F415879

General Info

Members Datasets Scaffolds Average Seq Length
344 177 344 285

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100188666|Ga0070665_1001886661
Length 308
Sequence MDKRLLDGLKMVGYSQRGNNYMAVKQTGLGRGFGSLIPQNFDAGLLVEENERIQKLAVGLLSPNPEQPRTVFDEGALAELAASIQMHGIIQPLVVTPAGDGYHIIAGERRWRAAKLAGLKTVPAVVRTTRQQEKLELAILENVQRVDLSPLEQAVSIERLHQQFNLTYGEVAKRLGKAETTVHNTVRLLQLPEDARDALAGGVISEGHARQVLALKDSPEKQVELLRLIIENGWSVRQAERYVSSLKAGIKQAKQAQERVSGDTPETERLSKRFGTYVRIHRTAKGGRVEIAFTSDDQLAKLLAELEQ

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
96 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
153 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
159 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
160 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
163 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
164 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
165 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
166 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
167 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
168 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
171 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
172 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
175 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.29
Nodule 0
Rhizoplane 0.87
Rhizosphere 72.09
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000410 3300001915 Bacteria 12960
2 JGI24740J21852_10016619 3300001979 Bacteria 2654
3 JGI24742J22300_10000078 3300002244 Bacteria 14051
4 rootH1_10177805 3300003316 Bacteria 2134
5 rootH2_10000244 3300003320 Bacteria 697651
6 rootH2_10112779 3300003320 Bacteria 3599
7 rootL2_10055423 3300003322 Bacteria 4895
8 rootL2_10164844 3300003322 Plasmid 3570
9 Ga0070658_10000036 3300005327 Bacteria 143743
10 Ga0070658_10000358 3300005327 Bacteria 39704
11 Ga0070658_10000668 3300005327 Bacteria 29714
12 Ga0070658_10000669 3300005327 Bacteria 29694
13 Ga0070658_10001490 3300005327 Bacteria 19873
14 Ga0070658_10043403 3300005327 Bacteria 3632
15 Ga0070658_10065677 3300005327 Bacteria 2962
16 Ga0070658_10074916 3300005327 Bacteria 2776
17 Ga0070658_10202725 3300005327 Unclassified 1674
18 Ga0070683_100000092 3300005329 Bacteria 59204
19 Ga0070683_100000891 3300005329 Bacteria 22174
20 Ga0070683_100064418 3300005329 Bacteria 3412
21 Ga0070690_100000735 3300005330 Bacteria 16744
22 Ga0070680_100009170 3300005336 Bacteria 7587
23 Ga0070680_100009762 3300005336 Bacteria 7388
24 Ga0070660_100000047 3300005339 Bacteria 69868
25 Ga0070660_100000185 3300005339 Bacteria 41480
26 Ga0070660_100213424 3300005339 Bacteria 1567
27 Ga0070671_100059261 3300005355 Bacteria 3186
28 Ga0070674_100008732 3300005356 Bacteria 6043
29 Ga0070673_100039642 3300005364 Bacteria 3607
30 Ga0070659_100001803 3300005366 Bacteria 15403
31 Ga0070659_100140230 3300005366 Bacteria 1968
32 Ga0070667_100004285 3300005367 Bacteria 12051
33 Ga0070663_100022619 3300005455 Bacteria 4206
34 Ga0070678_100003223 3300005456 Bacteria 9060
35 Ga0070678_100073195 3300005456 Bacteria 2571
36 Ga0070681_10069972 3300005458 Bacteria 3475
37 Ga0070685_10002698 3300005466 Bacteria 9088
38 Ga0070685_10014074 3300005466 Unclassified 4231
39 Ga0070685_10202053 3300005466 Bacteria 1292
40 Ga0070679_100002396 3300005530 Bacteria 16994
41 Ga0070679_100100688 3300005530 Bacteria 2875
42 Ga0070679_100144926 3300005530 Bacteria 2353
43 Ga0070679_100146669 3300005530 Bacteria 2337
44 Ga0070684_100006753 3300005535 Bacteria 8895
45 Ga0070684_100264741 3300005535 Bacteria 1573
46 Ga0070684_100381999 3300005535 Bacteria 1297
47 Ga0070686_100004629 3300005544 Bacteria 7588
48 Ga0070665_100095156 3300005548 Bacteria 2983
49 Ga0070665_100188666 3300005548 Unclassified 2062
50 Ga0068855_100000003 3300005563 Bacteria 589862
51 Ga0068855_100002780 3300005563 Bacteria 21542
52 Ga0068855_100040488 3300005563 Bacteria 5531
53 Ga0068855_100044794 3300005563 Bacteria 5235
54 Ga0068855_100354310 3300005563 Unclassified 1616
55 Ga0068857_100000040 3300005577 Bacteria 70513
56 Ga0068857_100075310 3300005577 Bacteria 3009
57 Ga0068857_100095951 3300005577 Bacteria 2657
58 Ga0068857_100260590 3300005577 Bacteria 1591
59 Ga0068856_100000968 3300005614 Bacteria 30626
60 Ga0068856_100001246 3300005614 Bacteria 26727
61 Ga0068856_100006945 3300005614 Bacteria 11072
62 Ga0068863_100036896 3300005841 Bacteria 4654
63 Ga0068863_100043689 3300005841 Bacteria 4253
64 Ga0068858_100005127 3300005842 Bacteria 12837
65 Ga0068862_100107661 3300005844 Bacteria 2444
66 Ga0081455_10000003 3300005937 Bacteria 367763
67 Ga0075365_10000021 3300006038 Bacteria 64483
68 Ga0075365_10178018 3300006038 Bacteria 1486
69 Ga0075365_10189503 3300006038 Unclassified 1439
70 Ga0075368_10001140 3300006042 Bacteria 8381
71 Ga0075368_10005511 3300006042 Unclassified 4359
72 Ga0075363_100000101 3300006048 Bacteria 19138
73 Ga0075363_100058245 3300006048 Unclassified 2075
74 Ga0075364_10000280 3300006051 Bacteria 24925
75 Ga0075364_10002838 3300006051 Bacteria 9761
76 Ga0075364_10022650 3300006051 Unclassified 3970
77 Ga0075364_10137769 3300006051 Bacteria 1640
78 Ga0075362_10000051 3300006177 Bacteria 38655
79 Ga0075362_10006571 3300006177 Bacteria 4342
80 Ga0075362_10151917 3300006177 Unclassified 1111
81 Ga0075367_10000232 3300006178 Bacteria 18827
82 Ga0075367_10004177 3300006178 Bacteria 7008
83 Ga0075369_10000012 3300006186 Bacteria 74833
84 Ga0075369_10000021 3300006186 Bacteria 44895
85 Ga0075366_10000001 3300006195 Bacteria 569172
86 Ga0075366_10001083 3300006195 Bacteria 13385
87 Ga0075366_10002052 3300006195 Bacteria 10221
88 Ga0075366_10002278 3300006195 Bacteria 9806
89 Ga0075366_10003260 3300006195 Bacteria 8531
90 Ga0097621_100000213 3300006237 Bacteria 38241
91 Ga0097621_100534814 3300006237 Bacteria 1065
92 Ga0075370_10003594 3300006353 Bacteria 7417
93 Ga0075370_10009121 3300006353 Bacteria 5134
94 Ga0075430_100017295 3300006846 Bacteria 6141
95 Ga0068865_100056190 3300006881 Bacteria 2741
96 Ga0105240_10000003 3300009093 Bacteria 1183681
97 Ga0105240_10018505 3300009093 Bacteria 9351
98 Ga0111539_10003243 3300009094 Bacteria 21511
99 Ga0105245_10000001 3300009098 Bacteria 939270
100 Ga0105245_10000093 3300009098 Bacteria 86866
101 Ga0105245_10013049 3300009098 Bacteria 7239
102 Ga0105245_10013944 3300009098 Bacteria 6999
103 Ga0105245_10031136 3300009098 Bacteria 4719
104 Ga0105245_10037524 3300009098 Bacteria 4309
105 Ga0105245_10062441 3300009098 Bacteria 3361
106 Ga0105245_10095359 3300009098 Bacteria 2745
107 Ga0105247_10222048 3300009101 Bacteria 1279
108 Ga0105243_10000001 3300009148 Bacteria 1156578
109 Ga0105243_10007488 3300009148 Bacteria 8388
110 Ga0105241_10000007 3300009174 Bacteria 343524
111 Ga0105241_10003543 3300009174 Bacteria 11615
112 Ga0105241_10014417 3300009174 Bacteria 5787
113 Ga0105242_10000002 3300009176 Bacteria 262559
114 Ga0105242_10001105 3300009176 Bacteria 21251
115 Ga0105248_10026055 3300009177 Bacteria 6505
116 Ga0105237_10005792 3300009545 Bacteria 13869
117 Ga0105249_10170539 3300009553 Bacteria 2110
118 Ga0105028_103845 3300009993 Bacteria 1569
119 Ga0105239_10015403 3300010375 Bacteria 8471
120 Ga0105239_10072706 3300010375 Bacteria 3781
121 Ga0105239_10198649 3300010375 Bacteria 2246
122 Ga0157373_10000096 3300013100 Bacteria 72510
123 Ga0157369_10000104 3300013105 Bacteria 118133
124 Ga0157369_10009605 3300013105 Bacteria 11062
125 Ga0157369_10017471 3300013105 Bacteria 8060
126 Ga0157374_10001055 3300013296 Bacteria 23950
127 Ga0157374_10001240 3300013296 Bacteria 21750
128 Ga0157374_10010956 3300013296 Bacteria 7829
129 Ga0157374_10202436 3300013296 Bacteria 1944
130 Ga0157374_10316611 3300013296 Unclassified 1546
131 Ga0157378_10004005 3300013297 Bacteria 13017
132 Ga0157372_10016685 3300013307 Bacteria 7882
133 Ga0157372_10098509 3300013307 Bacteria 3336
134 Ga0157372_10597214 3300013307 Unclassified 1287
135 Ga0163163_10027150 3300014325 Bacteria 5481
136 Ga0163163_10176967 3300014325 Bacteria 2180
137 Ga0157377_10008012 3300014745 Bacteria 5136
138 Ga0157379_10010500 3300014968 Bacteria 8073
139 Ga0157376_10000007 3300014969 Bacteria 368004
140 Ga0207705_10000011 3300025909 Bacteria 517768
141 Ga0207705_10000104 3300025909 Bacteria 96668
142 Ga0207705_10000136 3300025909 Bacteria 79294
143 Ga0207705_10002391 3300025909 Bacteria 14492
144 Ga0207705_10033941 3300025909 Bacteria 3647
145 Ga0207705_10163140 3300025909 Unclassified 1675
146 Ga0207654_10000002 3300025911 Bacteria 1460142
147 Ga0207654_10001677 3300025911 Bacteria 11582
148 Ga0207654_10062529 3300025911 Bacteria 2181
149 Ga0207707_10040464 3300025912 Bacteria 4071
150 Ga0207695_10000005 3300025913 Bacteria 1196715
151 Ga0207695_10150983 3300025913 Bacteria 2262
152 Ga0207671_10028073 3300025914 Bacteria 4206
153 Ga0207657_10002166 3300025919 Bacteria 21283
154 Ga0207657_10014274 3300025919 Bacteria 7765
155 Ga0207657_10022200 3300025919 Bacteria 5951
156 Ga0207657_10202396 3300025919 Bacteria 1596
157 Ga0207652_10004708 3300025921 Bacteria 11063
158 Ga0207652_10012158 3300025921 Bacteria 6955
159 Ga0207652_10064294 3300025921 Bacteria 3175
160 Ga0207652_10162641 3300025921 Bacteria 2001
161 Ga0207652_10262495 3300025921 Bacteria 1558
162 Ga0207694_10183012 3300025924 Bacteria 1700
163 Ga0207687_10000004 3300025927 Bacteria 841177
164 Ga0207687_10000127 3300025927 Bacteria 51055
165 Ga0207687_10007344 3300025927 Bacteria 7266
166 Ga0207687_10017003 3300025927 Bacteria 4781
167 Ga0207687_10029602 3300025927 Bacteria 3685
168 Ga0207687_10071160 3300025927 Bacteria 2484
169 Ga0207687_10074337 3300025927 Bacteria 2435
170 Ga0207690_10006465 3300025932 Bacteria 6946
171 Ga0207690_10092443 3300025932 Bacteria 2141
172 Ga0207686_10000001 3300025934 Bacteria 1169580
173 Ga0207709_10000002 3300025935 Bacteria 1171536
174 Ga0207709_10007984 3300025935 Bacteria 5860
175 Ga0207669_10047408 3300025937 Bacteria 2545
176 Ga0207704_10149740 3300025938 Bacteria 1645
177 Ga0207711_10069742 3300025941 Unclassified 3048
178 Ga0207661_10000083 3300025944 Bacteria 66112
179 Ga0207661_10022505 3300025944 Bacteria 4749
180 Ga0207667_10000008 3300025949 Bacteria 625138
181 Ga0207667_10000784 3300025949 Bacteria 41252
182 Ga0207667_10008146 3300025949 Bacteria 12479
183 Ga0207667_10265571 3300025949 Unclassified 1755
184 Ga0207651_10026683 3300025960 Bacteria 3613
185 Ga0207712_10030849 3300025961 Bacteria 3607
186 Ga0207712_10100165 3300025961 Bacteria 2152
187 Ga0207668_10110965 3300025972 Bacteria 2058
188 Ga0207658_10020302 3300025986 Bacteria 4600
189 Ga0207703_10011538 3300026035 Bacteria 6874
190 Ga0207678_10015387 3300026067 Bacteria 6728
191 Ga0207702_10000062 3300026078 Bacteria 124850
192 Ga0207702_10007315 3300026078 Bacteria 9434
193 Ga0207641_10103565 3300026088 Bacteria 2511
194 Ga0207674_10000001 3300026116 Bacteria 616581
195 Ga0207674_10172536 3300026116 Bacteria 2116
196 Ga0207683_10007296 3300026121 Bacteria 9473
197 Ga0207683_10524253 3300026121 Bacteria 1095
198 Ga0209813_10000002 3300027866 Bacteria 215993
199 Ga0209813_10002293 3300027866 Unclassified 4375
200 Ga0207428_10012640 3300027907 Bacteria 7405
201 Ga0268266_10020409 3300028379 Bacteria 5646
202 Ga0268266_10083928 3300028379 Bacteria 2781
203 Ga0265337_1001152 3300028556 Bacteria 13501
204 Ga0265337_1005011 3300028556 Bacteria 5370
205 Ga0265326_10003624 3300028558 Bacteria 5047
206 Ga0265319_1040941 3300028563 Unclassified 1565
207 Ga0265334_10000028 3300028573 Bacteria 115200
208 Ga0265334_10000045 3300028573 Bacteria 93663
209 Ga0265334_10013750 3300028573 Bacteria 3384
210 Ga0265322_10015787 3300028654 Unclassified 2180
211 Ga0265338_10000003 3300028800 Bacteria 733923
212 Ga0265338_10000323 3300028800 Bacteria 87009
213 Ga0265338_10000412 3300028800 Bacteria 76488
214 Ga0265338_10000905 3300028800 Bacteria 49902
215 Ga0265338_10001208 3300028800 Bacteria 42717
216 Ga0265338_10002516 3300028800 Bacteria 27243
217 Ga0265338_10021101 3300028800 Bacteria 6809
218 Ga0265338_10243694 3300028800 Bacteria 1330
219 Ga0265329_10067922 3300031242 Bacteria 1128
220 Ga0265340_10000065 3300031247 Bacteria 49264
221 Ga0265339_10014246 3300031249 Bacteria 4797
222 Ga0265331_10040843 3300031250 Bacteria 2256
223 Ga0265327_10000017 3300031251 Bacteria 445264
224 Ga0265327_10011602 3300031251 Bacteria 6045
225 Ga0265314_10116770 3300031711 Bacteria 1687
226 Ga0395899_0004401 3300037312 Bacteria 10985
227 Ga0395899_0008875 3300037312 Bacteria 7739
228 Ga0395900_0000520 3300037418 Bacteria 54397
229 Ga0395900_0205849 3300037418 Bacteria 1989
230 Ga0395900_0553606 3300037418 Bacteria 1094
231 Ga0395898_0005629 3300037466 Bacteria 13504
232 Ga0395898_0022460 3300037466 Bacteria 6389
233 Ga0395905_0000682 3300037471 Bacteria 45023
234 Ga0395905_0003087 3300037471 Bacteria 18002
235 Ga0395905_0152702 3300037471 Bacteria 2172
236 Ga0395901_0000738 3300038443 Bacteria 36950
237 Ga0395901_0001227 3300038443 Bacteria 27341
238 Ga0395901_0001401 3300038443 Bacteria 25185
239 Ga0395901_0015274 3300038443 Bacteria 7812
240 Ga0451807_2654460 3300041486 Bacteria 1454
241 Ga0495629_0065284 3300046459 Bacteria 2541
242 Ga0495609_0192071 3300046538 Unclassified 856
243 Ga0495622_0000051 3300046557 Bacteria 105674
244 Ga0495588_0000173 3300046674 Bacteria 81355
245 Ga0495658_0018120 3300046683 Bacteria 3653
246 Ga0495649_0000057 3300046694 Bacteria 99739
247 Ga0495600_0102595 3300046809 Bacteria 1864
248 Ga0495672_0155107 3300047320 Bacteria 1183
249 Ga0496100_0005577 3300048903 Bacteria 6794
250 Ga0496104_0281629 3300048907 Bacteria 1576
251 Ga0496126_0343958 3300048929 Unclassified 1221
252 Ga0501031_0002434 3300049568 Bacteria 11843
253 Ga0501032_0001611 3300049569 Bacteria 17996
254 Ga0501034_0001302 3300049571 Bacteria 33740
255 Ga0501034_0004883 3300049571 Bacteria 14794
256 Ga0501034_0033581 3300049571 Bacteria 5204
257 Ga0501034_0302279 3300049571 Unclassified 1537
258 Ga0501036_0040002 3300049572 Bacteria 3966
259 Ga0501037_0000141 3300049573 Bacteria 67142
260 Ga0501037_0101196 3300049573 Bacteria 2080
261 Ga0501037_0107319 3300049573 Unclassified 2012
262 Ga0501038_0009177 3300049574 Bacteria 9079
263 Ga0501042_0036752 3300049578 Bacteria 3475
264 Ga0501043_0000819 3300049579 Bacteria 27647
265 Ga0501046_0000145 3300049580 Bacteria 74343
266 Ga0501046_0067942 3300049580 Bacteria 2775
267 Ga0501047_0000119 3300049581 Bacteria 96051
268 Ga0501047_0000332 3300049581 Bacteria 54345
269 Ga0501048_0000059 3300049582 Bacteria 54989
270 Ga0501069_0019478 3300049585 Bacteria 3671
271 Ga0501069_0047166 3300049585 Bacteria 2391
272 Ga0501070_0014145 3300049586 Bacteria 6716
273 Ga0501080_0000106 3300049742 Bacteria 57580
274 Ga0501083_0031034 3300049744 Bacteria 3668
275 Ga0501083_0143493 3300049744 Bacteria 1563
276 Ga0501035_0000211 3300049822 Bacteria 69883
277 Ga0501035_0004211 3300049822 Bacteria 13669
278 Ga0501044_0029506 3300049823 Bacteria 5783
279 Ga0501044_0091298 3300049823 Bacteria 3072
280 Ga0501044_0430177 3300049823 Bacteria 1229
281 nmdc:mga03683_50_c1 3300050489 Bacteria 42495
282 nmdc:mga03683_5325_c1 3300050489 Bacteria 4342
283 nmdc:mga03683_61308_c1 3300050489 Unclassified 1590
284 nmdc:mga03n38_114_c1 3300050490 Bacteria 17436
285 nmdc:mga03n38_2840_c1 3300050490 Bacteria 5449
286 nmdc:mga00v17_1724_c1 3300050491 Bacteria 11352
287 nmdc:mga00v17_18383_c1 3300050491 Unclassified 3969
288 nmdc:mga00v17_68475_c1 3300050491 Bacteria 2194
289 nmdc:mga00v17_76439_c1 3300050491 Bacteria 2083
290 nmdc:mga00v17_981_c1 3300050491 Bacteria 15279
291 nmdc:mga0yw44_13_c1 3300050492 Bacteria 120183
292 nmdc:mga0yw44_162798_c1 3300050492 Unclassified 1461
293 nmdc:mga0yw44_85777_c1 3300050492 Bacteria 1982
294 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
295 nmdc:mga0k408_33_c2 3300050493 Bacteria 57718
296 nmdc:mga0k408_3403_c1 3300050493 Bacteria 8428
297 nmdc:mga0k408_5697_c1 3300050493 Bacteria 6625
298 nmdc:mga0k408_58_c1 3300050493 Bacteria 28391
299 nmdc:mga0k408_6876_c1 3300050493 Bacteria 6069
300 nmdc:mga06z11_10_c1 3300050494 Bacteria 105982
301 nmdc:mga06z11_116_c1 3300050494 Bacteria 32792
302 nmdc:mga04h51_2492_c1 3300050495 Unclassified 4375
303 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
304 nmdc:mga07m45_30009_c1 3300050496 Bacteria 3010
305 nmdc:mga07m45_31225_c1 3300050496 Bacteria 2952
306 nmdc:mga0qj67_16661_c1 3300050509 Bacteria 5577
307 nmdc:mga08y16_1247_c1 3300050511 Bacteria 25239
308 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
309 nmdc:mga0sz30_4_c1 3300050516 Bacteria 84956
310 Ga0500610_0000009 3300053079 Bacteria 105876
311 Ga0500643_000011 3300053087 Bacteria 385630
312 Ga0500643_014805 3300053087 Bacteria 2694
313 Ga0500644_0000173 3300053088 Bacteria 41225
314 Ga0500644_0000654 3300053088 Bacteria 12837
315 Ga0500646_0000948 3300053090 Bacteria 7972
316 Ga0500651_0000051 3300053093 Bacteria 76584
317 Ga0500651_0038948 3300053093 Unclassified 2994
318 Ga0500566_0000001 3300053094 Bacteria 1101031
319 Ga0500650_0000003 3300053098 Bacteria 164144
320 Ga0500555_000001 3300053103 Bacteria 1353713
321 Ga0500555_000002 3300053103 Bacteria 1314346
322 Ga0500556_0000196 3300053104 Bacteria 49648
323 Ga0500562_000002 3300053108 Bacteria 977234
324 Ga0500562_006413 3300053108 Bacteria 2967
325 Ga0500593_000001 3300053117 Bacteria 784404
326 Ga0500594_0000001 3300053118 Bacteria 1178472
327 Ga0500594_0000235 3300053118 Bacteria 13379
328 Ga0500614_000001 3300053123 Bacteria 1274484
329 Ga0500628_000009 3300053129 Bacteria 122386
330 Ga0500652_000049 3300053131 Bacteria 55921
331 Ga0500655_000556 3300053133 Bacteria 7488
332 Ga0500561_0000001 3300053137 Bacteria 957685
333 Ga0500568_0010548 3300053139 Bacteria 4319
334 Ga0500577_0000065 3300053142 Bacteria 23850
335 Ga0500577_0000345 3300053142 Bacteria 11924
336 Ga0500579_003632 3300053143 Bacteria 9308
337 Ga0500604_0015902 3300053151 Bacteria 2067
338 Ga0500616_0000005 3300053153 Bacteria 961725
339 Ga0500616_0066422 3300053153 Bacteria 1852
340 Ga0500616_0145916 3300053153 Bacteria 1101
341 Ga0500649_000009 3300053722 Bacteria 94696
342 Ga0500611_000436 3300053727 Bacteria 4244
343 Ga0501084_0038410 3300054114 Bacteria 4003
344 Ga0501082_0059321 3300060353 Bacteria 3298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053137 Ga0500561_0000001 Ga0500561_0000001_46430_47296 240
2 3300046538 Ga0495609_0192071 Ga0495609_0192071_27_818 241
3 3300009098 Ga0105245_10062441 Ga0105245_100624413 246
4 3300025927 Ga0207687_10029602 Ga0207687_100296023 246
5 3300005329 Ga0070683_100064418 Ga0070683_1000644182 250
6 3300025935 Ga0207709_10007984 Ga0207709_100079842 251
7 3300009176 Ga0105242_10001105 Ga0105242_100011052 254
8 3300009098 Ga0105245_10013944 Ga0105245_100139445 257
9 3300009148 Ga0105243_10007488 Ga0105243_100074885 257
10 3300025927 Ga0207687_10071160 Ga0207687_100711603 257
11 3300005327 Ga0070658_10202725 Ga0070658_102027252 258
12 3300005577 Ga0068857_100095951 Ga0068857_1000959513 258
13 3300025909 Ga0207705_10163140 Ga0207705_101631402 258
14 3300005327 Ga0070658_10000668 Ga0070658_100006683 260
15 3300005339 Ga0070660_100000185 Ga0070660_10000018527 260
16 3300005366 Ga0070659_100001803 Ga0070659_1000018035 260
17 3300005563 Ga0068855_100002780 Ga0068855_10000278022 260
18 3300025909 Ga0207705_10002391 Ga0207705_100023917 260
19 3300025919 Ga0207657_10002166 Ga0207657_100021667 260
20 3300025932 Ga0207690_10006465 Ga0207690_100064655 260
21 3300025949 Ga0207667_10000784 Ga0207667_100007845 260
22 3300028800 Ga0265338_10000412 Ga0265338_1000041218 264
23 3300049585 Ga0501069_0047166 Ga0501069_0047166_634_1491 264
24 3300049742 Ga0501080_0000106 Ga0501080_0000106_25136_25993 264
25 3300054114 Ga0501084_0038410 Ga0501084_0038410_879_1736 264
26 3300009993 Ga0105028_103845 Ga0105028_1038452 265
27 3300006051 Ga0075364_10000280 Ga0075364_100002803 270
28 3300009101 Ga0105247_10222048 Ga0105247_102220481 270
29 3300050491 nmdc:mga00v17_1724_c1 nmdc:mga00v17_1724_c1_6344_7210 270
30 3300053153 Ga0500616_0066422 Ga0500616_0066422_774_1664 272
31 3300009177 Ga0105248_10026055 Ga0105248_100260554 273
32 3300014968 Ga0157379_10010500 Ga0157379_100105004 273
33 3300025924 Ga0207694_10183012 Ga0207694_101830122 275
34 3300005841 Ga0068863_100036896 Ga0068863_1000368964 277
35 3300025941 Ga0207711_10069742 Ga0207711_100697422 277
36 3300028563 Ga0265319_1040941 Ga0265319_10409412 278
37 3300049823 Ga0501044_0430177 Ga0501044_0430177_119_964 278
38 3300028573 Ga0265334_10013750 Ga0265334_100137503 279
39 3300028800 Ga0265338_10002516 Ga0265338_1000251626 279
40 3300031242 Ga0265329_10067922 Ga0265329_100679221 279
41 3300031249 Ga0265339_10014246 Ga0265339_100142463 279
42 3300031251 Ga0265327_10011602 Ga0265327_100116026 279
43 3300049573 Ga0501037_0107319 Ga0501037_0107319_1092_1931 279
44 3300006186 Ga0075369_10000012 Ga0075369_1000001241 280
45 3300013296 Ga0157374_10316611 Ga0157374_103166112 280
46 3300037312 Ga0395899_0008875 Ga0395899_0008875_6874_7728 280
47 3300053088 Ga0500644_0000654 Ga0500644_0000654_11913_12755 280
48 3300053142 Ga0500577_0000345 Ga0500577_0000345_9308_10150 280
49 3300028556 Ga0265337_1001152 Ga0265337_100115211 281
50 3300028558 Ga0265326_10003624 Ga0265326_100036243 281
51 3300028573 Ga0265334_10000045 Ga0265334_1000004529 281
52 3300028654 Ga0265322_10015787 Ga0265322_100157872 281
53 3300028800 Ga0265338_10000003 Ga0265338_10000003681 281
54 3300050490 nmdc:mga03n38_114_c1 nmdc:mga03n38_114_c1_7096_7944 281
55 3300050491 nmdc:mga00v17_68475_c1 nmdc:mga00v17_68475_c1_460_1305 281
56 3300050494 nmdc:mga06z11_10_c1 nmdc:mga06z11_10_c1_75393_76241 281
57 3300050495 nmdc:mga04h51_2_c1 nmdc:mga04h51_2_c1_75390_76238 281
58 3300050496 nmdc:mga07m45_31225_c1 nmdc:mga07m45_31225_c1_1429_2277 281
59 3300050511 nmdc:mga08y16_1247_c1 nmdc:mga08y16_1247_c1_20453_21301 281
60 3300053151 Ga0500604_0015902 Ga0500604_0015902_833_1699 281
61 3300006051 Ga0075364_10002838 Ga0075364_100028387 282
62 3300006177 Ga0075362_10006571 Ga0075362_100065713 282
63 3300006195 Ga0075366_10001083 Ga0075366_100010833 282
64 3300049580 Ga0501046_0067942 Ga0501046_0067942_1248_2099 282
65 3300050489 nmdc:mga03683_5325_c1 nmdc:mga03683_5325_c1_940_1788 282
66 3300050491 nmdc:mga00v17_981_c1 nmdc:mga00v17_981_c1_5750_6598 282
67 3300050493 nmdc:mga0k408_58_c1 nmdc:mga0k408_58_c1_17967_18824 282
68 3300028556 Ga0265337_1005011 Ga0265337_10050112 283
69 3300028800 Ga0265338_10021101 Ga0265338_100211015 283
70 3300031711 Ga0265314_10116770 Ga0265314_101167702 283
71 3300049568 Ga0501031_0002434 Ga0501031_0002434_4647_5528 283
72 3300049569 Ga0501032_0001611 Ga0501032_0001611_12035_12916 283
73 3300049571 Ga0501034_0004883 Ga0501034_0004883_8592_9473 283
74 3300049572 Ga0501036_0040002 Ga0501036_0040002_2369_3250 283
75 3300049573 Ga0501037_0000141 Ga0501037_0000141_62088_62969 283
76 3300049574 Ga0501038_0009177 Ga0501038_0009177_3054_3935 283
77 3300049578 Ga0501042_0036752 Ga0501042_0036752_1276_2157 283
78 3300049579 Ga0501043_0000819 Ga0501043_0000819_13739_14620 283
79 3300049580 Ga0501046_0000145 Ga0501046_0000145_18492_19373 283
80 3300049581 Ga0501047_0000332 Ga0501047_0000332_52011_52892 283
81 3300049582 Ga0501048_0000059 Ga0501048_0000059_31933_32814 283
82 3300049585 Ga0501069_0019478 Ga0501069_0019478_706_1587 283
83 3300049586 Ga0501070_0014145 Ga0501070_0014145_3466_4347 283
84 3300049744 Ga0501083_0143493 Ga0501083_0143493_281_1162 283
85 3300049822 Ga0501035_0004211 Ga0501035_0004211_2054_2935 283
86 3300049823 Ga0501044_0029506 Ga0501044_0029506_4161_5042 283
87 3300060353 Ga0501082_0059321 Ga0501082_0059321_372_1253 283
88 3300002244 JGI24742J22300_10000078 JGI24742J22300_1000007815 284
89 3300005327 Ga0070658_10043403 Ga0070658_100434033 284
90 3300005455 Ga0070663_100022619 Ga0070663_1000226193 284
91 3300005458 Ga0070681_10069972 Ga0070681_100699722 284
92 3300005577 Ga0068857_100075310 Ga0068857_1000753102 284
93 3300005614 Ga0068856_100006945 Ga0068856_1000069459 284
94 3300006237 Ga0097621_100534814 Ga0097621_1005348141 284
95 3300006881 Ga0068865_100056190 Ga0068865_1000561902 284
96 3300009093 Ga0105240_10000003 Ga0105240_100000031251 284
97 3300009098 Ga0105245_10000093 Ga0105245_1000009322 284
98 3300009098 Ga0105245_10031136 Ga0105245_100311364 284
99 3300009148 Ga0105243_10000001 Ga0105243_1000000128 284
100 3300009176 Ga0105242_10000002 Ga0105242_10000002254 284
101 3300009545 Ga0105237_10005792 Ga0105237_100057924 284
102 3300010375 Ga0105239_10015403 Ga0105239_100154035 284
103 3300013296 Ga0157374_10001055 Ga0157374_1000105511 284
104 3300014325 Ga0163163_10027150 Ga0163163_100271504 284
105 3300014969 Ga0157376_10000007 Ga0157376_1000000737 284
106 3300025909 Ga0207705_10033941 Ga0207705_100339414 284
107 3300025912 Ga0207707_10040464 Ga0207707_100404644 284
108 3300025913 Ga0207695_10000005 Ga0207695_100000051262 284
109 3300025914 Ga0207671_10028073 Ga0207671_100280733 284
110 3300025927 Ga0207687_10000127 Ga0207687_1000012722 284
111 3300025927 Ga0207687_10017003 Ga0207687_100170034 284
112 3300025934 Ga0207686_10000001 Ga0207686_100000011116 284
113 3300025935 Ga0207709_10000002 Ga0207709_100000021233 284
114 3300025938 Ga0207704_10149740 Ga0207704_101497401 284
115 3300026067 Ga0207678_10015387 Ga0207678_100153874 284
116 3300026078 Ga0207702_10007315 Ga0207702_100073152 284
117 3300028573 Ga0265334_10000028 Ga0265334_1000002834 284
118 3300028800 Ga0265338_10000323 Ga0265338_1000032357 284
119 3300028800 Ga0265338_10000905 Ga0265338_1000090529 284
120 3300031247 Ga0265340_10000065 Ga0265340_100000656 284
121 3300037418 Ga0395900_0205849 Ga0395900_0205849_731_1591 284
122 3300038443 Ga0395901_0000738 Ga0395901_0000738_6903_7763 284
123 3300048903 Ga0496100_0005577 Ga0496100_0005577_5719_6579 284
124 3300049573 Ga0501037_0101196 Ga0501037_0101196_647_1513 284
125 3300053093 Ga0500651_0000051 Ga0500651_0000051_40795_41655 284
126 3300053093 Ga0500651_0038948 Ga0500651_0038948_2000_2860 284
127 3300053118 Ga0500594_0000235 Ga0500594_0000235_11903_12757 284
128 3300053129 Ga0500628_000009 Ga0500628_000009_7132_7986 284
129 3300003322 rootL2_10164844 rootL2_101648443 285
130 3300005327 Ga0070658_10000358 Ga0070658_100003589 285
131 3300005327 Ga0070658_10000669 Ga0070658_1000066934 285
132 3300005327 Ga0070658_10074916 Ga0070658_100749163 285
133 3300005336 Ga0070680_100009170 Ga0070680_1000091702 285
134 3300005339 Ga0070660_100213424 Ga0070660_1002134241 285
135 3300005355 Ga0070671_100059261 Ga0070671_1000592612 285
136 3300005356 Ga0070674_100008732 Ga0070674_1000087322 285
137 3300005364 Ga0070673_100039642 Ga0070673_1000396421 285
138 3300005366 Ga0070659_100140230 Ga0070659_1001402302 285
139 3300005456 Ga0070678_100003223 Ga0070678_1000032235 285
140 3300005466 Ga0070685_10002698 Ga0070685_100026984 285
141 3300005466 Ga0070685_10014074 Ga0070685_100140741 285
142 3300005530 Ga0070679_100144926 Ga0070679_1001449263 285
143 3300005548 Ga0070665_100095156 Ga0070665_1000951562 285
144 3300005548 Ga0070665_100188666 Ga0070665_1001886661 285
145 3300005841 Ga0068863_100043689 Ga0068863_1000436893 285
146 3300005937 Ga0081455_10000003 Ga0081455_100000033 285
147 3300009098 Ga0105245_10095359 Ga0105245_100953593 285
148 3300009553 Ga0105249_10170539 Ga0105249_101705392 285
149 3300010375 Ga0105239_10072706 Ga0105239_100727062 285
150 3300013105 Ga0157369_10017471 Ga0157369_100174713 285
151 3300013296 Ga0157374_10202436 Ga0157374_102024362 285
152 3300013297 Ga0157378_10004005 Ga0157378_100040058 285
153 3300013307 Ga0157372_10098509 Ga0157372_100985094 285
154 3300025909 Ga0207705_10000136 Ga0207705_1000013670 285
155 3300025919 Ga0207657_10014274 Ga0207657_100142743 285
156 3300025919 Ga0207657_10202396 Ga0207657_102023962 285
157 3300025921 Ga0207652_10004708 Ga0207652_100047086 285
158 3300025932 Ga0207690_10092443 Ga0207690_100924432 285
159 3300025937 Ga0207669_10047408 Ga0207669_100474083 285
160 3300025960 Ga0207651_10026683 Ga0207651_100266834 285
161 3300025961 Ga0207712_10100165 Ga0207712_101001652 285
162 3300026088 Ga0207641_10103565 Ga0207641_101035651 285
163 3300026121 Ga0207683_10007296 Ga0207683_100072966 285
164 3300028379 Ga0268266_10020409 Ga0268266_100204094 285
165 3300028379 Ga0268266_10083928 Ga0268266_100839282 285
166 3300037471 Ga0395905_0003087 Ga0395905_0003087_8835_9698 285
167 3300041486 Ga0451807_2654460 Ga0451807_2654460_286_1143 285
168 3300047320 Ga0495672_0155107 Ga0495672_0155107_39_896 285
169 3300048907 Ga0496104_0281629 Ga0496104_0281629_115_981 285
170 3300053079 Ga0500610_0000009 Ga0500610_0000009_104496_105353 285
171 3300053087 Ga0500643_014805 Ga0500643_014805_181_1038 285
172 3300053088 Ga0500644_0000173 Ga0500644_0000173_9353_10210 285
173 3300053090 Ga0500646_0000948 Ga0500646_0000948_5045_5908 285
174 3300053098 Ga0500650_0000003 Ga0500650_0000003_37838_38701 285
175 3300053103 Ga0500555_000002 Ga0500555_000002_38255_39112 285
176 3300053108 Ga0500562_006413 Ga0500562_006413_1656_2519 285
177 3300053118 Ga0500594_0000001 Ga0500594_0000001_339850_340713 285
178 3300053131 Ga0500652_000049 Ga0500652_000049_4245_5102 285
179 3300053133 Ga0500655_000556 Ga0500655_000556_5106_5969 285
180 3300053142 Ga0500577_0000065 Ga0500577_0000065_4090_4953 285
181 3300053143 Ga0500579_003632 Ga0500579_003632_4716_5579 285
182 3300053153 Ga0500616_0145916 Ga0500616_0145916_217_1080 285
183 3300005327 Ga0070658_10001490 Ga0070658_100014906 286
184 3300005466 Ga0070685_10202053 Ga0070685_102020531 286
185 3300005535 Ga0070684_100264741 Ga0070684_1002647411 286
186 3300005563 Ga0068855_100040488 Ga0068855_1000404885 286
187 3300005563 Ga0068855_100044794 Ga0068855_1000447944 286
188 3300005563 Ga0068855_100354310 Ga0068855_1003543101 286
189 3300005577 Ga0068857_100000040 Ga0068857_10000004030 286
190 3300005577 Ga0068857_100260590 Ga0068857_1002605902 286
191 3300005842 Ga0068858_100005127 Ga0068858_1000051274 286
192 3300009098 Ga0105245_10013049 Ga0105245_100130495 286
193 3300013296 Ga0157374_10010956 Ga0157374_100109566 286
194 3300013307 Ga0157372_10597214 Ga0157372_105972142 286
195 3300014325 Ga0163163_10176967 Ga0163163_101769671 286
196 3300014745 Ga0157377_10008012 Ga0157377_100080122 286
197 3300025909 Ga0207705_10000104 Ga0207705_1000010446 286
198 3300025927 Ga0207687_10007344 Ga0207687_100073443 286
199 3300025949 Ga0207667_10008146 Ga0207667_100081464 286
200 3300025949 Ga0207667_10265571 Ga0207667_102655712 286
201 3300025972 Ga0207668_10110965 Ga0207668_101109652 286
202 3300026035 Ga0207703_10011538 Ga0207703_100115382 286
203 3300026116 Ga0207674_10000001 Ga0207674_1000000130 286
204 3300026116 Ga0207674_10172536 Ga0207674_101725363 286
205 3300050491 nmdc:mga00v17_18383_c1 nmdc:mga00v17_18383_c1_947_1807 286
206 3300050493 nmdc:mga0k408_3403_c1 nmdc:mga0k408_3403_c1_5964_6824 286
207 3300050494 nmdc:mga06z11_116_c1 nmdc:mga06z11_116_c1_10973_11833 286
208 3300050495 nmdc:mga04h51_2492_c1 nmdc:mga04h51_2492_c1_656_1516 286
209 3300053087 Ga0500643_000011 Ga0500643_000011_329106_329981 286
210 3300053139 Ga0500568_0010548 Ga0500568_0010548_3379_4245 286
211 3300003316 rootH1_10177805 rootH1_101778052 287
212 3300005327 Ga0070658_10065677 Ga0070658_100656772 287
213 3300005367 Ga0070667_100004285 Ga0070667_1000042854 287
214 3300005456 Ga0070678_100073195 Ga0070678_1000731951 287
215 3300005530 Ga0070679_100002396 Ga0070679_10000239613 287
216 3300005530 Ga0070679_100146669 Ga0070679_1001466693 287
217 3300005614 Ga0068856_100001246 Ga0068856_1000012469 287
218 3300005844 Ga0068862_100107661 Ga0068862_1001076612 287
219 3300006038 Ga0075365_10189503 Ga0075365_101895031 287
220 3300006042 Ga0075368_10001140 Ga0075368_100011405 287
221 3300006048 Ga0075363_100000101 Ga0075363_10000010114 287
222 3300006178 Ga0075367_10004177 Ga0075367_100041773 287
223 3300006186 Ga0075369_10000021 Ga0075369_1000002132 287
224 3300006353 Ga0075370_10003594 Ga0075370_100035943 287
225 3300009094 Ga0111539_10003243 Ga0111539_100032432 287
226 3300009098 Ga0105245_10000001 Ga0105245_1000000136 287
227 3300009098 Ga0105245_10037524 Ga0105245_100375243 287
228 3300010375 Ga0105239_10198649 Ga0105239_101986492 287
229 3300013105 Ga0157369_10009605 Ga0157369_100096056 287
230 3300013296 Ga0157374_10001240 Ga0157374_1000124023 287
231 3300013307 Ga0157372_10016685 Ga0157372_100166858 287
232 3300025921 Ga0207652_10012158 Ga0207652_100121582 287
233 3300025921 Ga0207652_10162641 Ga0207652_101626412 287
234 3300025927 Ga0207687_10000004 Ga0207687_10000004231 287
235 3300025927 Ga0207687_10074337 Ga0207687_100743372 287
236 3300025961 Ga0207712_10030849 Ga0207712_100308493 287
237 3300025986 Ga0207658_10020302 Ga0207658_100203023 287
238 3300026078 Ga0207702_10000062 Ga0207702_100000629 287
239 3300026121 Ga0207683_10524253 Ga0207683_105242531 287
240 3300027866 Ga0209813_10000002 Ga0209813_10000002153 287
241 3300027907 Ga0207428_10012640 Ga0207428_100126404 287
242 3300028800 Ga0265338_10001208 Ga0265338_1000120819 287
243 3300031250 Ga0265331_10040843 Ga0265331_100408433 287
244 3300037312 Ga0395899_0004401 Ga0395899_0004401_5073_5936 287
245 3300037466 Ga0395898_0005629 Ga0395898_0005629_11116_11979 287
246 3300037471 Ga0395905_0000682 Ga0395905_0000682_20629_21492 287
247 3300038443 Ga0395901_0015274 Ga0395901_0015274_2246_3109 287
248 3300046694 Ga0495649_0000057 Ga0495649_0000057_15724_16587 287
249 3300049744 Ga0501083_0031034 Ga0501083_0031034_2301_3167 287
250 3300050492 nmdc:mga0yw44_162798_c1 nmdc:mga0yw44_162798_c1_511_1389 287
251 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_15562_16425 287
252 3300053104 Ga0500556_0000196 Ga0500556_0000196_7729_8592 287
253 3300053108 Ga0500562_000002 Ga0500562_000002_186813_187682 287
254 3300053117 Ga0500593_000001 Ga0500593_000001_324655_325524 287
255 3300001915 JGI24741J21665_1000410 JGI24741J21665_10004103 288
256 3300001979 JGI24740J21852_10016619 JGI24740J21852_100166193 288
257 3300003320 rootH2_10000244 rootH2_1000024428 288
258 3300003320 rootH2_10112779 rootH2_101127792 288
259 3300003322 rootL2_10055423 rootL2_100554233 288
260 3300005327 Ga0070658_10000036 Ga0070658_1000003631 288
261 3300005329 Ga0070683_100000092 Ga0070683_10000009217 288
262 3300005329 Ga0070683_100000891 Ga0070683_1000008915 288
263 3300005330 Ga0070690_100000735 Ga0070690_1000007355 288
264 3300005336 Ga0070680_100009762 Ga0070680_1000097625 288
265 3300005339 Ga0070660_100000047 Ga0070660_1000000475 288
266 3300005530 Ga0070679_100100688 Ga0070679_1001006882 288
267 3300005535 Ga0070684_100006753 Ga0070684_1000067533 288
268 3300005535 Ga0070684_100381999 Ga0070684_1003819991 288
269 3300005544 Ga0070686_100004629 Ga0070686_1000046293 288
270 3300005563 Ga0068855_100000003 Ga0068855_100000003636 288
271 3300005614 Ga0068856_100000968 Ga0068856_1000009689 288
272 3300006038 Ga0075365_10000021 Ga0075365_100000213 288
273 3300006038 Ga0075365_10178018 Ga0075365_101780182 288
274 3300006042 Ga0075368_10005511 Ga0075368_100055114 288
275 3300006048 Ga0075363_100058245 Ga0075363_1000582452 288
276 3300006051 Ga0075364_10022650 Ga0075364_100226503 288
277 3300006051 Ga0075364_10137769 Ga0075364_101377691 288
278 3300006177 Ga0075362_10000051 Ga0075362_1000005113 288
279 3300006177 Ga0075362_10151917 Ga0075362_101519172 288
280 3300006178 Ga0075367_10000232 Ga0075367_100002328 288
281 3300006195 Ga0075366_10000001 Ga0075366_1000000127 288
282 3300006195 Ga0075366_10002052 Ga0075366_100020525 288
283 3300006195 Ga0075366_10002278 Ga0075366_100022785 288
284 3300006195 Ga0075366_10003260 Ga0075366_100032603 288
285 3300006237 Ga0097621_100000213 Ga0097621_10000021326 288
286 3300006353 Ga0075370_10009121 Ga0075370_100091211 288
287 3300006846 Ga0075430_100017295 Ga0075430_1000172952 288
288 3300009093 Ga0105240_10018505 Ga0105240_100185053 288
289 3300009174 Ga0105241_10000007 Ga0105241_1000000732 288
290 3300009174 Ga0105241_10003543 Ga0105241_100035436 288
291 3300009174 Ga0105241_10014417 Ga0105241_100144175 288
292 3300013100 Ga0157373_10000096 Ga0157373_1000009641 288
293 3300013105 Ga0157369_10000104 Ga0157369_100001048 288
294 3300025909 Ga0207705_10000011 Ga0207705_10000011565 288
295 3300025911 Ga0207654_10000002 Ga0207654_100000021515 288
296 3300025911 Ga0207654_10001677 Ga0207654_100016775 288
297 3300025911 Ga0207654_10062529 Ga0207654_100625292 288
298 3300025913 Ga0207695_10150983 Ga0207695_101509833 288
299 3300025919 Ga0207657_10022200 Ga0207657_100222005 288
300 3300025921 Ga0207652_10064294 Ga0207652_100642943 288
301 3300025921 Ga0207652_10262495 Ga0207652_102624952 288
302 3300025944 Ga0207661_10000083 Ga0207661_1000008329 288
303 3300025944 Ga0207661_10022505 Ga0207661_100225052 288
304 3300025949 Ga0207667_10000008 Ga0207667_10000008626 288
305 3300027866 Ga0209813_10002293 Ga0209813_100022932 288
306 3300028800 Ga0265338_10243694 Ga0265338_102436942 288
307 3300031251 Ga0265327_10000017 Ga0265327_10000017473 288
308 3300037418 Ga0395900_0000520 Ga0395900_0000520_43780_44658 288
309 3300037418 Ga0395900_0553606 Ga0395900_0553606_157_1026 288
310 3300037466 Ga0395898_0022460 Ga0395898_0022460_4403_5272 288
311 3300037471 Ga0395905_0152702 Ga0395905_0152702_496_1365 288
312 3300038443 Ga0395901_0001227 Ga0395901_0001227_25885_26763 288
313 3300038443 Ga0395901_0001401 Ga0395901_0001401_11662_12531 288
314 3300046459 Ga0495629_0065284 Ga0495629_0065284_369_1241 288
315 3300046557 Ga0495622_0000051 Ga0495622_0000051_96302_97174 288
316 3300046674 Ga0495588_0000173 Ga0495588_0000173_28870_29736 288
317 3300046683 Ga0495658_0018120 Ga0495658_0018120_1838_2710 288
318 3300046809 Ga0495600_0102595 Ga0495600_0102595_427_1299 288
319 3300048929 Ga0496126_0343958 Ga0496126_0343958_310_1176 288
320 3300049571 Ga0501034_0001302 Ga0501034_0001302_5231_6100 288
321 3300049571 Ga0501034_0033581 Ga0501034_0033581_1496_2365 288
322 3300049571 Ga0501034_0302279 Ga0501034_0302279_620_1486 288
323 3300049581 Ga0501047_0000119 Ga0501047_0000119_66673_67542 288
324 3300049822 Ga0501035_0000211 Ga0501035_0000211_28523_29392 288
325 3300049823 Ga0501044_0091298 Ga0501044_0091298_1685_2554 288
326 3300050489 nmdc:mga03683_50_c1 nmdc:mga03683_50_c1_14468_15337 288
327 3300050489 nmdc:mga03683_61308_c1 nmdc:mga03683_61308_c1_85_951 288
328 3300050490 nmdc:mga03n38_2840_c1 nmdc:mga03n38_2840_c1_3818_4687 288
329 3300050491 nmdc:mga00v17_76439_c1 nmdc:mga00v17_76439_c1_510_1376 288
330 3300050492 nmdc:mga0yw44_13_c1 nmdc:mga0yw44_13_c1_80815_81687 288
331 3300050492 nmdc:mga0yw44_85777_c1 nmdc:mga0yw44_85777_c1_636_1502 288
332 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_1051417_1052289 288
333 3300050493 nmdc:mga0k408_33_c2 nmdc:mga0k408_33_c2_11681_12547 288
334 3300050493 nmdc:mga0k408_5697_c1 nmdc:mga0k408_5697_c1_927_1793 288
335 3300050493 nmdc:mga0k408_6876_c1 nmdc:mga0k408_6876_c1_1609_2475 288
336 3300050496 nmdc:mga07m45_30009_c1 nmdc:mga07m45_30009_c1_33_905 288
337 3300050509 nmdc:mga0qj67_16661_c1 nmdc:mga0qj67_16661_c1_379_1254 288
338 3300050516 nmdc:mga0sz30_4_c1 nmdc:mga0sz30_4_c1_35044_35916 288
339 3300053094 Ga0500566_0000001 Ga0500566_0000001_1028325_1029197 288
340 3300053103 Ga0500555_000001 Ga0500555_000001_1309436_1310302 288
341 3300053123 Ga0500614_000001 Ga0500614_000001_1104353_1105219 288
342 3300053153 Ga0500616_0000005 Ga0500616_0000005_641480_642367 288
343 3300053722 Ga0500649_000009 Ga0500649_000009_81731_82597 288
344 3300053727 Ga0500611_000436 Ga0500611_000436_203_1075 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02195

ParBc

ParB/Sulfiredoxin domain

54

143

0.96

PF23552

267

307

0.96

PF17762

HTH_ParB

HTH domain found in ParB protein

193

245

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s6h-assembly1.cif.gz_A crystal structure of the dna binding domain of the chromosome-partitioning protein parb complexed to the centromeric pars site 0.9144 115 225
6s6h-assembly1.cif.gz_B crystal structure of the dna binding domain of the chromosome-partitioning protein parb complexed to the centromeric pars site 0.9138 115 226
6y93-assembly1.cif.gz_A crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.906 128 233
6y93-assembly1.cif.gz_A crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.8981 128 233
6y93-assembly1.cif.gz_B crystal structure of the dna-binding domain of the nucleoid occlusion factor (noc) complexed to the noc-binding site (nbs) 0.8955 116 230
ID Description Score Start End Superfamily
af_Q2FUQ5_43_106_3.90.1530.30 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9767 47 110 3.90.1530.30
af_Q2FUQ5_43_106_3.90.1530.30 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9621 47 110 3.90.1530.30
1vz0A01 Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain; 0.9586 54 109 3.90.1530.30
af_P9WIJ9_142_255_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9228 114 223 1.10.10.2830
af_Q2G118_97_208_1.10.10.2830 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9153 112 222 1.10.10.2830
ID Description Score Start End GO Terms
AF-A0A7X6EQM4-F1-model_v4 deleted 0.9855 34 102
AF-A0A7X6EQM4-F1-model_v4 deleted 0.873 34 102
AF-A0A7K1DJ47-F1-model_v4 ParB/RepB/Spo0J family partition protein 0.85 33 229 GO:0003677
GO:0005694
GO:0007059
GO:0045881
AF-A0A2T4RMR3-F1-model_v4 deleted 0.8456 114 246
AF-A0A2T4RMR3-F1-model_v4 deleted 0.8329 114 246

Feature Viewer

pLDDT pTM Quality
79.71 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map