F415674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 220 | 343 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0595527|Ga0395905_0595527_181_789 |
| Length | 202 |
| Sequence | LQRLKRVQIERLAGVRDGSVTVFGTGVCGVVLAAGASSRFGSPKQRLLLEPVLSRVRRSSVDDVVVVLGAHEVETSARTVRCPEWERGPGASLRCGLEALPPETEAAIVVLGDGPDLAPEAIDRVIATWRSTDAEVIAATYGGVRLHPLLIARAQWPAVPDEGLRSLAAVLVPCDDLGPPGDVDFSDEIPESLRPKPPTAES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 144 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 152 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 153 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 154 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 155 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 156 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 157 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 158 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 199 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.75 |
| Rhizosphere | 90.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10678891 | 3300005328 | Bacteria | 750 |
| 2 | Ga0070683_100009377 | 3300005329 | Bacteria | 8368 |
| 3 | Ga0070683_100145347 | 3300005329 | Bacteria | 2247 |
| 4 | Ga0070666_10074623 | 3300005335 | Bacteria | 2312 |
| 5 | Ga0070680_100201981 | 3300005336 | Bacteria | 1676 |
| 6 | Ga0070682_100032133 | 3300005337 | Bacteria | 3180 |
| 7 | Ga0068868_100213442 | 3300005338 | Bacteria | 1614 |
| 8 | Ga0068868_100497545 | 3300005338 | Unclassified | 1067 |
| 9 | Ga0070691_10124062 | 3300005341 | Unclassified | 1303 |
| 10 | Ga0070687_100234275 | 3300005343 | Bacteria | 1132 |
| 11 | Ga0070692_10209349 | 3300005345 | Bacteria | 1146 |
| 12 | Ga0070668_100021194 | 3300005347 | Bacteria | 4912 |
| 13 | Ga0070668_100219745 | 3300005347 | Bacteria | 1567 |
| 14 | Ga0070669_100422661 | 3300005353 | Bacteria | 1094 |
| 15 | Ga0070673_100112702 | 3300005364 | Bacteria | 2258 |
| 16 | Ga0070673_100201850 | 3300005364 | Bacteria | 1713 |
| 17 | Ga0070688_100007444 | 3300005365 | Bacteria | 5903 |
| 18 | Ga0070659_100365789 | 3300005366 | Bacteria | 1212 |
| 19 | Ga0070667_100342136 | 3300005367 | Bacteria | 1353 |
| 20 | Ga0070703_10090500 | 3300005406 | Unclassified | 1060 |
| 21 | Ga0070709_10067463 | 3300005434 | Bacteria | 2297 |
| 22 | Ga0070714_100038155 | 3300005435 | Bacteria | 4040 |
| 23 | Ga0070714_100215918 | 3300005435 | Bacteria | 1760 |
| 24 | Ga0070713_100114582 | 3300005436 | Bacteria | 2355 |
| 25 | Ga0070710_10093085 | 3300005437 | Bacteria | 1781 |
| 26 | Ga0070701_10003678 | 3300005438 | Bacteria | 6111 |
| 27 | Ga0070701_10384518 | 3300005438 | Unclassified | 885 |
| 28 | Ga0070711_100006925 | 3300005439 | Bacteria | 6873 |
| 29 | Ga0070705_100126949 | 3300005440 | Bacteria | 1657 |
| 30 | Ga0070700_100113057 | 3300005441 | Unclassified | 1808 |
| 31 | Ga0070694_100262901 | 3300005444 | Bacteria | 1309 |
| 32 | Ga0070694_100323070 | 3300005444 | Unclassified | 1188 |
| 33 | Ga0070694_100339337 | 3300005444 | Unclassified | 1161 |
| 34 | Ga0070708_100170565 | 3300005445 | Bacteria | 2031 |
| 35 | Ga0070663_100107337 | 3300005455 | Bacteria | 2093 |
| 36 | Ga0070678_100018547 | 3300005456 | Bacteria | 4511 |
| 37 | Ga0070662_100041395 | 3300005457 | Bacteria | 3286 |
| 38 | Ga0070662_100065973 | 3300005457 | Bacteria | 2655 |
| 39 | Ga0070681_11030713 | 3300005458 | Unclassified | 743 |
| 40 | Ga0068867_100054578 | 3300005459 | Bacteria | 2952 |
| 41 | Ga0070685_10027717 | 3300005466 | Bacteria | 3134 |
| 42 | Ga0070685_10048261 | 3300005466 | Bacteria | 2452 |
| 43 | Ga0070706_100248540 | 3300005467 | Bacteria | 1661 |
| 44 | Ga0070707_100014133 | 3300005468 | Bacteria | 7481 |
| 45 | Ga0070707_100545171 | 3300005468 | Bacteria | 1122 |
| 46 | Ga0070698_100006283 | 3300005471 | Bacteria | 12909 |
| 47 | Ga0070679_100688262 | 3300005530 | Bacteria | 965 |
| 48 | Ga0068853_100075864 | 3300005539 | Bacteria | 2935 |
| 49 | Ga0070672_100159215 | 3300005543 | Bacteria | 1872 |
| 50 | Ga0070695_101216808 | 3300005545 | Bacteria | 620 |
| 51 | Ga0070696_100026320 | 3300005546 | Bacteria | 3957 |
| 52 | Ga0070696_100208602 | 3300005546 | Unclassified | 1462 |
| 53 | Ga0070696_100492003 | 3300005546 | Bacteria | 974 |
| 54 | Ga0070693_100250999 | 3300005547 | Bacteria | 1173 |
| 55 | Ga0070665_100033262 | 3300005548 | Bacteria | 5188 |
| 56 | Ga0070704_100039962 | 3300005549 | Bacteria | 3225 |
| 57 | Ga0070704_100089418 | 3300005549 | Bacteria | 2291 |
| 58 | Ga0070704_100576370 | 3300005549 | Bacteria | 986 |
| 59 | Ga0068855_100028306 | 3300005563 | Bacteria | 6703 |
| 60 | Ga0068855_100089423 | 3300005563 | Bacteria | 3555 |
| 61 | Ga0068855_100650758 | 3300005563 | Unclassified | 1132 |
| 62 | Ga0070664_100141132 | 3300005564 | Bacteria | 2121 |
| 63 | Ga0068857_100005679 | 3300005577 | Bacteria | 10665 |
| 64 | Ga0068857_100044120 | 3300005577 | Bacteria | 3954 |
| 65 | Ga0068854_100338803 | 3300005578 | Bacteria | 1227 |
| 66 | Ga0068856_100008762 | 3300005614 | Bacteria | 9839 |
| 67 | Ga0068856_100099403 | 3300005614 | Bacteria | 2900 |
| 68 | Ga0070702_100015066 | 3300005615 | Bacteria | 3938 |
| 69 | Ga0070702_100038105 | 3300005615 | Bacteria | 2674 |
| 70 | Ga0068859_100682419 | 3300005617 | Bacteria | 1118 |
| 71 | Ga0068864_101586657 | 3300005618 | Bacteria | 658 |
| 72 | Ga0068861_100037148 | 3300005719 | Bacteria | 3620 |
| 73 | Ga0068851_10159755 | 3300005834 | Bacteria | 1237 |
| 74 | Ga0068863_100627529 | 3300005841 | Bacteria | 1065 |
| 75 | Ga0068860_101097984 | 3300005843 | Bacteria | 815 |
| 76 | Ga0068862_100548166 | 3300005844 | Unclassified | 1104 |
| 77 | Ga0081455_10088175 | 3300005937 | Bacteria | 2522 |
| 78 | Ga0081538_10001503 | 3300005981 | Bacteria | 23933 |
| 79 | Ga0081540_1001335 | 3300005983 | Bacteria | 21496 |
| 80 | Ga0081540_1143438 | 3300005983 | Unclassified | 955 |
| 81 | Ga0070717_10014733 | 3300006028 | Bacteria | 6015 |
| 82 | Ga0070712_100151956 | 3300006175 | Bacteria | 1778 |
| 83 | Ga0070712_100228327 | 3300006175 | Bacteria | 1477 |
| 84 | Ga0070712_100938831 | 3300006175 | Unclassified | 747 |
| 85 | Ga0097621_100333044 | 3300006237 | Bacteria | 1347 |
| 86 | Ga0075431_100493052 | 3300006847 | Bacteria | 1217 |
| 87 | Ga0075433_11042768 | 3300006852 | Bacteria | 712 |
| 88 | Ga0075434_100581888 | 3300006871 | Bacteria | 1139 |
| 89 | Ga0068865_100006636 | 3300006881 | Bacteria | 7079 |
| 90 | Ga0068865_100138231 | 3300006881 | Bacteria | 1834 |
| 91 | Ga0097620_100682435 | 3300006931 | Bacteria | 1118 |
| 92 | Ga0075435_100185425 | 3300007076 | Bacteria | 1759 |
| 93 | Ga0111539_10012751 | 3300009094 | Bacteria | 10523 |
| 94 | Ga0111539_10367971 | 3300009094 | Bacteria | 1673 |
| 95 | Ga0111539_10431753 | 3300009094 | Bacteria | 1534 |
| 96 | Ga0105245_10006942 | 3300009098 | Bacteria | 9925 |
| 97 | Ga0105245_10007115 | 3300009098 | Bacteria | 9814 |
| 98 | Ga0105245_10079199 | 3300009098 | Bacteria | 3000 |
| 99 | Ga0105245_10116464 | 3300009098 | Bacteria | 2492 |
| 100 | Ga0105245_10297756 | 3300009098 | Bacteria | 1582 |
| 101 | Ga0105245_10532872 | 3300009098 | Unclassified | 1194 |
| 102 | Ga0105247_10148265 | 3300009101 | Bacteria | 1544 |
| 103 | Ga0114129_10877861 | 3300009147 | Unclassified | 1138 |
| 104 | Ga0114129_12099872 | 3300009147 | Unclassified | 681 |
| 105 | Ga0105243_10223161 | 3300009148 | Bacteria | 1667 |
| 106 | Ga0105243_10312219 | 3300009148 | Bacteria | 1429 |
| 107 | Ga0105241_10323876 | 3300009174 | Bacteria | 1330 |
| 108 | Ga0105242_10005237 | 3300009176 | Bacteria | 10008 |
| 109 | Ga0105242_10596934 | 3300009176 | Bacteria | 1066 |
| 110 | Ga0105248_10021199 | 3300009177 | Bacteria | 7200 |
| 111 | Ga0105237_10050681 | 3300009545 | Bacteria | 4171 |
| 112 | Ga0105238_10093471 | 3300009551 | Bacteria | 2995 |
| 113 | Ga0105249_10134928 | 3300009553 | Unclassified | 2360 |
| 114 | Ga0105239_10027132 | 3300010375 | Bacteria | 6305 |
| 115 | Ga0105239_10075392 | 3300010375 | Bacteria | 3709 |
| 116 | Ga0105239_10126649 | 3300010375 | Bacteria | 2839 |
| 117 | Ga0105246_10023947 | 3300011119 | Bacteria | 3958 |
| 118 | Ga0105246_11053723 | 3300011119 | Unclassified | 740 |
| 119 | Ga0157342_1047241 | 3300012507 | Unclassified | 595 |
| 120 | Ga0157374_10028620 | 3300013296 | Bacteria | 5035 |
| 121 | Ga0157374_10082266 | 3300013296 | Bacteria | 3057 |
| 122 | Ga0157378_10009952 | 3300013297 | Bacteria | 8289 |
| 123 | Ga0163162_10007734 | 3300013306 | Bacteria | 10474 |
| 124 | Ga0163162_10106270 | 3300013306 | Bacteria | 2902 |
| 125 | Ga0157372_10056077 | 3300013307 | Bacteria | 4402 |
| 126 | Ga0157372_10721275 | 3300013307 | Bacteria | 1160 |
| 127 | Ga0157375_10007650 | 3300013308 | Bacteria | 9451 |
| 128 | Ga0157375_10231604 | 3300013308 | Bacteria | 2006 |
| 129 | Ga0157380_10217584 | 3300014326 | Bacteria | 1707 |
| 130 | Ga0182008_10250383 | 3300014497 | Bacteria | 914 |
| 131 | Ga0182008_10577195 | 3300014497 | Unclassified | 628 |
| 132 | Ga0157377_10002322 | 3300014745 | Bacteria | 8370 |
| 133 | Ga0157377_10186258 | 3300014745 | Bacteria | 1309 |
| 134 | Ga0157377_10249765 | 3300014745 | Bacteria | 1149 |
| 135 | Ga0157379_10636476 | 3300014968 | Bacteria | 998 |
| 136 | Ga0157376_10077906 | 3300014969 | Bacteria | 2837 |
| 137 | Ga0157376_12499917 | 3300014969 | Unclassified | 556 |
| 138 | Ga0207653_10038906 | 3300025885 | Bacteria | 1555 |
| 139 | Ga0207653_10071443 | 3300025885 | Bacteria | 1186 |
| 140 | Ga0207682_10072077 | 3300025893 | Bacteria | 1465 |
| 141 | Ga0207710_10074368 | 3300025900 | Bacteria | 1564 |
| 142 | Ga0207688_10035921 | 3300025901 | Bacteria | 2745 |
| 143 | Ga0207680_10162961 | 3300025903 | Bacteria | 1497 |
| 144 | Ga0207699_10275150 | 3300025906 | Bacteria | 1168 |
| 145 | Ga0207684_10058034 | 3300025910 | Bacteria | 3284 |
| 146 | Ga0207684_10543239 | 3300025910 | Bacteria | 994 |
| 147 | Ga0207654_10088670 | 3300025911 | Bacteria | 1880 |
| 148 | Ga0207707_10255417 | 3300025912 | Bacteria | 1522 |
| 149 | Ga0207707_11270069 | 3300025912 | Bacteria | 593 |
| 150 | Ga0207671_10261993 | 3300025914 | Bacteria | 1361 |
| 151 | Ga0207693_10001256 | 3300025915 | Bacteria | 22567 |
| 152 | Ga0207693_10533017 | 3300025915 | Bacteria | 916 |
| 153 | Ga0207663_10143550 | 3300025916 | Bacteria | 1666 |
| 154 | Ga0207660_10003185 | 3300025917 | Bacteria | 10735 |
| 155 | Ga0207662_10022505 | 3300025918 | Bacteria | 3614 |
| 156 | Ga0207657_10002716 | 3300025919 | Bacteria | 19059 |
| 157 | Ga0207652_11245557 | 3300025921 | Unclassified | 646 |
| 158 | Ga0207646_10025119 | 3300025922 | Bacteria | 5453 |
| 159 | Ga0207646_10814143 | 3300025922 | Bacteria | 831 |
| 160 | Ga0207646_10871526 | 3300025922 | Bacteria | 800 |
| 161 | Ga0207646_10929062 | 3300025922 | Bacteria | 771 |
| 162 | Ga0207681_10469746 | 3300025923 | Bacteria | 1026 |
| 163 | Ga0207659_10226734 | 3300025926 | Bacteria | 1505 |
| 164 | Ga0207687_10031647 | 3300025927 | Bacteria | 3577 |
| 165 | Ga0207687_10448661 | 3300025927 | Bacteria | 1069 |
| 166 | Ga0207687_10594475 | 3300025927 | Bacteria | 932 |
| 167 | Ga0207687_10625666 | 3300025927 | Bacteria | 909 |
| 168 | Ga0207664_10012259 | 3300025929 | Bacteria | 6127 |
| 169 | Ga0207690_10504957 | 3300025932 | Unclassified | 978 |
| 170 | Ga0207690_11230726 | 3300025932 | Unclassified | 625 |
| 171 | Ga0207706_10010931 | 3300025933 | Bacteria | 8278 |
| 172 | Ga0207706_10034995 | 3300025933 | Bacteria | 4468 |
| 173 | Ga0207706_10342966 | 3300025933 | Bacteria | 1299 |
| 174 | Ga0207686_10085588 | 3300025934 | Bacteria | 2068 |
| 175 | Ga0207686_10260966 | 3300025934 | Bacteria | 1270 |
| 176 | Ga0207709_10117008 | 3300025935 | Bacteria | 1793 |
| 177 | Ga0207670_10212675 | 3300025936 | Bacteria | 1475 |
| 178 | Ga0207669_10111041 | 3300025937 | Bacteria | 1837 |
| 179 | Ga0207704_10125391 | 3300025938 | Bacteria | 1767 |
| 180 | Ga0207661_10068472 | 3300025944 | Bacteria | 2891 |
| 181 | Ga0207679_10307000 | 3300025945 | Bacteria | 1369 |
| 182 | Ga0207667_10072793 | 3300025949 | Bacteria | 3571 |
| 183 | Ga0207667_10074302 | 3300025949 | Bacteria | 3531 |
| 184 | Ga0207667_10126994 | 3300025949 | Bacteria | 2627 |
| 185 | Ga0207651_10400807 | 3300025960 | Unclassified | 1167 |
| 186 | Ga0207712_10036052 | 3300025961 | Bacteria | 3366 |
| 187 | Ga0207712_10096753 | 3300025961 | Unclassified | 2186 |
| 188 | Ga0207668_10011321 | 3300025972 | Bacteria | 5415 |
| 189 | Ga0207640_10155555 | 3300025981 | Bacteria | 1685 |
| 190 | Ga0207677_10267467 | 3300026023 | Bacteria | 1397 |
| 191 | Ga0207677_10421308 | 3300026023 | Unclassified | 1137 |
| 192 | Ga0207639_10298751 | 3300026041 | Bacteria | 1423 |
| 193 | Ga0207678_10006146 | 3300026067 | Bacteria | 10683 |
| 194 | Ga0207708_10000515 | 3300026075 | Bacteria | 29848 |
| 195 | Ga0207702_10028695 | 3300026078 | Bacteria | 4627 |
| 196 | Ga0207702_10038598 | 3300026078 | Bacteria | 3999 |
| 197 | Ga0207648_10000705 | 3300026089 | Bacteria | 37489 |
| 198 | Ga0207648_10092258 | 3300026089 | Bacteria | 2648 |
| 199 | Ga0207674_10000923 | 3300026116 | Bacteria | 38278 |
| 200 | Ga0207674_10002109 | 3300026116 | Bacteria | 25169 |
| 201 | Ga0207675_100002893 | 3300026118 | Bacteria | 16878 |
| 202 | Ga0207683_10023530 | 3300026121 | Bacteria | 5299 |
| 203 | Ga0207428_10601617 | 3300027907 | Bacteria | 792 |
| 204 | Ga0268266_10129141 | 3300028379 | Bacteria | 2259 |
| 205 | Ga0268265_10280354 | 3300028380 | Bacteria | 1491 |
| 206 | Ga0268265_10504374 | 3300028380 | Unclassified | 1141 |
| 207 | Ga0307409_100206850 | 3300031995 | Bacteria | 1760 |
| 208 | Ga0307416_100119096 | 3300032002 | Bacteria | 2348 |
| 209 | Ga0307414_10414655 | 3300032004 | Unclassified | 1173 |
| 210 | Ga0307411_11266505 | 3300032005 | Bacteria | 671 |
| 211 | Ga0373943_0355058 | 3300035170 | Bacteria | 841 |
| 212 | Ga0373935_0123103 | 3300035692 | Bacteria | 1735 |
| 213 | Ga0395899_0010130 | 3300037312 | Bacteria | 7228 |
| 214 | Ga0395899_0041718 | 3300037312 | Bacteria | 3428 |
| 215 | Ga0395899_0481253 | 3300037312 | Unclassified | 808 |
| 216 | Ga0395900_0007148 | 3300037418 | Bacteria | 11569 |
| 217 | Ga0395900_0014100 | 3300037418 | Bacteria | 8160 |
| 218 | Ga0395900_0024887 | 3300037418 | Bacteria | 6126 |
| 219 | Ga0395900_0067530 | 3300037418 | Bacteria | 3673 |
| 220 | Ga0395900_0656132 | 3300037418 | Unclassified | 985 |
| 221 | Ga0395898_0003692 | 3300037466 | Bacteria | 17010 |
| 222 | Ga0395898_0004728 | 3300037466 | Bacteria | 14820 |
| 223 | Ga0395898_0010283 | 3300037466 | Bacteria | 9792 |
| 224 | Ga0395898_0354501 | 3300037466 | Bacteria | 1399 |
| 225 | Ga0395898_1195139 | 3300037466 | Unclassified | 692 |
| 226 | Ga0395898_1502528 | 3300037466 | Bacteria | 599 |
| 227 | Ga0395898_1544755 | 3300037466 | Unclassified | 589 |
| 228 | Ga0395905_0002224 | 3300037471 | Bacteria | 21889 |
| 229 | Ga0395905_0012584 | 3300037471 | Bacteria | 8140 |
| 230 | Ga0395905_0020154 | 3300037471 | Bacteria | 6317 |
| 231 | Ga0395905_0020464 | 3300037471 | Bacteria | 6268 |
| 232 | Ga0395905_0023205 | 3300037471 | Bacteria | 5864 |
| 233 | Ga0395905_0296190 | 3300037471 | Unclassified | 1505 |
| 234 | Ga0395905_0595527 | 3300037471 | Unclassified | 1007 |
| 235 | Ga0395901_0008564 | 3300038443 | Bacteria | 10336 |
| 236 | Ga0395901_0016741 | 3300038443 | Bacteria | 7470 |
| 237 | Ga0395901_0032367 | 3300038443 | Bacteria | 5396 |
| 238 | Ga0395901_0043408 | 3300038443 | Bacteria | 4663 |
| 239 | Ga0395901_0061820 | 3300038443 | Bacteria | 3897 |
| 240 | Ga0395901_0165591 | 3300038443 | Unclassified | 2321 |
| 241 | Ga0395901_0189985 | 3300038443 | Bacteria | 2154 |
| 242 | Ga0395901_0250222 | 3300038443 | Unclassified | 1846 |
| 243 | Ga0395901_0292233 | 3300038443 | Unclassified | 1691 |
| 244 | Ga0395901_0339210 | 3300038443 | Unclassified | 1553 |
| 245 | Ga0439461_0001225 | 3300041410 | Bacteria | 3913 |
| 246 | Ga0439461_0025991 | 3300041410 | Unclassified | 1192 |
| 247 | Ga0439461_0076080 | 3300041410 | Unclassified | 785 |
| 248 | Ga0439466_0029708 | 3300041411 | Unclassified | 1879 |
| 249 | Ga0451853_2640462 | 3300041512 | Bacteria | 1467 |
| 250 | Ga0439431_0053578 | 3300041997 | Unclassified | 1051 |
| 251 | Ga0439445_0005343 | 3300042004 | Bacteria | 2926 |
| 252 | Ga0439446_0006147 | 3300042156 | Bacteria | 3119 |
| 253 | Ga0439434_0004397 | 3300042435 | Bacteria | 4122 |
| 254 | Ga0495603_0014784 | 3300046455 | Bacteria | 4721 |
| 255 | Ga0495641_0007636 | 3300046461 | Bacteria | 6722 |
| 256 | Ga0495651_0094089 | 3300046462 | Bacteria | 2243 |
| 257 | Ga0495582_0006027 | 3300046473 | Bacteria | 6759 |
| 258 | Ga0495605_0055675 | 3300046474 | Unclassified | 1910 |
| 259 | Ga0495605_0182187 | 3300046474 | Unclassified | 923 |
| 260 | Ga0495662_0072609 | 3300046476 | Bacteria | 1669 |
| 261 | Ga0495664_0225539 | 3300046477 | Bacteria | 1134 |
| 262 | Ga0495584_0065705 | 3300046491 | Unclassified | 1825 |
| 263 | Ga0495584_0364690 | 3300046491 | Bacteria | 734 |
| 264 | Ga0495585_0126542 | 3300046492 | Unclassified | 1348 |
| 265 | Ga0495594_0108662 | 3300046499 | Bacteria | 1563 |
| 266 | Ga0495596_0028372 | 3300046500 | Unclassified | 2248 |
| 267 | Ga0495608_0137800 | 3300046511 | Unclassified | 1559 |
| 268 | Ga0495608_0420010 | 3300046511 | Unclassified | 816 |
| 269 | Ga0495616_0217207 | 3300046513 | Bacteria | 834 |
| 270 | Ga0495618_0246035 | 3300046514 | Archaea | 1123 |
| 271 | Ga0495628_0096598 | 3300046516 | Bacteria | 2282 |
| 272 | Ga0495630_0133202 | 3300046517 | Unclassified | 1888 |
| 273 | Ga0495630_0447953 | 3300046517 | Bacteria | 989 |
| 274 | Ga0495631_0133023 | 3300046518 | Unclassified | 1069 |
| 275 | Ga0495663_0016177 | 3300046525 | Bacteria | 2108 |
| 276 | Ga0495663_0019822 | 3300046525 | Unclassified | 1928 |
| 277 | Ga0495609_0034278 | 3300046538 | Unclassified | 2302 |
| 278 | Ga0495645_0449204 | 3300046543 | Unclassified | 813 |
| 279 | Ga0495667_0134965 | 3300046559 | Unclassified | 1591 |
| 280 | Ga0495656_0257582 | 3300046615 | Unclassified | 883 |
| 281 | Ga0495659_0019918 | 3300046664 | Bacteria | 2249 |
| 282 | Ga0495659_0225036 | 3300046664 | Bacteria | 776 |
| 283 | Ga0495588_0048425 | 3300046674 | Bacteria | 2183 |
| 284 | Ga0495646_0098120 | 3300046680 | Unclassified | 1683 |
| 285 | Ga0495647_0434795 | 3300046681 | Bacteria | 606 |
| 286 | Ga0495658_0036580 | 3300046683 | Bacteria | 2710 |
| 287 | Ga0495658_0059273 | 3300046683 | Bacteria | 2192 |
| 288 | Ga0495613_0035137 | 3300046689 | Bacteria | 3721 |
| 289 | Ga0495624_0348473 | 3300046690 | Bacteria | 891 |
| 290 | Ga0495671_0083268 | 3300046692 | Unclassified | 1568 |
| 291 | Ga0495581_0000094 | 3300047315 | Bacteria | 36744 |
| 292 | Ga0495581_0015923 | 3300047315 | Bacteria | 4369 |
| 293 | Ga0495674_0217041 | 3300047319 | Unclassified | 1582 |
| 294 | Ga0495676_0002561 | 3300047321 | Bacteria | 16185 |
| 295 | Ga0495684_0094377 | 3300047471 | Bacteria | 2265 |
| 296 | Ga0495602_0532108 | 3300048088 | Unclassified | 817 |
| 297 | Ga0496100_0032253 | 3300048903 | Bacteria | 3264 |
| 298 | Ga0496102_0042354 | 3300048905 | Bacteria | 4125 |
| 299 | Ga0496102_0631429 | 3300048905 | Bacteria | 994 |
| 300 | Ga0496104_0130032 | 3300048907 | Bacteria | 2419 |
| 301 | Ga0496104_0188746 | 3300048907 | Bacteria | 1972 |
| 302 | Ga0496105_0438374 | 3300048908 | Bacteria | 1032 |
| 303 | Ga0496106_0341443 | 3300048909 | Bacteria | 1203 |
| 304 | Ga0496106_1169520 | 3300048909 | Bacteria | 601 |
| 305 | Ga0496107_0415497 | 3300048910 | Bacteria | 1000 |
| 306 | Ga0496108_0035459 | 3300048911 | Bacteria | 4147 |
| 307 | Ga0496108_0158403 | 3300048911 | Bacteria | 1956 |
| 308 | Ga0496108_0189835 | 3300048911 | Unclassified | 1781 |
| 309 | Ga0496108_0368482 | 3300048911 | Bacteria | 1254 |
| 310 | Ga0496109_0011202 | 3300048912 | Bacteria | 7696 |
| 311 | Ga0496109_0020700 | 3300048912 | Bacteria | 5810 |
| 312 | Ga0496109_0169271 | 3300048912 | Unclassified | 2049 |
| 313 | Ga0496109_0227001 | 3300048912 | Bacteria | 1756 |
| 314 | Ga0496110_0052334 | 3300048913 | Bacteria | 3588 |
| 315 | Ga0496110_0145308 | 3300048913 | Bacteria | 2145 |
| 316 | Ga0496110_0253964 | 3300048913 | Bacteria | 1600 |
| 317 | Ga0496110_0998362 | 3300048913 | Bacteria | 744 |
| 318 | Ga0496110_1043922 | 3300048913 | Unclassified | 725 |
| 319 | Ga0496111_0037524 | 3300048914 | Bacteria | 3467 |
| 320 | Ga0496111_0259350 | 3300048914 | Bacteria | 1290 |
| 321 | Ga0496112_0213064 | 3300048915 | Bacteria | 1889 |
| 322 | Ga0496112_0531457 | 3300048915 | Bacteria | 1110 |
| 323 | Ga0496113_0075814 | 3300048916 | Bacteria | 2568 |
| 324 | Ga0496113_0188615 | 3300048916 | Bacteria | 1636 |
| 325 | Ga0496113_0191412 | 3300048916 | Unclassified | 1624 |
| 326 | Ga0496115_0085981 | 3300048918 | Bacteria | 2565 |
| 327 | Ga0501038_0307833 | 3300049574 | Bacteria | 1242 |
| 328 | Ga0501042_0343692 | 3300049578 | Bacteria | 1079 |
| 329 | Ga0501048_0362021 | 3300049582 | Viruses | 1035 |
| 330 | Ga0501067_0005710 | 3300049583 | Bacteria | 6906 |
| 331 | Ga0501069_0000573 | 3300049585 | Bacteria | 17009 |
| 332 | Ga0501072_0312410 | 3300049588 | Viruses | 1249 |
| 333 | Ga0501077_0672988 | 3300049593 | Bacteria | 665 |
| 334 | nmdc:mga05p37_1792351_c1 | 3300050507 | Unclassified | 593 |
| 335 | nmdc:mga08y16_1061935_c1 | 3300050511 | Bacteria | 787 |
| 336 | nmdc:mga08y16_170311_c1 | 3300050511 | Bacteria | 2262 |
| 337 | nmdc:mga0n895_675832_c1 | 3300050512 | Bacteria | 1030 |
| 338 | nmdc:mga0rr50_708848_c1 | 3300050513 | Unclassified | 859 |
| 339 | Ga0495601_0107062 | 3300053077 | Unclassified | 1808 |
| 340 | Ga0495601_0147513 | 3300053077 | Unclassified | 1535 |
| 341 | Ga0495595_0103221 | 3300053084 | Unclassified | 1377 |
| 342 | Ga0501084_0671726 | 3300054114 | Unclassified | 874 |
| 343 | Ga0530510_0031839 | 3300061734 | Bacteria | 3792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014497 | Ga0182008_10577195 | Ga0182008_105771951 | 143 |
| 2 | 3300005983 | Ga0081540_1001335 | Ga0081540_100133521 | 161 |
| 3 | 3300005338 | Ga0068868_100213442 | Ga0068868_1002134422 | 163 |
| 4 | 3300005457 | Ga0070662_100065973 | Ga0070662_1000659733 | 163 |
| 5 | 3300005530 | Ga0070679_100688262 | Ga0070679_1006882622 | 163 |
| 6 | 3300005545 | Ga0070695_101216808 | Ga0070695_1012168081 | 163 |
| 7 | 3300005563 | Ga0068855_100089423 | Ga0068855_1000894233 | 163 |
| 8 | 3300009098 | Ga0105245_10006942 | Ga0105245_1000694211 | 163 |
| 9 | 3300010375 | Ga0105239_10126649 | Ga0105239_101266493 | 163 |
| 10 | 3300013307 | Ga0157372_10056077 | Ga0157372_100560775 | 163 |
| 11 | 3300014745 | Ga0157377_10249765 | Ga0157377_102497652 | 163 |
| 12 | 3300025912 | Ga0207707_11270069 | Ga0207707_112700691 | 163 |
| 13 | 3300025933 | Ga0207706_10010931 | Ga0207706_100109313 | 163 |
| 14 | 3300025949 | Ga0207667_10074302 | Ga0207667_100743023 | 163 |
| 15 | 3300046461 | Ga0495641_0007636 | Ga0495641_0007636_5694_6185 | 163 |
| 16 | 3300046473 | Ga0495582_0006027 | Ga0495582_0006027_4067_4558 | 163 |
| 17 | 3300046517 | Ga0495630_0447953 | Ga0495630_0447953_294_785 | 163 |
| 18 | 3300046683 | Ga0495658_0036580 | Ga0495658_0036580_523_1014 | 163 |
| 19 | 3300046689 | Ga0495613_0035137 | Ga0495613_0035137_332_823 | 163 |
| 20 | 3300047315 | Ga0495581_0000094 | Ga0495581_0000094_22589_23080 | 163 |
| 21 | 3300047321 | Ga0495676_0002561 | Ga0495676_0002561_10256_10747 | 163 |
| 22 | 3300006871 | Ga0075434_100581888 | Ga0075434_1005818882 | 164 |
| 23 | 3300007076 | Ga0075435_100185425 | Ga0075435_1001854252 | 164 |
| 24 | 3300009147 | Ga0114129_12099872 | Ga0114129_120998721 | 164 |
| 25 | 3300035170 | Ga0373943_0355058 | Ga0373943_0355058_56_550 | 164 |
| 26 | 3300035692 | Ga0373935_0123103 | Ga0373935_0123103_204_698 | 164 |
| 27 | 3300037312 | Ga0395899_0481253 | Ga0395899_0481253_148_642 | 164 |
| 28 | 3300037418 | Ga0395900_0007148 | Ga0395900_0007148_431_925 | 164 |
| 29 | 3300037466 | Ga0395898_0354501 | Ga0395898_0354501_753_1247 | 164 |
| 30 | 3300037471 | Ga0395905_0020154 | Ga0395905_0020154_5092_5586 | 164 |
| 31 | 3300038443 | Ga0395901_0016741 | Ga0395901_0016741_6503_6997 | 164 |
| 32 | 3300038443 | Ga0395901_0061820 | Ga0395901_0061820_2569_3063 | 164 |
| 33 | 3300038443 | Ga0395901_0189985 | Ga0395901_0189985_480_977 | 164 |
| 34 | 3300049593 | Ga0501077_0672988 | Ga0501077_0672988_98_595 | 164 |
| 35 | 3300050507 | nmdc:mga05p37_1792351_c1 | nmdc:mga05p37_1792351_c1_48_542 | 164 |
| 36 | 3300050512 | nmdc:mga0n895_675832_c1 | nmdc:mga0n895_675832_c1_192_686 | 164 |
| 37 | 3300050513 | nmdc:mga0rr50_708848_c1 | nmdc:mga0rr50_708848_c1_292_786 | 164 |
| 38 | 3300005364 | Ga0070673_100112702 | Ga0070673_1001127024 | 165 |
| 39 | 3300005444 | Ga0070694_100339337 | Ga0070694_1003393372 | 165 |
| 40 | 3300005468 | Ga0070707_100014133 | Ga0070707_10001413312 | 165 |
| 41 | 3300005577 | Ga0068857_100044120 | Ga0068857_1000441203 | 165 |
| 42 | 3300005615 | Ga0070702_100038105 | Ga0070702_1000381054 | 165 |
| 43 | 3300006175 | Ga0070712_100938831 | Ga0070712_1009388312 | 165 |
| 44 | 3300009094 | Ga0111539_10012751 | Ga0111539_100127511 | 165 |
| 45 | 3300009098 | Ga0105245_10079199 | Ga0105245_100791996 | 165 |
| 46 | 3300009098 | Ga0105245_10297756 | Ga0105245_102977562 | 165 |
| 47 | 3300011119 | Ga0105246_11053723 | Ga0105246_110537232 | 165 |
| 48 | 3300013296 | Ga0157374_10082266 | Ga0157374_100822666 | 165 |
| 49 | 3300013308 | Ga0157375_10007650 | Ga0157375_100076508 | 165 |
| 50 | 3300014497 | Ga0182008_10250383 | Ga0182008_102503832 | 165 |
| 51 | 3300014969 | Ga0157376_12499917 | Ga0157376_124999171 | 165 |
| 52 | 3300025915 | Ga0207693_10533017 | Ga0207693_105330172 | 165 |
| 53 | 3300025922 | Ga0207646_10025119 | Ga0207646_100251192 | 165 |
| 54 | 3300025927 | Ga0207687_10448661 | Ga0207687_104486612 | 165 |
| 55 | 3300025927 | Ga0207687_10625666 | Ga0207687_106256662 | 165 |
| 56 | 3300025932 | Ga0207690_11230726 | Ga0207690_112307261 | 165 |
| 57 | 3300025960 | Ga0207651_10400807 | Ga0207651_104008072 | 165 |
| 58 | 3300026116 | Ga0207674_10000923 | Ga0207674_1000092328 | 165 |
| 59 | 3300027907 | Ga0207428_10601617 | Ga0207428_106016172 | 165 |
| 60 | 3300028380 | Ga0268265_10504374 | Ga0268265_105043742 | 165 |
| 61 | 3300041512 | Ga0451853_2640462 | Ga0451853_2640462_729_1232 | 165 |
| 62 | 3300046474 | Ga0495605_0055675 | Ga0495605_0055675_901_1404 | 165 |
| 63 | 3300046491 | Ga0495584_0065705 | Ga0495584_0065705_742_1245 | 165 |
| 64 | 3300046492 | Ga0495585_0126542 | Ga0495585_0126542_579_1082 | 165 |
| 65 | 3300046500 | Ga0495596_0028372 | Ga0495596_0028372_365_868 | 165 |
| 66 | 3300046518 | Ga0495631_0133023 | Ga0495631_0133023_332_835 | 165 |
| 67 | 3300046525 | Ga0495663_0019822 | Ga0495663_0019822_868_1371 | 165 |
| 68 | 3300046538 | Ga0495609_0034278 | Ga0495609_0034278_1095_1598 | 165 |
| 69 | 3300046615 | Ga0495656_0257582 | Ga0495656_0257582_49_552 | 165 |
| 70 | 3300046692 | Ga0495671_0083268 | Ga0495671_0083268_828_1331 | 165 |
| 71 | 3300048907 | Ga0496104_0130032 | Ga0496104_0130032_815_1318 | 165 |
| 72 | 3300048911 | Ga0496108_0035459 | Ga0496108_0035459_1968_2471 | 165 |
| 73 | 3300048912 | Ga0496109_0227001 | Ga0496109_0227001_224_727 | 165 |
| 74 | 3300048913 | Ga0496110_0052334 | Ga0496110_0052334_1478_1981 | 165 |
| 75 | 3300048913 | Ga0496110_1043922 | Ga0496110_1043922_34_534 | 165 |
| 76 | 3300048914 | Ga0496111_0037524 | Ga0496111_0037524_1548_2051 | 165 |
| 77 | 3300048916 | Ga0496113_0075814 | Ga0496113_0075814_771_1274 | 165 |
| 78 | 3300050511 | nmdc:mga08y16_1061935_c1 | nmdc:mga08y16_1061935_c1_210_710 | 165 |
| 79 | 3300005981 | Ga0081538_10001503 | Ga0081538_1000150310 | 166 |
| 80 | 3300037466 | Ga0395898_1195139 | Ga0395898_1195139_130_633 | 166 |
| 81 | 3300005614 | Ga0068856_100099403 | Ga0068856_1000994033 | 167 |
| 82 | 3300009094 | Ga0111539_10367971 | Ga0111539_103679713 | 167 |
| 83 | 3300026078 | Ga0207702_10028695 | Ga0207702_100286953 | 167 |
| 84 | 3300037312 | Ga0395899_0041718 | Ga0395899_0041718_1549_2064 | 167 |
| 85 | 3300037418 | Ga0395900_0024887 | Ga0395900_0024887_5009_5524 | 167 |
| 86 | 3300037466 | Ga0395898_0010283 | Ga0395898_0010283_334_849 | 167 |
| 87 | 3300037471 | Ga0395905_0002224 | Ga0395905_0002224_9761_10276 | 167 |
| 88 | 3300038443 | Ga0395901_0008564 | Ga0395901_0008564_3903_4418 | 167 |
| 89 | 3300038443 | Ga0395901_0292233 | Ga0395901_0292233_210_725 | 167 |
| 90 | 3300046664 | Ga0495659_0225036 | Ga0495659_0225036_16_519 | 167 |
| 91 | 3300050511 | nmdc:mga08y16_170311_c1 | nmdc:mga08y16_170311_c1_20_529 | 167 |
| 92 | 3300005329 | Ga0070683_100009377 | Ga0070683_10000937710 | 168 |
| 93 | 3300005546 | Ga0070696_100208602 | Ga0070696_1002086021 | 168 |
| 94 | 3300005564 | Ga0070664_100141132 | Ga0070664_1001411323 | 168 |
| 95 | 3300005577 | Ga0068857_100005679 | Ga0068857_1000056793 | 168 |
| 96 | 3300025910 | Ga0207684_10058034 | Ga0207684_100580342 | 168 |
| 97 | 3300025922 | Ga0207646_10871526 | Ga0207646_108715261 | 168 |
| 98 | 3300025945 | Ga0207679_10307000 | Ga0207679_103070003 | 168 |
| 99 | 3300026116 | Ga0207674_10002109 | Ga0207674_1000210921 | 168 |
| 100 | 3300049583 | Ga0501067_0005710 | Ga0501067_0005710_654_1160 | 168 |
| 101 | 3300049585 | Ga0501069_0000573 | Ga0501069_0000573_1688_2194 | 168 |
| 102 | 3300061734 | Ga0530510_0031839 | Ga0530510_0031839_179_685 | 168 |
| 103 | 3300006852 | Ga0075433_11042768 | Ga0075433_110427682 | 169 |
| 104 | 3300005338 | Ga0068868_100497545 | Ga0068868_1004975452 | 170 |
| 105 | 3300005445 | Ga0070708_100170565 | Ga0070708_1001705651 | 170 |
| 106 | 3300005467 | Ga0070706_100248540 | Ga0070706_1002485402 | 170 |
| 107 | 3300005471 | Ga0070698_100006283 | Ga0070698_1000062836 | 170 |
| 108 | 3300025910 | Ga0207684_10543239 | Ga0207684_105432392 | 170 |
| 109 | 3300026023 | Ga0207677_10421308 | Ga0207677_104213082 | 170 |
| 110 | 3300041410 | Ga0439461_0025991 | Ga0439461_0025991_609_1124 | 170 |
| 111 | 3300041411 | Ga0439466_0029708 | Ga0439466_0029708_36_551 | 170 |
| 112 | 3300048909 | Ga0496106_0341443 | Ga0496106_0341443_184_696 | 170 |
| 113 | 3300048910 | Ga0496107_0415497 | Ga0496107_0415497_75_587 | 170 |
| 114 | 3300048911 | Ga0496108_0368482 | Ga0496108_0368482_508_1020 | 170 |
| 115 | 3300048912 | Ga0496109_0011202 | Ga0496109_0011202_1651_2163 | 170 |
| 116 | 3300048913 | Ga0496110_0145308 | Ga0496110_0145308_1026_1538 | 170 |
| 117 | 3300048914 | Ga0496111_0259350 | Ga0496111_0259350_298_810 | 170 |
| 118 | 3300048915 | Ga0496112_0531457 | Ga0496112_0531457_519_1034 | 170 |
| 119 | 3300048916 | Ga0496113_0191412 | Ga0496113_0191412_532_1044 | 170 |
| 120 | 3300049574 | Ga0501038_0307833 | Ga0501038_0307833_612_1127 | 170 |
| 121 | 3300049578 | Ga0501042_0343692 | Ga0501042_0343692_549_1064 | 170 |
| 122 | 3300049582 | Ga0501048_0362021 | Ga0501048_0362021_338_853 | 170 |
| 123 | 3300049588 | Ga0501072_0312410 | Ga0501072_0312410_234_749 | 170 |
| 124 | 3300054114 | Ga0501084_0671726 | Ga0501084_0671726_285_800 | 170 |
| 125 | 3300005341 | Ga0070691_10124062 | Ga0070691_101240622 | 171 |
| 126 | 3300005347 | Ga0070668_100021194 | Ga0070668_1000211942 | 171 |
| 127 | 3300005435 | Ga0070714_100038155 | Ga0070714_1000381555 | 171 |
| 128 | 3300005436 | Ga0070713_100114582 | Ga0070713_1001145825 | 171 |
| 129 | 3300005438 | Ga0070701_10384518 | Ga0070701_103845182 | 171 |
| 130 | 3300005444 | Ga0070694_100323070 | Ga0070694_1003230701 | 171 |
| 131 | 3300005457 | Ga0070662_100041395 | Ga0070662_1000413955 | 171 |
| 132 | 3300005459 | Ga0068867_100054578 | Ga0068867_1000545782 | 171 |
| 133 | 3300005546 | Ga0070696_100492003 | Ga0070696_1004920032 | 171 |
| 134 | 3300005549 | Ga0070704_100089418 | Ga0070704_1000894182 | 171 |
| 135 | 3300005563 | Ga0068855_100028306 | Ga0068855_1000283065 | 171 |
| 136 | 3300005578 | Ga0068854_100338803 | Ga0068854_1003388032 | 171 |
| 137 | 3300005719 | Ga0068861_100037148 | Ga0068861_1000371482 | 171 |
| 138 | 3300005844 | Ga0068862_100548166 | Ga0068862_1005481662 | 171 |
| 139 | 3300005937 | Ga0081455_10088175 | Ga0081455_100881752 | 171 |
| 140 | 3300006028 | Ga0070717_10014733 | Ga0070717_100147338 | 171 |
| 141 | 3300006175 | Ga0070712_100228327 | Ga0070712_1002283272 | 171 |
| 142 | 3300006881 | Ga0068865_100138231 | Ga0068865_1001382312 | 171 |
| 143 | 3300009098 | Ga0105245_10116464 | Ga0105245_101164642 | 171 |
| 144 | 3300009148 | Ga0105243_10223161 | Ga0105243_102231613 | 171 |
| 145 | 3300009176 | Ga0105242_10596934 | Ga0105242_105969342 | 171 |
| 146 | 3300009553 | Ga0105249_10134928 | Ga0105249_101349282 | 171 |
| 147 | 3300010375 | Ga0105239_10075392 | Ga0105239_100753926 | 171 |
| 148 | 3300013306 | Ga0163162_10106270 | Ga0163162_101062703 | 171 |
| 149 | 3300025923 | Ga0207681_10469746 | Ga0207681_104697462 | 171 |
| 150 | 3300025927 | Ga0207687_10031647 | Ga0207687_100316473 | 171 |
| 151 | 3300025929 | Ga0207664_10012259 | Ga0207664_100122595 | 171 |
| 152 | 3300025933 | Ga0207706_10034995 | Ga0207706_100349953 | 171 |
| 153 | 3300025934 | Ga0207686_10260966 | Ga0207686_102609661 | 171 |
| 154 | 3300025938 | Ga0207704_10125391 | Ga0207704_101253912 | 171 |
| 155 | 3300025949 | Ga0207667_10072793 | Ga0207667_100727933 | 171 |
| 156 | 3300025961 | Ga0207712_10096753 | Ga0207712_100967532 | 171 |
| 157 | 3300025972 | Ga0207668_10011321 | Ga0207668_100113213 | 171 |
| 158 | 3300025981 | Ga0207640_10155555 | Ga0207640_101555552 | 171 |
| 159 | 3300026089 | Ga0207648_10092258 | Ga0207648_100922583 | 171 |
| 160 | 3300026118 | Ga0207675_100002893 | Ga0207675_10000289314 | 171 |
| 161 | 3300028380 | Ga0268265_10280354 | Ga0268265_102803542 | 171 |
| 162 | 3300046462 | Ga0495651_0094089 | Ga0495651_0094089_448_966 | 171 |
| 163 | 3300046477 | Ga0495664_0225539 | Ga0495664_0225539_527_1045 | 171 |
| 164 | 3300046511 | Ga0495608_0137800 | Ga0495608_0137800_629_1147 | 171 |
| 165 | 3300046511 | Ga0495608_0420010 | Ga0495608_0420010_256_774 | 171 |
| 166 | 3300046514 | Ga0495618_0246035 | Ga0495618_0246035_405_923 | 171 |
| 167 | 3300046516 | Ga0495628_0096598 | Ga0495628_0096598_241_759 | 171 |
| 168 | 3300046517 | Ga0495630_0133202 | Ga0495630_0133202_133_651 | 171 |
| 169 | 3300046543 | Ga0495645_0449204 | Ga0495645_0449204_55_573 | 171 |
| 170 | 3300046559 | Ga0495667_0134965 | Ga0495667_0134965_49_567 | 171 |
| 171 | 3300046680 | Ga0495646_0098120 | Ga0495646_0098120_833_1351 | 171 |
| 172 | 3300047319 | Ga0495674_0217041 | Ga0495674_0217041_220_738 | 171 |
| 173 | 3300047471 | Ga0495684_0094377 | Ga0495684_0094377_719_1237 | 171 |
| 174 | 3300048088 | Ga0495602_0532108 | Ga0495602_0532108_49_567 | 171 |
| 175 | 3300048909 | Ga0496106_1169520 | Ga0496106_1169520_44_562 | 171 |
| 176 | 3300053077 | Ga0495601_0107062 | Ga0495601_0107062_996_1514 | 171 |
| 177 | 3300053077 | Ga0495601_0147513 | Ga0495601_0147513_22_540 | 171 |
| 178 | 3300053084 | Ga0495595_0103221 | Ga0495595_0103221_609_1127 | 171 |
| 179 | 3300005335 | Ga0070666_10074623 | Ga0070666_100746231 | 172 |
| 180 | 3300005336 | Ga0070680_100201981 | Ga0070680_1002019812 | 172 |
| 181 | 3300005337 | Ga0070682_100032133 | Ga0070682_1000321332 | 172 |
| 182 | 3300005343 | Ga0070687_100234275 | Ga0070687_1002342752 | 172 |
| 183 | 3300005345 | Ga0070692_10209349 | Ga0070692_102093492 | 172 |
| 184 | 3300005347 | Ga0070668_100219745 | Ga0070668_1002197452 | 172 |
| 185 | 3300005353 | Ga0070669_100422661 | Ga0070669_1004226612 | 172 |
| 186 | 3300005364 | Ga0070673_100201850 | Ga0070673_1002018503 | 172 |
| 187 | 3300005365 | Ga0070688_100007444 | Ga0070688_1000074447 | 172 |
| 188 | 3300005366 | Ga0070659_100365789 | Ga0070659_1003657892 | 172 |
| 189 | 3300005367 | Ga0070667_100342136 | Ga0070667_1003421362 | 172 |
| 190 | 3300005406 | Ga0070703_10090500 | Ga0070703_100905002 | 172 |
| 191 | 3300005434 | Ga0070709_10067463 | Ga0070709_100674632 | 172 |
| 192 | 3300005435 | Ga0070714_100215918 | Ga0070714_1002159182 | 172 |
| 193 | 3300005437 | Ga0070710_10093085 | Ga0070710_100930852 | 172 |
| 194 | 3300005438 | Ga0070701_10003678 | Ga0070701_100036784 | 172 |
| 195 | 3300005439 | Ga0070711_100006925 | Ga0070711_1000069254 | 172 |
| 196 | 3300005440 | Ga0070705_100126949 | Ga0070705_1001269493 | 172 |
| 197 | 3300005441 | Ga0070700_100113057 | Ga0070700_1001130572 | 172 |
| 198 | 3300005444 | Ga0070694_100262901 | Ga0070694_1002629012 | 172 |
| 199 | 3300005455 | Ga0070663_100107337 | Ga0070663_1001073374 | 172 |
| 200 | 3300005456 | Ga0070678_100018547 | Ga0070678_1000185474 | 172 |
| 201 | 3300005466 | Ga0070685_10048261 | Ga0070685_100482614 | 172 |
| 202 | 3300005468 | Ga0070707_100545171 | Ga0070707_1005451712 | 172 |
| 203 | 3300005539 | Ga0068853_100075864 | Ga0068853_1000758644 | 172 |
| 204 | 3300005543 | Ga0070672_100159215 | Ga0070672_1001592152 | 172 |
| 205 | 3300005546 | Ga0070696_100026320 | Ga0070696_1000263202 | 172 |
| 206 | 3300005547 | Ga0070693_100250999 | Ga0070693_1002509992 | 172 |
| 207 | 3300005548 | Ga0070665_100033262 | Ga0070665_1000332627 | 172 |
| 208 | 3300005549 | Ga0070704_100039962 | Ga0070704_1000399622 | 172 |
| 209 | 3300005563 | Ga0068855_100650758 | Ga0068855_1006507582 | 172 |
| 210 | 3300005614 | Ga0068856_100008762 | Ga0068856_10000876211 | 172 |
| 211 | 3300005615 | Ga0070702_100015066 | Ga0070702_1000150666 | 172 |
| 212 | 3300005617 | Ga0068859_100682419 | Ga0068859_1006824192 | 172 |
| 213 | 3300005618 | Ga0068864_101586657 | Ga0068864_1015866571 | 172 |
| 214 | 3300005841 | Ga0068863_100627529 | Ga0068863_1006275292 | 172 |
| 215 | 3300005843 | Ga0068860_101097984 | Ga0068860_1010979842 | 172 |
| 216 | 3300006175 | Ga0070712_100151956 | Ga0070712_1001519563 | 172 |
| 217 | 3300006237 | Ga0097621_100333044 | Ga0097621_1003330442 | 172 |
| 218 | 3300006881 | Ga0068865_100006636 | Ga0068865_1000066367 | 172 |
| 219 | 3300006931 | Ga0097620_100682435 | Ga0097620_1006824352 | 172 |
| 220 | 3300009098 | Ga0105245_10532872 | Ga0105245_105328722 | 172 |
| 221 | 3300009101 | Ga0105247_10148265 | Ga0105247_101482652 | 172 |
| 222 | 3300009147 | Ga0114129_10877861 | Ga0114129_108778611 | 172 |
| 223 | 3300009148 | Ga0105243_10312219 | Ga0105243_103122192 | 172 |
| 224 | 3300009174 | Ga0105241_10323876 | Ga0105241_103238762 | 172 |
| 225 | 3300009176 | Ga0105242_10005237 | Ga0105242_100052372 | 172 |
| 226 | 3300009177 | Ga0105248_10021199 | Ga0105248_100211993 | 172 |
| 227 | 3300009545 | Ga0105237_10050681 | Ga0105237_100506817 | 172 |
| 228 | 3300009551 | Ga0105238_10093471 | Ga0105238_100934711 | 172 |
| 229 | 3300010375 | Ga0105239_10027132 | Ga0105239_100271322 | 172 |
| 230 | 3300011119 | Ga0105246_10023947 | Ga0105246_100239476 | 172 |
| 231 | 3300013296 | Ga0157374_10028620 | Ga0157374_100286202 | 172 |
| 232 | 3300013297 | Ga0157378_10009952 | Ga0157378_100099524 | 172 |
| 233 | 3300013306 | Ga0163162_10007734 | Ga0163162_100077344 | 172 |
| 234 | 3300013307 | Ga0157372_10721275 | Ga0157372_107212752 | 172 |
| 235 | 3300013308 | Ga0157375_10231604 | Ga0157375_102316042 | 172 |
| 236 | 3300014326 | Ga0157380_10217584 | Ga0157380_102175842 | 172 |
| 237 | 3300014745 | Ga0157377_10002322 | Ga0157377_100023223 | 172 |
| 238 | 3300014968 | Ga0157379_10636476 | Ga0157379_106364762 | 172 |
| 239 | 3300014969 | Ga0157376_10077906 | Ga0157376_100779065 | 172 |
| 240 | 3300025885 | Ga0207653_10038906 | Ga0207653_100389062 | 172 |
| 241 | 3300025893 | Ga0207682_10072077 | Ga0207682_100720772 | 172 |
| 242 | 3300025900 | Ga0207710_10074368 | Ga0207710_100743682 | 172 |
| 243 | 3300025903 | Ga0207680_10162961 | Ga0207680_101629613 | 172 |
| 244 | 3300025906 | Ga0207699_10275150 | Ga0207699_102751502 | 172 |
| 245 | 3300025911 | Ga0207654_10088670 | Ga0207654_100886703 | 172 |
| 246 | 3300025914 | Ga0207671_10261993 | Ga0207671_102619932 | 172 |
| 247 | 3300025915 | Ga0207693_10001256 | Ga0207693_100012562 | 172 |
| 248 | 3300025916 | Ga0207663_10143550 | Ga0207663_101435502 | 172 |
| 249 | 3300025917 | Ga0207660_10003185 | Ga0207660_100031859 | 172 |
| 250 | 3300025918 | Ga0207662_10022505 | Ga0207662_100225055 | 172 |
| 251 | 3300025919 | Ga0207657_10002716 | Ga0207657_100027166 | 172 |
| 252 | 3300025921 | Ga0207652_11245557 | Ga0207652_112455572 | 172 |
| 253 | 3300025932 | Ga0207690_10504957 | Ga0207690_105049572 | 172 |
| 254 | 3300025933 | Ga0207706_10342966 | Ga0207706_103429661 | 172 |
| 255 | 3300025934 | Ga0207686_10085588 | Ga0207686_100855883 | 172 |
| 256 | 3300025935 | Ga0207709_10117008 | Ga0207709_101170083 | 172 |
| 257 | 3300025936 | Ga0207670_10212675 | Ga0207670_102126752 | 172 |
| 258 | 3300025937 | Ga0207669_10111041 | Ga0207669_101110411 | 172 |
| 259 | 3300025949 | Ga0207667_10126994 | Ga0207667_101269944 | 172 |
| 260 | 3300025961 | Ga0207712_10036052 | Ga0207712_100360526 | 172 |
| 261 | 3300026041 | Ga0207639_10298751 | Ga0207639_102987512 | 172 |
| 262 | 3300026067 | Ga0207678_10006146 | Ga0207678_1000614612 | 172 |
| 263 | 3300026075 | Ga0207708_10000515 | Ga0207708_100005158 | 172 |
| 264 | 3300026078 | Ga0207702_10038598 | Ga0207702_100385984 | 172 |
| 265 | 3300026089 | Ga0207648_10000705 | Ga0207648_100007058 | 172 |
| 266 | 3300026121 | Ga0207683_10023530 | Ga0207683_100235303 | 172 |
| 267 | 3300028379 | Ga0268266_10129141 | Ga0268266_101291413 | 172 |
| 268 | 3300032005 | Ga0307411_11266505 | Ga0307411_112665051 | 172 |
| 269 | 3300046455 | Ga0495603_0014784 | Ga0495603_0014784_182_706 | 172 |
| 270 | 3300046474 | Ga0495605_0182187 | Ga0495605_0182187_309_833 | 172 |
| 271 | 3300046476 | Ga0495662_0072609 | Ga0495662_0072609_448_972 | 172 |
| 272 | 3300046491 | Ga0495584_0364690 | Ga0495584_0364690_135_659 | 172 |
| 273 | 3300046499 | Ga0495594_0108662 | Ga0495594_0108662_842_1366 | 172 |
| 274 | 3300046513 | Ga0495616_0217207 | Ga0495616_0217207_162_686 | 172 |
| 275 | 3300046525 | Ga0495663_0016177 | Ga0495663_0016177_902_1426 | 172 |
| 276 | 3300046664 | Ga0495659_0019918 | Ga0495659_0019918_1709_2233 | 172 |
| 277 | 3300046674 | Ga0495588_0048425 | Ga0495588_0048425_1521_2045 | 172 |
| 278 | 3300046681 | Ga0495647_0434795 | Ga0495647_0434795_71_595 | 172 |
| 279 | 3300046683 | Ga0495658_0059273 | Ga0495658_0059273_1137_1661 | 172 |
| 280 | 3300046690 | Ga0495624_0348473 | Ga0495624_0348473_234_758 | 172 |
| 281 | 3300047315 | Ga0495581_0015923 | Ga0495581_0015923_2873_3397 | 172 |
| 282 | 3300048903 | Ga0496100_0032253 | Ga0496100_0032253_629_1153 | 172 |
| 283 | 3300048905 | Ga0496102_0042354 | Ga0496102_0042354_1273_1797 | 172 |
| 284 | 3300048907 | Ga0496104_0188746 | Ga0496104_0188746_486_1010 | 172 |
| 285 | 3300048908 | Ga0496105_0438374 | Ga0496105_0438374_392_916 | 172 |
| 286 | 3300048911 | Ga0496108_0158403 | Ga0496108_0158403_400_924 | 172 |
| 287 | 3300048912 | Ga0496109_0020700 | Ga0496109_0020700_766_1290 | 172 |
| 288 | 3300048913 | Ga0496110_0998362 | Ga0496110_0998362_124_648 | 172 |
| 289 | 3300048916 | Ga0496113_0188615 | Ga0496113_0188615_344_868 | 172 |
| 290 | 3300048918 | Ga0496115_0085981 | Ga0496115_0085981_1791_2315 | 172 |
| 291 | 3300006847 | Ga0075431_100493052 | Ga0075431_1004930522 | 173 |
| 292 | 3300031995 | Ga0307409_100206850 | Ga0307409_1002068502 | 173 |
| 293 | 3300032002 | Ga0307416_100119096 | Ga0307416_1001190963 | 173 |
| 294 | 3300032004 | Ga0307414_10414655 | Ga0307414_104146552 | 173 |
| 295 | 3300037466 | Ga0395898_1544755 | Ga0395898_1544755_30_557 | 173 |
| 296 | 3300041410 | Ga0439461_0076080 | Ga0439461_0076080_14_541 | 173 |
| 297 | 3300005458 | Ga0070681_11030713 | Ga0070681_110307132 | 174 |
| 298 | 3300009094 | Ga0111539_10431753 | Ga0111539_104317531 | 174 |
| 299 | 3300012507 | Ga0157342_1047241 | Ga0157342_10472411 | 174 |
| 300 | 3300025912 | Ga0207707_10255417 | Ga0207707_102554172 | 174 |
| 301 | 3300025922 | Ga0207646_10929062 | Ga0207646_109290622 | 174 |
| 302 | 3300037312 | Ga0395899_0010130 | Ga0395899_0010130_3053_3583 | 174 |
| 303 | 3300037418 | Ga0395900_0014100 | Ga0395900_0014100_3038_3568 | 174 |
| 304 | 3300037418 | Ga0395900_0067530 | Ga0395900_0067530_889_1425 | 174 |
| 305 | 3300037418 | Ga0395900_0656132 | Ga0395900_0656132_354_884 | 174 |
| 306 | 3300037466 | Ga0395898_0003692 | Ga0395898_0003692_1539_2069 | 174 |
| 307 | 3300037466 | Ga0395898_0004728 | Ga0395898_0004728_686_1216 | 174 |
| 308 | 3300037466 | Ga0395898_1502528 | Ga0395898_1502528_11_547 | 174 |
| 309 | 3300037471 | Ga0395905_0012584 | Ga0395905_0012584_6921_7451 | 174 |
| 310 | 3300037471 | Ga0395905_0020464 | Ga0395905_0020464_3264_3794 | 174 |
| 311 | 3300037471 | Ga0395905_0023205 | Ga0395905_0023205_3687_4223 | 174 |
| 312 | 3300037471 | Ga0395905_0296190 | Ga0395905_0296190_118_666 | 174 |
| 313 | 3300038443 | Ga0395901_0043408 | Ga0395901_0043408_219_755 | 174 |
| 314 | 3300038443 | Ga0395901_0165591 | Ga0395901_0165591_81_611 | 174 |
| 315 | 3300038443 | Ga0395901_0250222 | Ga0395901_0250222_306_836 | 174 |
| 316 | 3300038443 | Ga0395901_0339210 | Ga0395901_0339210_830_1378 | 174 |
| 317 | 3300041410 | Ga0439461_0001225 | Ga0439461_0001225_3195_3725 | 174 |
| 318 | 3300041997 | Ga0439431_0053578 | Ga0439431_0053578_216_746 | 174 |
| 319 | 3300042004 | Ga0439445_0005343 | Ga0439445_0005343_410_940 | 174 |
| 320 | 3300042156 | Ga0439446_0006147 | Ga0439446_0006147_136_666 | 174 |
| 321 | 3300042435 | Ga0439434_0004397 | Ga0439434_0004397_3501_4031 | 174 |
| 322 | 3300005983 | Ga0081540_1143438 | Ga0081540_11434381 | 176 |
| 323 | 3300025885 | Ga0207653_10071443 | Ga0207653_100714432 | 176 |
| 324 | 3300025922 | Ga0207646_10814143 | Ga0207646_108141431 | 176 |
| 325 | 3300005328 | Ga0070676_10678891 | Ga0070676_106788911 | 182 |
| 326 | 3300005329 | Ga0070683_100145347 | Ga0070683_1001453471 | 182 |
| 327 | 3300005466 | Ga0070685_10027717 | Ga0070685_100277175 | 182 |
| 328 | 3300005549 | Ga0070704_100576370 | Ga0070704_1005763702 | 182 |
| 329 | 3300005834 | Ga0068851_10159755 | Ga0068851_101597552 | 182 |
| 330 | 3300009098 | Ga0105245_10007115 | Ga0105245_100071154 | 182 |
| 331 | 3300014745 | Ga0157377_10186258 | Ga0157377_101862581 | 182 |
| 332 | 3300025901 | Ga0207688_10035921 | Ga0207688_100359212 | 182 |
| 333 | 3300025926 | Ga0207659_10226734 | Ga0207659_102267343 | 182 |
| 334 | 3300025927 | Ga0207687_10594475 | Ga0207687_105944752 | 182 |
| 335 | 3300025944 | Ga0207661_10068472 | Ga0207661_100684723 | 182 |
| 336 | 3300026023 | Ga0207677_10267467 | Ga0207677_102674672 | 182 |
| 337 | 3300037471 | Ga0395905_0595527 | Ga0395905_0595527_181_789 | 182 |
| 338 | 3300038443 | Ga0395901_0032367 | Ga0395901_0032367_2141_2749 | 182 |
| 339 | 3300048905 | Ga0496102_0631429 | Ga0496102_0631429_349_903 | 182 |
| 340 | 3300048911 | Ga0496108_0189835 | Ga0496108_0189835_945_1499 | 182 |
| 341 | 3300048912 | Ga0496109_0169271 | Ga0496109_0169271_873_1421 | 182 |
| 342 | 3300048913 | Ga0496110_0253964 | Ga0496110_0253964_777_1325 | 182 |
| 343 | 3300048915 | Ga0496112_0213064 | Ga0496112_0213064_597_1151 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jtj-assembly1.cif.gz_A-2 | 3-deoxy-manno-octulosonate cytidylyltransferase from yersinia pestis | 0.826 | 10 | 124 |
| 8b31-assembly1.cif.gz_B | crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 | 0.823 | 9 | 142 |
| 1vic-assembly3.cif.gz_B | crystal structure of cmp-kdo synthetase | 0.814 | 10 | 124 |
| 2waw-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis rv0371c homolog from mycobacterium sp. strain jc1 | 0.807 | 8 | 171 |
| 3k8e-assembly2.cif.gz_A | crystal structure of e. coli lipopolysaccharide specific cmp-kdo synthetase | 0.7952 | 10 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0VBA2_1_174_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8366 | 72 | 141 | 3.90.550.10 |
| af_P9WJQ9_9_197_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8313 | 9 | 171 | 3.90.550.10 |
| af_Q61647_178_371_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8027 | 71 | 122 | 3.90.550.10 |
| af_Q2FVY4_1_197_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.7895 | 11 | 171 | 3.90.550.10 |
| 2weeA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.778 | 7 | 171 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538F2W8-F1-model_v4 | Nucleotidyltransferase family protein | 0.98 | 8 | 172 |
GO:0016779
|
| AF-A0A538M2P6-F1-model_v4 | Nucleotidyltransferase family protein | 0.9786 | 8 | 178 |
GO:0016779
|
| AF-A0A7M2Z016-F1-model_v4 | Putative MobA-related protein | 0.978 | 8 | 177 |
GO:0016779
|
| AF-A0A7M2Z016-F1-model_v4 | Putative MobA-related protein | 0.9668 | 8 | 177 |
GO:0016779
|
| AF-A0A538IA21-F1-model_v4 | Nucleotidyltransferase family protein | 0.9643 | 1 | 172 |
GO:0016779
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar