc:mga05p37_1792351_c1_48_542 164
36 3300050512 nmdc:mga0n895_675832_c1 nmdc:mga0n895_675832_c1_192_686 164
37 3300050513 nmdc:mga0rr50_708848_c1 nmdc:mga0rr50_708848_c1_292_786 164
38 3300005364 Ga0070673_100112702 Ga0070673_1001127024 165
39 3300005444 Ga0070694_100339337 Ga0070694_1003393372 165
40 3300005468 Ga0070707_100014133 Ga0070707_10001413312 165
41 3300005577 Ga0068857_100044120 Ga0068857_1000441203 165
42 3300005615 Ga0070702_100038105 Ga0070702_1000381054 165
43 3300006175 Ga0070712_100938831 Ga0070712_1009388312 165
44 3300009094 Ga0111539_10012751 Ga0111539_100127511 165
45 3300009098 Ga0105245_10079199 Ga0105245_100791996 165
46 3300009098 Ga0105245_10297756 Ga0105245_102977562 165
47 3300011119 Ga0105246_11053723 Ga0105246_110537232 165
48 3300013296 Ga0157374_10082266 Ga0157374_100822666 165
49 3300013308 Ga0157375_10007650 Ga0157375_100076508 165
50 3300014497 Ga0182008_10250383 Ga0182008_102503832 165
51 3300014969 Ga0157376_12499917 Ga0157376_124999171 165
52 3300025915 Ga0207693_10533017 Ga0207693_105330172 165
53 3300025922 Ga0207646_10025119 Ga0207646_100251192 165
54 3300025927 Ga0207687_10448661 Ga0207687_104486612 165
55 3300025927 Ga0207687_10625666 Ga0207687_106256662 165
56 3300025932 Ga0207690_11230726 Ga0207690_112307261 165
57 3300025960 Ga0207651_10400807 Ga0207651_104008072 165
58 3300026116 Ga0207674_10000923 Ga0207674_1000092328 165
59 3300027907 Ga0207428_10601617 Ga0207428_106016172 165
60 3300028380 Ga0268265_10504374 Ga0268265_105043742 165
61 3300041512 Ga0451853_2640462 Ga0451853_2640462_729_1232 165
62 3300046474 Ga0495605_0055675 Ga0495605_0055675_901_1404 165
63 3300046491 Ga0495584_0065705 Ga0495584_0065705_742_1245 165
64 3300046492 Ga0495585_0126542 Ga0495585_0126542_579_1082 165
65 3300046500 Ga0495596_0028372 Ga0495596_0028372_365_868 165
66 3300046518 Ga0495631_0133023 Ga0495631_0133023_332_835 165
67 3300046525 Ga0495663_0019822 Ga0495663_0019822_868_1371 165
68 3300046538 Ga0495609_0034278 Ga0495609_0034278_1095_1598 165
69 3300046615 Ga0495656_0257582 Ga0495656_0257582_49_552 165
70 3300046692 Ga0495671_0083268 Ga0495671_0083268_828_1331 165
71 3300048907 Ga0496104_0130032 Ga0496104_0130032_815_1318 165
72 3300048911 Ga0496108_0035459 Ga0496108_0035459_1968_2471 165
73 3300048912 Ga0496109_0227001 Ga0496109_0227001_224_727 165
74 3300048913 Ga0496110_0052334 Ga0496110_0052334_1478_1981 165
75 3300048913 Ga0496110_1043922 Ga0496110_1043922_34_534 165
76 3300048914 Ga0496111_0037524 Ga0496111_0037524_1548_2051 165
77 3300048916 Ga0496113_0075814 Ga0496113_0075814_771_1274 165
78 3300050511 nmdc:mga08y16_1061935_c1 nmdc:mga08y16_1061935_c1_210_710 165
79 3300005981 Ga0081538_10001503 Ga0081538_1000150310 166
80 3300037466 Ga0395898_1195139 Ga0395898_1195139_130_633 166
81 3300005614 Ga0068856_100099403 Ga0068856_1000994033 167
82 3300009094 Ga0111539_10367971 Ga0111539_103679713 167
83 3300026078 Ga0207702_10028695 Ga0207702_100286953 167
84 3300037312 Ga0395899_0041718 Ga0395899_0041718_1549_2064 167
85 3300037418 Ga0395900_0024887 Ga0395900_0024887_5009_5524 167
86 3300037466 Ga0395898_0010283 Ga0395898_0010283_334_849 167
87 3300037471 Ga0395905_0002224 Ga0395905_0002224_9761_10276 167
88 3300038443 Ga0395901_0008564 Ga0395901_0008564_3903_4418 167
89 3300038443 Ga0395901_0292233 Ga0395901_0292233_210_725 167
90 3300046664 Ga0495659_0225036 Ga0495659_0225036_16_519 167
91 3300050511 nmdc:mga08y16_170311_c1 nmdc:mga08y16_170311_c1_20_529 167
92 3300005329 Ga0070683_100009377 Ga0070683_10000937710 168
93 3300005546 Ga0070696_100208602 Ga0070696_1002086021 168
94 3300005564 Ga0070664_100141132 Ga0070664_1001411323 168
95 3300005577 Ga0068857_100005679 Ga0068857_1000056793 168
96 3300025910 Ga0207684_10058034 Ga0207684_100580342 168
97 3300025922 Ga0207646_10871526 Ga0207646_108715261 168
98 3300025945 Ga0207679_10307000 Ga0207679_103070003 168
99 3300026116 Ga0207674_10002109 Ga0207674_1000210921 168
100 3300049583 Ga0501067_0005710 Ga0501067_0005710_654_1160 168
101 3300049585 Ga0501069_0000573 Ga0501069_0000573_1688_2194 168
102 3300061734 Ga0530510_0031839 Ga0530510_0031839_179_685 168
103 3300006852 Ga0075433_11042768 Ga0075433_110427682 169
104 3300005338 Ga0068868_100497545 Ga0068868_1004975452 170
105 3300005445 Ga0070708_100170565 Ga0070708_1001705651 170
106 3300005467 Ga0070706_100248540 Ga0070706_1002485402 170
107 3300005471 Ga0070698_100006283 Ga0070698_1000062836 170
108 3300025910 Ga0207684_10543239 Ga0207684_105432392 170
109 3300026023 Ga0207677_10421308 Ga0207677_104213082 170
110 3300041410 Ga0439461_0025991 Ga0439461_0025991_609_1124 170
111 3300041411 Ga0439466_0029708 Ga0439466_0029708_36_551 170
112 3300048909 Ga0496106_0341443 Ga0496106_0341443_184_696 170
113 3300048910 Ga0496107_0415497 Ga0496107_0415497_75_587 170
114 3300048911 Ga0496108_0368482 Ga0496108_0368482_508_1020 170
115 3300048912 Ga0496109_0011202 Ga0496109_0011202_1651_2163 170
116 3300048913 Ga0496110_0145308 Ga0496110_0145308_1026_1538 170
117 3300048914 Ga0496111_0259350 Ga0496111_0259350_298_810 170
118 3300048915 Ga0496112_0531457 Ga0496112_0531457_519_1034 170
119 3300048916 Ga0496113_0191412 Ga0496113_0191412_532_1044 170
120 3300049574 Ga0501038_0307833 Ga0501038_0307833_612_1127 170
121 3300049578 Ga0501042_0343692 Ga0501042_0343692_549_1064 170
122 3300049582 Ga0501048_0362021 Ga0501048_0362021_338_853 170
123 3300049588 Ga0501072_0312410 Ga0501072_0312410_234_749 170
124 3300054114 Ga0501084_0671726 Ga0501084_0671726_285_800 170
125 3300005341 Ga0070691_10124062 Ga0070691_101240622 171
126 3300005347 Ga0070668_100021194 Ga0070668_1000211942 171
127 3300005435 Ga0070714_100038155 Ga0070714_1000381555 171
128 3300005436 Ga0070713_100114582 Ga0070713_1001145825 171
129 3300005438 Ga0070701_10384518 Ga0070701_103845182 171
130 3300005444 Ga0070694_100323070 Ga0070694_1003230701 171
131 3300005457 Ga0070662_100041395 Ga0070662_1000413955 171
132 3300005459 Ga0068867_100054578 Ga0068867_1000545782 171
133 3300005546 Ga0070696_100492003 Ga0070696_1004920032 171
134 3300005549 Ga0070704_100089418 Ga0070704_1000894182 171
135 3300005563 Ga0068855_100028306 Ga0068855_1000283065 171
136 3300005578 Ga0068854_100338803 Ga0068854_1003388032 171
137 3300005719 Ga0068861_100037148 Ga0068861_1000371482 171
138 3300005844 Ga0068862_100548166 Ga0068862_1005481662 171
139 3300005937 Ga0081455_10088175 Ga0081455_100881752 171
140 3300006028 Ga0070717_10014733 Ga0070717_100147338 171
141 3300006175 Ga0070712_100228327 Ga0070712_1002283272 171
142 3300006881 Ga0068865_100138231 Ga0068865_1001382312 171
143 3300009098 Ga0105245_10116464 Ga0105245_101164642 171
144 3300009148 Ga0105243_10223161 Ga0105243_102231613 171
145 3300009176 Ga0105242_10596934 Ga0105242_105969342 171
146 3300009553 Ga0105249_10134928 Ga0105249_101349282 171
147 3300010375 Ga0105239_10075392 Ga0105239_100753926 171
148 3300013306 Ga0163162_10106270 Ga0163162_101062703 171
149 3300025923 Ga0207681_10469746 Ga0207681_104697462 171
150 3300025927 Ga0207687_10031647 Ga0207687_100316473 171
151 3300025929 Ga0207664_10012259 Ga0207664_100122595 171
152 3300025933 Ga0207706_10034995 Ga0207706_100349953 171
153 3300025934 Ga0207686_10260966 Ga0207686_102609661 171
154 3300025938 Ga0207704_10125391 Ga0207704_101253912 171
155 3300025949 Ga0207667_10072793 Ga0207667_100727933 171
156 3300025961 Ga0207712_10096753 Ga0207712_100967532 171
157 3300025972 Ga0207668_10011321 Ga0207668_100113213 171
158 3300025981 Ga0207640_10155555 Ga0207640_101555552 171
159 3300026089 Ga0207648_10092258 Ga0207648_100922583 171
160 3300026118 Ga0207675_100002893 Ga0207675_10000289314 171
161 3300028380 Ga0268265_10280354 Ga0268265_102803542 171
162 3300046462 Ga0495651_0094089 Ga0495651_0094089_448_966 171
163 3300046477 Ga0495664_0225539 Ga0495664_0225539_527_1045 171
164 3300046511 Ga0495608_0137800 Ga0495608_0137800_629_1147 171
165 3300046511 Ga0495608_0420010 Ga0495608_0420010_256_774 171
166 3300046514 Ga0495618_0246035 Ga0495618_0246035_405_923 171
167 3300046516 Ga0495628_0096598 Ga0495628_0096598_241_759 171
168 3300046517 Ga0495630_0133202 Ga0495630_0133202_133_651 171
169 3300046543 Ga0495645_0449204 Ga0495645_0449204_55_573 171
170 3300046559 Ga0495667_0134965 Ga0495667_0134965_49_567 171
171 3300046680 Ga0495646_0098120 Ga0495646_0098120_833_1351 171
172 3300047319 Ga0495674_0217041 Ga0495674_0217041_220_738 171
173 3300047471 Ga0495684_0094377 Ga0495684_0094377_719_1237 171
174 3300048088 Ga0495602_0532108 Ga0495602_0532108_49_567 171
175 3300048909 Ga0496106_1169520 Ga0496106_1169520_44_562 171
176 3300053077 Ga0495601_0107062 Ga0495601_0107062_996_1514 171
177 3300053077 Ga0495601_0147513 Ga0495601_0147513_22_540 171
178 3300053084 Ga0495595_0103221 Ga0495595_0103221_609_1127 171
179 3300005335 Ga0070666_10074623 Ga0070666_100746231 172
180 3300005336 Ga0070680_100201981 Ga0070680_1002019812 172
181 3300005337 Ga0070682_100032133 Ga0070682_1000321332 172
182 3300005343 Ga0070687_100234275 Ga0070687_1002342752 172
183 3300005345 Ga0070692_10209349 Ga0070692_102093492 172
184 3300005347 Ga0070668_100219745 Ga0070668_1002197452 172
185 3300005353 Ga0070669_100422661 Ga0070669_1004226612 172
186 3300005364 Ga0070673_100201850 Ga0070673_1002018503 172
187 3300005365 Ga0070688_100007444 Ga0070688_1000074447 172
188 3300005366 Ga0070659_100365789 Ga0070659_1003657892 172
189 3300005367 Ga0070667_100342136 Ga0070667_1003421362 172
190 3300005406 Ga0070703_10090500 Ga0070703_100905002 172
191 3300005434 Ga0070709_10067463 Ga0070709_100674632 172
192 3300005435 Ga0070714_100215918 Ga0070714_1002159182 172
193 3300005437 Ga0070710_10093085 Ga0070710_100930852 172
194 3300005438 Ga0070701_10003678 Ga0070701_100036784 172
195 3300005439 Ga0070711_100006925 Ga0070711_1000069254 172
196 3300005440 Ga0070705_100126949 Ga0070705_1001269493 172
197 3300005441 Ga0070700_100113057 Ga0070700_1001130572 172
198 3300005444 Ga0070694_100262901 Ga0070694_1002629012 172
199 3300005455 Ga0070663_100107337 Ga0070663_1001073374 172
200 3300005456 Ga0070678_100018547 Ga0070678_1000185474 172
201 3300005466 Ga0070685_10048261 Ga0070685_100482614 172
202 3300005468 Ga0070707_100545171 Ga0070707_1005451712 172
203 3300005539 Ga0068853_100075864 Ga0068853_1000758644 172
204 3300005543 Ga0070672_100159215 Ga0070672_1001592152 172
205 3300005546 Ga0070696_100026320 Ga0070696_1000263202 172
206 3300005547 Ga0070693_100250999 Ga0070693_1002509992 172
207 3300005548 Ga0070665_100033262 Ga0070665_1000332627 172
208 3300005549 Ga0070704_100039962 Ga0070704_1000399622 172
209 3300005563 Ga0068855_100650758 Ga0068855_1006507582 172
210 3300005614 Ga0068856_100008762 Ga0068856_10000876211 172
211 3300005615 Ga0070702_100015066 Ga0070702_1000150666 172
212 3300005617 Ga0068859_100682419 Ga0068859_1006824192 172
213 3300005618 Ga0068864_101586657 Ga0068864_1015866571 172
214 3300005841 Ga0068863_100627529 Ga0068863_1006275292 172
215 3300005843 Ga0068860_101097984 Ga0068860_1010979842 172
216 3300006175 Ga0070712_100151956 Ga0070712_1001519563 172
217 3300006237 Ga0097621_100333044 Ga0097621_1003330442 172
218 3300006881 Ga0068865_100006636 Ga0068865_1000066367 172
219 3300006931 Ga0097620_100682435 Ga0097620_1006824352 172
220 3300009098 Ga0105245_10532872 Ga0105245_105328722 172
221 3300009101 Ga0105247_10148265 Ga0105247_101482652 172
222 3300009147 Ga0114129_10877861 Ga0114129_108778611 172
223 3300009148 Ga0105243_10312219 Ga0105243_103122192 172
224 3300009174 Ga0105241_10323876 Ga0105241_103238762 172
225 3300009176 Ga0105242_10005237 Ga0105242_100052372 172
226 3300009177 Ga0105248_10021199 Ga0105248_100211993 172
227 3300009545 Ga0105237_10050681 Ga0105237_100506817 172
228 3300009551 Ga0105238_10093471 Ga0105238_100934711 172
229 3300010375 Ga0105239_10027132 Ga0105239_100271322 172
230 3300011119 Ga0105246_10023947 Ga0105246_100239476 172
231 3300013296 Ga0157374_10028620 Ga0157374_100286202 172
232 3300013297 Ga0157378_10009952 Ga0157378_100099524 172
233 3300013306 Ga0163162_10007734 Ga0163162_100077344 172
234 3300013307 Ga0157372_10721275 Ga0157372_107212752 172
235 3300013308 Ga0157375_10231604 Ga0157375_102316042 172
236 3300014326 Ga0157380_10217584 Ga0157380_102175842 172
237 3300014745 Ga0157377_10002322 Ga0157377_100023223 172
238 3300014968 Ga0157379_10636476 Ga0157379_106364762 172
239 3300014969 Ga0157376_10077906 Ga0157376_100779065 172
240 3300025885 Ga0207653_10038906 Ga0207653_100389062 172
241 3300025893 Ga0207682_10072077 Ga0207682_100720772 172
242 3300025900 Ga0207710_10074368 Ga0207710_100743682 172
243 3300025903 Ga0207680_10162961 Ga0207680_101629613 172
244 3300025906 Ga0207699_10275150 Ga0207699_102751502 172
245 3300025911 Ga0207654_10088670 Ga0207654_100886703 172
246 3300025914 Ga0207671_10261993 Ga0207671_102619932 172
247 3300025915 Ga0207693_10001256 Ga0207693_100012562 172
248 3300025916 Ga0207663_10143550 Ga0207663_101435502 172
249 3300025917 Ga0207660_10003185 Ga0207660_100031859 172
250 3300025918 Ga0207662_10022505 Ga0207662_100225055 172
251 3300025919 Ga0207657_10002716 Ga0207657_100027166 172
252 3300025921 Ga0207652_11245557 Ga0207652_112455572 172
253 3300025932 Ga0207690_10504957 Ga0207690_105049572 172
254 3300025933 Ga0207706_10342966 Ga0207706_103429661 172
255 3300025934 Ga0207686_10085588 Ga0207686_100855883 172
256 3300025935 Ga0207709_10117008 Ga0207709_101170083 172
257 3300025936 Ga0207670_10212675 Ga0207670_102126752 172
258 3300025937 Ga0207669_10111041 Ga0207669_101110411 172
259 3300025949 Ga0207667_10126994 Ga0207667_101269944 172
260 3300025961 Ga0207712_10036052 Ga0207712_100360526 172
261 3300026041 Ga0207639_10298751 Ga0207639_102987512 172
262 3300026067 Ga0207678_10006146 Ga0207678_1000614612 172
263 3300026075 Ga0207708_10000515 Ga0207708_100005158 172
264 3300026078 Ga0207702_10038598 Ga0207702_100385984 172
265 3300026089 Ga0207648_10000705 Ga0207648_100007058 172
266 3300026121 Ga0207683_10023530 Ga0207683_100235303 172
267 3300028379 Ga0268266_10129141 Ga0268266_101291413 172
268 3300032005 Ga0307411_11266505 Ga0307411_112665051 172
269 3300046455 Ga0495603_0014784 Ga0495603_0014784_182_706 172
270 3300046474 Ga0495605_0182187 Ga0495605_0182187_309_833 172
271 3300046476 Ga0495662_0072609 Ga0495662_0072609_448_972 172
272 3300046491 Ga0495584_0364690 Ga0495584_0364690_135_659 172
273 3300046499 Ga0495594_0108662 Ga0495594_0108662_842_1366 172
274 3300046513 Ga0495616_0217207 Ga0495616_0217207_162_686 172
275 3300046525 Ga0495663_0016177 Ga0495663_0016177_902_1426 172
276 3300046664 Ga0495659_0019918 Ga0495659_0019918_1709_2233 172
277 3300046674 Ga0495588_0048425 Ga0495588_0048425_1521_2045 172
278 3300046681 Ga0495647_0434795 Ga0495647_0434795_71_595 172
279 3300046683 Ga0495658_0059273 Ga0495658_0059273_1137_1661 172
280 3300046690 Ga0495624_0348473 Ga0495624_0348473_234_758 172
281 3300047315 Ga0495581_0015923 Ga0495581_0015923_2873_3397 172
282 3300048903 Ga0496100_0032253 Ga0496100_0032253_629_1153 172
283 3300048905 Ga0496102_0042354 Ga0496102_0042354_1273_1797 172
284 3300048907 Ga0496104_0188746 Ga0496104_0188746_486_1010 172
285 3300048908 Ga0496105_0438374 Ga0496105_0438374_392_916 172
286 3300048911 Ga0496108_0158403 Ga0496108_0158403_400_924 172
287 3300048912 Ga0496109_0020700 Ga0496109_0020700_766_1290 172
288 3300048913 Ga0496110_0998362 Ga0496110_0998362_124_648 172
289 3300048916 Ga0496113_0188615 Ga0496113_0188615_344_868 172
290 3300048918 Ga0496115_0085981 Ga0496115_0085981_1791_2315 172
291 3300006847 Ga0075431_100493052 Ga0075431_1004930522 173
292 3300031995 Ga0307409_100206850 Ga0307409_1002068502 173
293 3300032002 Ga0307416_100119096 Ga0307416_1001190963 173
294 3300032004 Ga0307414_10414655 Ga0307414_104146552 173
295 3300037466 Ga0395898_1544755 Ga0395898_1544755_30_557 173
296 3300041410 Ga0439461_0076080 Ga0439461_0076080_14_541 173
297 3300005458 Ga0070681_11030713 Ga0070681_110307132 174
298 3300009094 Ga0111539_10431753 Ga0111539_104317531 174
299 3300012507 Ga0157342_1047241 Ga0157342_10472411 174
300 3300025912 Ga0207707_10255417 Ga0207707_102554172 174
301 3300025922 Ga0207646_10929062 Ga0207646_109290622 174
302 3300037312 Ga0395899_0010130 Ga0395899_0010130_3053_3583 174
303 3300037418 Ga0395900_0014100 Ga0395900_0014100_3038_3568 174
304 3300037418 Ga0395900_0067530 Ga0395900_0067530_889_1425 174
305 3300037418 Ga0395900_0656132 Ga0395900_0656132_354_884 174
306 3300037466 Ga0395898_0003692 Ga0395898_0003692_1539_2069 174
307 3300037466 Ga0395898_0004728 Ga0395898_0004728_686_1216 174
308 3300037466 Ga0395898_1502528 Ga0395898_1502528_11_547 174
309 3300037471 Ga0395905_0012584 Ga0395905_0012584_6921_7451 174
310 3300037471 Ga0395905_0020464 Ga0395905_0020464_3264_3794 174
311 3300037471 Ga0395905_0023205 Ga0395905_0023205_3687_4223 174
312 3300037471 Ga0395905_0296190 Ga0395905_0296190_118_666 174
313 3300038443 Ga0395901_0043408 Ga0395901_0043408_219_755 174
314 3300038443 Ga0395901_0165591 Ga0395901_0165591_81_611 174
315 3300038443 Ga0395901_0250222 Ga0395901_0250222_306_836 174
316 3300038443 Ga0395901_0339210 Ga0395901_0339210_830_1378 174
317 3300041410 Ga0439461_0001225 Ga0439461_0001225_3195_3725 174
318 3300041997 Ga0439431_0053578 Ga0439431_0053578_216_746 174
319 3300042004 Ga0439445_0005343 Ga0439445_0005343_410_940 174
320 3300042156 Ga0439446_0006147 Ga0439446_0006147_136_666 174
321 3300042435 Ga0439434_0004397 Ga0439434_0004397_3501_4031 174
322 3300005983 Ga0081540_1143438 Ga0081540_11434381 176
323 3300025885 Ga0207653_10071443 Ga0207653_100714432 176
324 3300025922 Ga0207646_10814143 Ga0207646_108141431 176
325 3300005328 Ga0070676_10678891 Ga0070676_106788911 182
326 3300005329 Ga0070683_100145347 Ga0070683_1001453471 182
327 3300005466 Ga0070685_10027717 Ga0070685_100277175 182
328 3300005549 Ga0070704_100576370 Ga0070704_1005763702 182
329 3300005834 Ga0068851_10159755 Ga0068851_101597552 182
330 3300009098 Ga0105245_10007115 Ga0105245_100071154 182
331 3300014745 Ga0157377_10186258 Ga0157377_101862581 182
332 3300025901 Ga0207688_10035921 Ga0207688_100359212 182
333 3300025926 Ga0207659_10226734 Ga0207659_102267343 182
334 3300025927 Ga0207687_10594475 Ga0207687_105944752 182
335 3300025944 Ga0207661_10068472 Ga0207661_100684723 182
336 3300026023 Ga0207677_10267467 Ga0207677_102674672 182
337 3300037471 Ga0395905_0595527 Ga0395905_0595527_181_789 182
338 3300038443 Ga0395901_0032367 Ga0395901_0032367_2141_2749 182
339 3300048905 Ga0496102_0631429 Ga0496102_0631429_349_903 182
340 3300048911 Ga0496108_0189835 Ga0496108_0189835_945_1499 182
341 3300048912 Ga0496109_0169271 Ga0496109_0169271_873_1421 182
342 3300048913 Ga0496110_0253964 Ga0496110_0253964_777_1325 182
343 3300048915 Ga0496112_0213064 Ga0496112_0213064_597_1151 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

29

174

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtj-assembly1.cif.gz_A-2 3-deoxy-manno-octulosonate cytidylyltransferase from yersinia pestis 0.826 10 124
8b31-assembly1.cif.gz_B crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 0.823 9 142
1vic-assembly3.cif.gz_B crystal structure of cmp-kdo synthetase 0.814 10 124
2waw-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis rv0371c homolog from mycobacterium sp. strain jc1 0.807 8 171
3k8e-assembly2.cif.gz_A crystal structure of e. coli lipopolysaccharide specific cmp-kdo synthetase 0.7952 10 122
ID Description Score Start End Superfamily
af_A0A0P0VBA2_1_174_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8366 72 141 3.90.550.10
af_P9WJQ9_9_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8313 9 171 3.90.550.10
af_Q61647_178_371_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8027 71 122 3.90.550.10
af_Q2FVY4_1_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7895 11 171 3.90.550.10
2weeA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.778 7 171 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A538F2W8-F1-model_v4 Nucleotidyltransferase family protein 0.98 8 172 GO:0016779
AF-A0A538M2P6-F1-model_v4 Nucleotidyltransferase family protein 0.9786 8 178 GO:0016779
AF-A0A7M2Z016-F1-model_v4 Putative MobA-related protein 0.978 8 177 GO:0016779
AF-A0A7M2Z016-F1-model_v4 Putative MobA-related protein 0.9668 8 177 GO:0016779
AF-A0A538IA21-F1-model_v4 Nucleotidyltransferase family protein 0.9643 1 172 GO:0016779

Feature Viewer

pLDDT pTM Quality
91.32 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map