F415891

General Info

Members Datasets Scaffolds Average Seq Length
344 168 688 217

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100050360|Ga0068859_1000503603
Length 218
Sequence MLELARAGGEEGLWLRAERQTQGRGRQGRAWASPQGNLYVSTLVRLRAADPPAATLALVAAVALEEAVRVFLPHGATIKWPNDLLIGGAKLSGILLERNGDAVVIGFGVNLAHHPEDTDRKATSLAAHAAACEPHIFLETLAEIFARWLHRWRSDGLAPVREXXXARAHPIGTALSVRQYDAPPLEGLFDGLDPGGAIILRLADGTRHVMHAADVFLI

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
144 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
145 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
146 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 2.62
Rhizosphere 95.35
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100050360 3300005617 Bacteria 4184
2 JGI24740J21852_10010606 3300001979 Bacteria 3539
3 JGI24739J22299_10000252 3300001989 Bacteria 18058
4 JGI24739J22299_10001972 3300001989 Bacteria 7852
5 JGI24737J22298_10001703 3300001990 Bacteria 7848
6 JGI24737J22298_10001807 3300001990 Bacteria 7664
7 JGI24738J21930_10001019 3300002075 Bacteria 8002
8 JGI24738J21930_10006483 3300002075 Bacteria 2744
9 rootL2_10012722 3300003322 Bacteria 1839
10 Ga0055530_10000623 3300003791 Bacteria 30661
11 Ga0055531_10000619 3300003794 Bacteria 30659
12 Ga0070658_10002556 3300005327 Bacteria 15170
13 Ga0070658_10034969 3300005327 Bacteria 4045
14 Ga0070658_10207568 3300005327 Bacteria 1654
15 Ga0070658_10237148 3300005327 Bacteria 1545
16 Ga0070676_10010296 3300005328 Bacteria 5070
17 Ga0070683_100029236 3300005329 Bacteria 4987
18 Ga0070670_100014557 3300005331 Bacteria 6754
19 Ga0070670_100021062 3300005331 Bacteria 5607
20 Ga0070670_100024563 3300005331 Bacteria 5181
21 Ga0070670_100031408 3300005331 Bacteria 4573
22 Ga0070677_10072922 3300005333 Bacteria 1449
23 Ga0068869_100030466 3300005334 Bacteria 3787
24 Ga0068869_100137640 3300005334 Bacteria 1883
25 Ga0068869_100394514 3300005334 Bacteria 1137
26 Ga0070666_10000346 3300005335 Bacteria 29073
27 Ga0070666_10003796 3300005335 Bacteria 9163
28 Ga0070682_100018027 3300005337 Bacteria 4120
29 Ga0070682_100078749 3300005337 Bacteria 2127
30 Ga0068868_100001893 3300005338 Bacteria 14366
31 Ga0068868_100191943 3300005338 Bacteria 1699
32 Ga0070660_100000350 3300005339 Bacteria 30817
33 Ga0070660_100006064 3300005339 Bacteria 8358
34 Ga0070660_100014062 3300005339 Bacteria 5760
35 Ga0070660_100058764 3300005339 Bacteria 2981
36 Ga0070689_100075409 3300005340 Bacteria 2641
37 Ga0070661_100000536 3300005344 Bacteria 29149
38 Ga0070661_100012197 3300005344 Bacteria 6008
39 Ga0070661_100020387 3300005344 Bacteria 4727
40 Ga0070668_100099724 3300005347 Bacteria 2300
41 Ga0070669_100001260 3300005353 Bacteria 18380
42 Ga0070675_100023729 3300005354 Bacteria 4907
43 Ga0070671_100011547 3300005355 Bacteria 7103
44 Ga0070671_100053980 3300005355 Bacteria 3340
45 Ga0070674_100136635 3300005356 Bacteria 1834
46 Ga0070673_100002892 3300005364 Bacteria 10570
47 Ga0070673_100006497 3300005364 Bacteria 7603
48 Ga0070659_100000905 3300005366 Bacteria 21696
49 Ga0070659_100007487 3300005366 Bacteria 7931
50 Ga0070659_100018346 3300005366 Bacteria 5281
51 Ga0070659_100026646 3300005366 Bacteria 4449
52 Ga0070667_100001306 3300005367 Bacteria 22448
53 Ga0070667_100032878 3300005367 Bacteria 4329
54 Ga0070667_100045012 3300005367 Bacteria 3709
55 Ga0070667_100057914 3300005367 Bacteria 3276
56 Ga0070710_10266724 3300005437 Bacteria 1106
57 Ga0070694_100023666 3300005444 Bacteria 3954
58 Ga0070663_100000364 3300005455 Bacteria 23779
59 Ga0070663_100014152 3300005455 Bacteria 5113
60 Ga0070678_100222315 3300005456 Bacteria 1570
61 Ga0070678_100282108 3300005456 Bacteria 1405
62 Ga0070678_100344653 3300005456 Bacteria 1279
63 Ga0070678_100759843 3300005456 Bacteria 877
64 Ga0070662_100000024 3300005457 Bacteria 91042
65 Ga0070662_100008459 3300005457 Bacteria 6711
66 Ga0070662_100126569 3300005457 Bacteria 1964
67 Ga0070662_100237183 3300005457 Bacteria 1461
68 Ga0070681_10371208 3300005458 Bacteria 1341
69 Ga0068867_100005599 3300005459 Bacteria 8900
70 Ga0068867_100333078 3300005459 Bacteria 1261
71 Ga0070685_10292685 3300005466 Bacteria 1094
72 Ga0070706_100363772 3300005467 Bacteria 1348
73 Ga0070684_100011221 3300005535 Bacteria 7133
74 Ga0068853_100000033 3300005539 Bacteria 113700
75 Ga0068853_100002144 3300005539 Bacteria 14696
76 Ga0068853_100069451 3300005539 Bacteria 3065
77 Ga0068853_100752549 3300005539 Bacteria 931
78 Ga0070672_100041818 3300005543 Bacteria 3526
79 Ga0070695_100037844 3300005545 Bacteria 3042
80 Ga0070696_100010269 3300005546 Bacteria 6266
81 Ga0070693_100010106 3300005547 Bacteria 4713
82 Ga0070665_100008391 3300005548 Bacteria 10449
83 Ga0070665_100013578 3300005548 Bacteria 8193
84 Ga0068855_100002638 3300005563 Bacteria 22114
85 Ga0068855_100007208 3300005563 Bacteria 13495
86 Ga0068855_100273244 3300005563 Bacteria 1879
87 Ga0068855_100356261 3300005563 Bacteria 1611
88 Ga0070664_100002469 3300005564 Bacteria 14893
89 Ga0070664_100003398 3300005564 Bacteria 12850
90 Ga0070664_100005430 3300005564 Bacteria 10232
91 Ga0070664_100027853 3300005564 Bacteria 4698
92 Ga0070664_100116729 3300005564 Bacteria 2334
93 Ga0070664_100293397 3300005564 Bacteria 1468
94 Ga0068857_100001517 3300005577 Bacteria 18537
95 Ga0068857_100132691 3300005577 Bacteria 2247
96 Ga0068854_100002372 3300005578 Bacteria 11621
97 Ga0068854_100008221 3300005578 Bacteria 6697
98 Ga0068854_100134249 3300005578 Bacteria 1893
99 Ga0068856_100000744 3300005614 Bacteria 35290
100 Ga0068852_100000442 3300005616 Bacteria 27467
101 Ga0068852_100000461 3300005616 Bacteria 26890
102 Ga0068852_100029627 3300005616 Bacteria 4499
103 Ga0068852_100069523 3300005616 Bacteria 3087
104 Ga0068859_100008534 3300005617 Bacteria 10365
105 Ga0068864_100020883 3300005618 Bacteria 5481
106 Ga0068864_100041312 3300005618 Bacteria 3944
107 Ga0068864_100221659 3300005618 Bacteria 1745
108 Ga0068861_100000052 3300005719 Bacteria 54577
109 Ga0068861_100255597 3300005719 Bacteria 1497
110 Ga0068851_10001361 3300005834 Bacteria 10657
111 Ga0068870_10158690 3300005840 Bacteria 1339
112 Ga0068863_100008185 3300005841 Bacteria 10213
113 Ga0068863_100071717 3300005841 Bacteria 3277
114 Ga0068863_100774285 3300005841 Bacteria 956
115 Ga0068863_100960854 3300005841 Bacteria 856
116 Ga0068858_100006550 3300005842 Bacteria 11324
117 Ga0068860_100003073 3300005843 Bacteria 17251
118 Ga0068860_100040673 3300005843 Bacteria 4442
119 Ga0068862_100004859 3300005844 Bacteria 11313
120 Ga0068862_100027600 3300005844 Bacteria 4779
121 Ga0068862_100084073 3300005844 Bacteria 2765
122 Ga0068862_100084973 3300005844 Bacteria 2749
123 Ga0068862_100140315 3300005844 Bacteria 2144
124 Ga0097621_100010978 3300006237 Bacteria 6653
125 Ga0097621_100011026 3300006237 Bacteria 6642
126 Ga0097621_100081580 3300006237 Bacteria 2692
127 Ga0068871_100017644 3300006358 Bacteria 5405
128 Ga0068871_100115128 3300006358 Bacteria 2266
129 Ga0097620_100008534 3300006931 Bacteria 10365
130 Ga0097620_100050361 3300006931 Bacteria 4184
131 Ga0111539_10077698 3300009094 Bacteria 3906
132 Ga0105245_10001667 3300009098 Bacteria 20219
133 Ga0105241_10046959 3300009174 Bacteria 3281
134 Ga0105241_10078915 3300009174 Bacteria 2573
135 Ga0105248_10000059 3300009177 Bacteria 137176
136 Ga0105248_10001577 3300009177 Bacteria 25361
137 Ga0105248_10006863 3300009177 Bacteria 12484
138 Ga0105249_10070136 3300009553 Bacteria 3235
139 Ga0105249_10330176 3300009553 Bacteria 1539
140 Ga0105239_10200219 3300010375 Bacteria 2237
141 Ga0105246_10041355 3300011119 Bacteria 3115
142 Ga0157373_10009357 3300013100 Bacteria 7241
143 Ga0157373_10023013 3300013100 Bacteria 4519
144 Ga0157371_10001377 3300013102 Bacteria 25491
145 Ga0157371_10003770 3300013102 Bacteria 13565
146 Ga0157371_10015137 3300013102 Bacteria 5797
147 Ga0157371_10022992 3300013102 Bacteria 4558
148 Ga0157371_10062968 3300013102 Bacteria 2629
149 Ga0157369_10001177 3300013105 Bacteria 32602
150 Ga0157369_10090451 3300013105 Bacteria 3268
151 Ga0157369_10309951 3300013105 Bacteria 1641
152 Ga0157378_10001776 3300013297 Bacteria 19365
153 Ga0163162_10084572 3300013306 Bacteria 3248
154 Ga0163162_10149227 3300013306 Bacteria 2455
155 Ga0157372_10093124 3300013307 Bacteria 3429
156 Ga0157372_10103884 3300013307 Bacteria 3247
157 Ga0157372_10180055 3300013307 Bacteria 2446
158 Ga0157372_10652391 3300013307 Bacteria 1226
159 Ga0157375_10044850 3300013308 Bacteria 4300
160 Ga0157375_10702178 3300013308 Bacteria 1165
161 Ga0163163_10001821 3300014325 Bacteria 18002
162 Ga0157377_10027692 3300014745 Bacteria 3045
163 Ga0157376_10885241 3300014969 Unclassified 910
164 Ga0209050_1000010 3300025298 Bacteria 980454
165 Ga0209257_1000009 3300025304 Bacteria 1205047
166 Ga0207697_10001060 3300025315 Bacteria 15193
167 Ga0207656_10004644 3300025321 Bacteria 4814
168 Ga0207642_10037955 3300025899 Bacteria 2080
169 Ga0207688_10020925 3300025901 Bacteria 3571
170 Ga0207680_10001930 3300025903 Bacteria 9727
171 Ga0207680_10012828 3300025903 Bacteria 4281
172 Ga0207680_10034999 3300025903 Bacteria 2879
173 Ga0207647_10000153 3300025904 Bacteria 54496
174 Ga0207647_10015502 3300025904 Bacteria 5222
175 Ga0207647_10082620 3300025904 Bacteria 1924
176 Ga0207645_10003786 3300025907 Bacteria 11356
177 Ga0207645_10120319 3300025907 Bacteria 1704
178 Ga0207705_10000062 3300025909 Bacteria 149432
179 Ga0207705_10015098 3300025909 Bacteria 5553
180 Ga0207705_10041020 3300025909 Bacteria 3320
181 Ga0207654_10042466 3300025911 Bacteria 2573
182 Ga0207707_10322537 3300025912 Bacteria 1333
183 Ga0207695_10580617 3300025913 Unclassified 1002
184 Ga0207660_10005888 3300025917 Bacteria 7963
185 Ga0207660_10137903 3300025917 Bacteria 1863
186 Ga0207657_10000015 3300025919 Bacteria 175776
187 Ga0207657_10002109 3300025919 Bacteria 21508
188 Ga0207657_10010444 3300025919 Bacteria 9266
189 Ga0207657_10017043 3300025919 Bacteria 6987
190 Ga0207657_10042191 3300025919 Bacteria 4027
191 Ga0207649_10000264 3300025920 Bacteria 41423
192 Ga0207649_10021606 3300025920 Bacteria 3708
193 Ga0207649_10056789 3300025920 Bacteria 2445
194 Ga0207649_10124521 3300025920 Bacteria 1742
195 Ga0207681_10009549 3300025923 Bacteria 5927
196 Ga0207650_10008755 3300025925 Bacteria 6914
197 Ga0207650_10016864 3300025925 Bacteria 5109
198 Ga0207650_10017927 3300025925 Bacteria 4961
199 Ga0207650_10033450 3300025925 Bacteria 3723
200 Ga0207659_10015140 3300025926 Bacteria 4990
201 Ga0207687_10009029 3300025927 Bacteria 6515
202 Ga0207664_10536076 3300025929 Bacteria 1049
203 Ga0207644_10201300 3300025931 Bacteria 1571
204 Ga0207690_10000032 3300025932 Bacteria 152479
205 Ga0207690_10130569 3300025932 Bacteria 1838
206 Ga0207690_10259771 3300025932 Bacteria 1345
207 Ga0207690_10622399 3300025932 Unclassified 883
208 Ga0207706_10000032 3300025933 Bacteria 142723
209 Ga0207706_10000194 3300025933 Bacteria 67452
210 Ga0207706_10003797 3300025933 Bacteria 14399
211 Ga0207706_10008916 3300025933 Bacteria 9232
212 Ga0207704_10013574 3300025938 Bacteria 4082
213 Ga0207691_10002330 3300025940 Bacteria 18590
214 Ga0207691_10054017 3300025940 Bacteria 3665
215 Ga0207711_10000476 3300025941 Bacteria 41373
216 Ga0207711_10038127 3300025941 Bacteria 4086
217 Ga0207689_10000094 3300025942 Bacteria 71733
218 Ga0207679_10000466 3300025945 Bacteria 28495
219 Ga0207679_10006436 3300025945 Bacteria 7420
220 Ga0207679_10110803 3300025945 Bacteria 2166
221 Ga0207679_10242479 3300025945 Bacteria 1528
222 Ga0207667_10054271 3300025949 Bacteria 4215
223 Ga0207667_10064707 3300025949 Bacteria 3816
224 Ga0207667_10077422 3300025949 Bacteria 3449
225 Ga0207651_10002269 3300025960 Bacteria 9129
226 Ga0207651_10548111 3300025960 Bacteria 1005
227 Ga0207712_10210974 3300025961 Bacteria 1546
228 Ga0207668_10021750 3300025972 Bacteria 4094
229 Ga0207640_10009447 3300025981 Bacteria 5463
230 Ga0207640_10230149 3300025981 Bacteria 1425
231 Ga0207658_10006238 3300025986 Bacteria 8145
232 Ga0207658_10009321 3300025986 Bacteria 6656
233 Ga0207658_10036535 3300025986 Bacteria 3522
234 Ga0207658_10053301 3300025986 Bacteria 2988
235 Ga0207658_10056796 3300025986 Bacteria 2906
236 Ga0207658_10183972 3300025986 Bacteria 1731
237 Ga0207677_10004013 3300026023 Bacteria 7853
238 Ga0207703_10007116 3300026035 Bacteria 8903
239 Ga0207639_10000410 3300026041 Bacteria 29670
240 Ga0207639_10028866 3300026041 Bacteria 4055
241 Ga0207639_10129161 3300026041 Bacteria 2089
242 Ga0207678_10000913 3300026067 Bacteria 27026
243 Ga0207678_10004123 3300026067 Bacteria 13060
244 Ga0207678_10032408 3300026067 Bacteria 4554
245 Ga0207678_10034705 3300026067 Bacteria 4393
246 Ga0207678_10273997 3300026067 Bacteria 1447
247 Ga0207702_10000072 3300026078 Bacteria 113840
248 Ga0207702_10055593 3300026078 Bacteria 3357
249 Ga0207641_10053707 3300026088 Bacteria 3416
250 Ga0207641_10119863 3300026088 Bacteria 2346
251 Ga0207641_10168243 3300026088 Bacteria 1998
252 Ga0207648_10000104 3300026089 Bacteria 81717
253 Ga0207648_10114550 3300026089 Bacteria 2369
254 Ga0207676_10010419 3300026095 Bacteria 6617
255 Ga0207676_10017558 3300026095 Bacteria 5188
256 Ga0207676_10038228 3300026095 Bacteria 3661
257 Ga0207674_10000345 3300026116 Bacteria 59803
258 Ga0207674_10002883 3300026116 Bacteria 21374
259 Ga0207675_100000035 3300026118 Bacteria 95190
260 Ga0207675_100256521 3300026118 Bacteria 1694
261 Ga0207675_100510713 3300026118 Bacteria 1197
262 Ga0207683_10088857 3300026121 Bacteria 2750
263 Ga0207683_10100367 3300026121 Bacteria 2584
264 Ga0207683_10160078 3300026121 Bacteria 2035
265 Ga0207683_10405031 3300026121 Bacteria 1255
266 Ga0207698_10010338 3300026142 Bacteria 5987
267 Ga0207698_10021552 3300026142 Bacteria 4460
268 Ga0268266_10070840 3300028379 Bacteria 3021
269 Ga0268266_10211986 3300028379 Unclassified 1777
270 Ga0268266_10286717 3300028379 Bacteria 1532
271 Ga0268265_10001444 3300028380 Bacteria 20029
272 Ga0268265_10003173 3300028380 Bacteria 11949
273 Ga0268265_10003458 3300028380 Bacteria 11353
274 Ga0268264_10038888 3300028381 Bacteria 3928
275 Ga0268264_10042922 3300028381 Bacteria 3745
276 Ga0307513_10339324 3300031456 Bacteria 1254
277 Ga0307413_10002997 3300031824 Bacteria 7002
278 Ga0307410_10071463 3300031852 Bacteria 2407
279 Ga0307410_10234940 3300031852 Bacteria 1417
280 Ga0307409_100428682 3300031995 Bacteria 1270
281 Ga0307411_10021132 3300032005 Bacteria 3801
282 Ga0373950_0015342 3300034818 Bacteria 1298
283 Ga0373959_0012551 3300034820 Unclassified 1515
284 Ga0373931_0349427 3300035691 Bacteria 925
285 Ga0395899_0061377 3300037312 Bacteria 2769
286 Ga0395899_0119567 3300037312 Bacteria 1888
287 Ga0395899_0276976 3300037312 Bacteria 1142
288 Ga0395900_0037519 3300037418 Bacteria 4995
289 Ga0395900_0038911 3300037418 Bacteria 4902
290 Ga0395900_0055889 3300037418 Bacteria 4064
291 Ga0395900_0163233 3300037418 Bacteria 2271
292 Ga0395900_0191801 3300037418 Bacteria 2072
293 Ga0395900_0194889 3300037418 Bacteria 2053
294 Ga0395900_0284816 3300037418 Bacteria 1643
295 Ga0395900_0366782 3300037418 Bacteria 1410
296 Ga0395898_0213545 3300037466 Bacteria 1840
297 Ga0395898_0305878 3300037466 Bacteria 1516
298 Ga0395898_0328524 3300037466 Bacteria 1458
299 Ga0395898_0603277 3300037466 Unclassified 1040
300 Ga0395905_0014513 3300037471 Bacteria 7517
301 Ga0395905_0035197 3300037471 Bacteria 4702
302 Ga0395905_0050664 3300037471 Bacteria 3889
303 Ga0395905_0152909 3300037471 Bacteria 2170
304 Ga0395905_0262982 3300037471 Bacteria 1610
305 Ga0395901_0042520 3300038443 Bacteria 4711
306 Ga0395901_0115339 3300038443 Bacteria 2821
307 Ga0395901_0154930 3300038443 Bacteria 2407
308 Ga0395901_0225700 3300038443 Bacteria 1957
309 Ga0439436_0015190 3300041404 Bacteria 2317
310 Ga0450917_000725 3300042120 Bacteria 2431
311 Ga0450903_015902 3300042138 Bacteria 1183
312 Ga0450905_000818 3300042142 Bacteria 3861
313 Ga0450889_000253 3300042144 Bacteria 5930
314 Ga0439458_0038294 3300042157 Bacteria 1158
315 Ga0466972_0065499 3300044658 Bacteria 1738
316 Ga0466972_0171080 3300044658 Bacteria 1020
317 Ga0466972_0223190 3300044658 Unclassified 882
318 Ga0466961_0027441 3300044693 Bacteria 3662
319 Ga0466963_0006612 3300044694 Bacteria 6876
320 Ga0466963_0131505 3300044694 Bacteria 1729
321 Ga0466971_0100939 3300044719 Bacteria 1326
322 Ga0466970_0013852 3300044765 Bacteria 4137
323 Ga0466970_0156343 3300044765 Bacteria 1260
324 Ga0466957_0056627 3300044842 Bacteria 2398
325 Ga0466957_0319882 3300044842 Bacteria 1047
326 Ga0466959_0128169 3300045049 Bacteria 1800
327 Ga0466958_0007241 3300045836 Bacteria 6085
328 Ga0466967_0007359 3300045976 Bacteria 7931
329 Ga0466967_0197197 3300045976 Bacteria 1905
330 Ga0466967_0604951 3300045976 Bacteria 1082
331 Ga0495648_0198093 3300046524 Bacteria 1008
332 Ga0495668_0158085 3300046616 Bacteria 1241
333 Ga0495677_0005616 3300047445 Bacteria 4754
334 Ga0496101_0018917 3300048904 Bacteria 4692
335 Ga0496101_0034477 3300048904 Bacteria 3575
336 Ga0496105_0405245 3300048908 Bacteria 1082
337 Ga0496109_0512806 3300048912 Bacteria 1132
338 Ga0496110_0044062 3300048913 Bacteria 3896
339 Ga0496110_0182960 3300048913 Bacteria 1903
340 Ga0496112_0025671 3300048915 Bacteria 5660
341 Ga0496114_0047006 3300048917 Bacteria 3588
342 Ga0496115_0000571 3300048918 Bacteria 28486
343 nmdc:mga08y16_18229_c1 3300050511 Bacteria 7396
344 Ga0500658_0000133 3300053134 Bacteria 35167
345 Ga0068859_100050360
346 JGI24740J21852_10010606
347 JGI24739J22299_10000252
348 JGI24739J22299_10001972
349 JGI24737J22298_10001703
350 JGI24737J22298_10001807
351 JGI24738J21930_10001019
352 JGI24738J21930_10006483
353 rootL2_10012722
354 Ga0055530_10000623
355 Ga0055531_10000619
356 Ga0070658_10002556
357 Ga0070658_10034969
358 Ga0070658_10207568
359 Ga0070658_10237148
360 Ga0070676_10010296
361 Ga0070683_100029236
362 Ga0070670_100014557
363 Ga0070670_100021062
364 Ga0070670_100024563
365 Ga0070670_100031408
366 Ga0070677_10072922
367 Ga0068869_100030466
368 Ga0068869_100137640
369 Ga0068869_100394514
370 Ga0070666_10000346
371 Ga0070666_10003796
372 Ga0070682_100018027
373 Ga0070682_100078749
374 Ga0068868_100001893
375 Ga0068868_100191943
376 Ga0070660_100000350
377 Ga0070660_100006064
378 Ga0070660_100014062
379 Ga0070660_100058764
380 Ga0070689_100075409
381 Ga0070661_100000536
382 Ga0070661_100012197
383 Ga0070661_100020387
384 Ga0070668_100099724
385 Ga0070669_100001260
386 Ga0070675_100023729
387 Ga0070671_100011547
388 Ga0070671_100053980
389 Ga0070674_100136635
390 Ga0070673_100002892
391 Ga0070673_100006497
392 Ga0070659_100000905
393 Ga0070659_100007487
394 Ga0070659_100018346
395 Ga0070659_100026646
396 Ga0070667_100001306
397 Ga0070667_100032878
398 Ga0070667_100045012
399 Ga0070667_100057914
400 Ga0070710_10266724
401 Ga0070694_100023666
402 Ga0070663_100000364
403 Ga0070663_100014152
404 Ga0070678_100222315
405 Ga0070678_100282108
406 Ga0070678_100344653
407 Ga0070678_100759843
408 Ga0070662_100000024
409 Ga0070662_100008459
410 Ga0070662_100126569
411 Ga0070662_100237183
412 Ga0070681_10371208
413 Ga0068867_100005599
414 Ga0068867_100333078
415 Ga0070685_10292685
416 Ga0070706_100363772
417 Ga0070684_100011221
418 Ga0068853_100000033
419 Ga0068853_100002144
420 Ga0068853_100069451
421 Ga0068853_100752549
422 Ga0070672_100041818
423 Ga0070695_100037844
424 Ga0070696_100010269
425 Ga0070693_100010106
426 Ga0070665_100008391
427 Ga0070665_100013578
428 Ga0068855_100002638
429 Ga0068855_100007208
430 Ga0068855_100273244
431 Ga0068855_100356261
432 Ga0070664_100002469
433 Ga0070664_100003398
434 Ga0070664_100005430
435 Ga0070664_100027853
436 Ga0070664_100116729
437 Ga0070664_100293397
438 Ga0068857_100001517
439 Ga0068857_100132691
440 Ga0068854_100002372
441 Ga0068854_100008221
442 Ga0068854_100134249
443 Ga0068856_100000744
444 Ga0068852_100000442
445 Ga0068852_100000461
446 Ga0068852_100029627
447 Ga0068852_100069523
448 Ga0068859_100008534
449 Ga0068864_100020883
450 Ga0068864_100041312
451 Ga0068864_100221659
452 Ga0068861_100000052
453 Ga0068861_100255597
454 Ga0068851_10001361
455 Ga0068870_10158690
456 Ga0068863_100008185
457 Ga0068863_100071717
458 Ga0068863_100774285
459 Ga0068863_100960854
460 Ga0068858_100006550
461 Ga0068860_100003073
462 Ga0068860_100040673
463 Ga0068862_100004859
464 Ga0068862_100027600
465 Ga0068862_100084073
466 Ga0068862_100084973
467 Ga0068862_100140315
468 Ga0097621_100010978
469 Ga0097621_100011026
470 Ga0097621_100081580
471 Ga0068871_100017644
472 Ga0068871_100115128
473 Ga0097620_100008534
474 Ga0097620_100050361
475 Ga0111539_10077698
476 Ga0105245_10001667
477 Ga0105241_10046959
478 Ga0105241_10078915
479 Ga0105248_10000059
480 Ga0105248_10001577
481 Ga0105248_10006863
482 Ga0105249_10070136
483 Ga0105249_10330176
484 Ga0105239_10200219
485 Ga0105246_10041355
486 Ga0157373_10009357
487 Ga0157373_10023013
488 Ga0157371_10001377
489 Ga0157371_10003770
490 Ga0157371_10015137
491 Ga0157371_10022992
492 Ga0157371_10062968
493 Ga0157369_10001177
494 Ga0157369_10090451
495 Ga0157369_10309951
496 Ga0157378_10001776
497 Ga0163162_10084572
498 Ga0163162_10149227
499 Ga0157372_10093124
500 Ga0157372_10103884
501 Ga0157372_10180055
502 Ga0157372_10652391
503 Ga0157375_10044850
504 Ga0157375_10702178
505 Ga0163163_10001821
506 Ga0157377_10027692
507 Ga0157376_10885241
508 Ga0209050_1000010
509 Ga0209257_1000009
510 Ga0207697_10001060
511 Ga0207656_10004644
512 Ga0207642_10037955
513 Ga0207688_10020925
514 Ga0207680_10001930
515 Ga0207680_10012828
516 Ga0207680_10034999
517 Ga0207647_10000153
518 Ga0207647_10015502
519 Ga0207647_10082620
520 Ga0207645_10003786
521 Ga0207645_10120319
522 Ga0207705_10000062
523 Ga0207705_10015098
524 Ga0207705_10041020
525 Ga0207654_10042466
526 Ga0207707_10322537
527 Ga0207695_10580617
528 Ga0207660_10005888
529 Ga0207660_10137903
530 Ga0207657_10000015
531 Ga0207657_10002109
532 Ga0207657_10010444
533 Ga0207657_10017043
534 Ga0207657_10042191
535 Ga0207649_10000264
536 Ga0207649_10021606
537 Ga0207649_10056789
538 Ga0207649_10124521
539 Ga0207681_10009549
540 Ga0207650_10008755
541 Ga0207650_10016864
542 Ga0207650_10017927
543 Ga0207650_10033450
544 Ga0207659_10015140
545 Ga0207687_10009029
546 Ga0207664_10536076
547 Ga0207644_10201300
548 Ga0207690_10000032
549 Ga0207690_10130569
550 Ga0207690_10259771
551 Ga0207690_10622399
552 Ga0207706_10000032
553 Ga0207706_10000194
554 Ga0207706_10003797
555 Ga0207706_10008916
556 Ga0207704_10013574
557 Ga0207691_10002330
558 Ga0207691_10054017
559 Ga0207711_10000476
560 Ga0207711_10038127
561 Ga0207689_10000094
562 Ga0207679_10000466
563 Ga0207679_10006436
564 Ga0207679_10110803
565 Ga0207679_10242479
566 Ga0207667_10054271
567 Ga0207667_10064707
568 Ga0207667_10077422
569 Ga0207651_10002269
570 Ga0207651_10548111
571 Ga0207712_10210974
572 Ga0207668_10021750
573 Ga0207640_10009447
574 Ga0207640_10230149
575 Ga0207658_10006238
576 Ga0207658_10009321
577 Ga0207658_10036535
578 Ga0207658_10053301
579 Ga0207658_10056796
580 Ga0207658_10183972
581 Ga0207677_10004013
582 Ga0207703_10007116
583 Ga0207639_10000410
584 Ga0207639_10028866
585 Ga0207639_10129161
586 Ga0207678_10000913
587 Ga0207678_10004123
588 Ga0207678_10032408
589 Ga0207678_10034705
590 Ga0207678_10273997
591 Ga0207702_10000072
592 Ga0207702_10055593
593 Ga0207641_10053707
594 Ga0207641_10119863
595 Ga0207641_10168243
596 Ga0207648_10000104
597 Ga0207648_10114550
598 Ga0207676_10010419
599 Ga0207676_10017558
600 Ga0207676_10038228
601 Ga0207674_10000345
602 Ga0207674_10002883
603 Ga0207675_100000035
604 Ga0207675_100256521
605 Ga0207675_100510713
606 Ga0207683_10088857
607 Ga0207683_10100367
608 Ga0207683_10160078
609 Ga0207683_10405031
610 Ga0207698_10010338
611 Ga0207698_10021552
612 Ga0268266_10070840
613 Ga0268266_10211986
614 Ga0268266_10286717
615 Ga0268265_10001444
616 Ga0268265_10003173
617 Ga0268265_10003458
618 Ga0268264_10038888
619 Ga0268264_10042922
620 Ga0307513_10339324
621 Ga0307413_10002997
622 Ga0307410_10071463
623 Ga0307410_10234940
624 Ga0307409_100428682
625 Ga0307411_10021132
626 Ga0373950_0015342
627 Ga0373959_0012551
628 Ga0373931_0349427
629 Ga0395899_0061377
630 Ga0395899_0119567
631 Ga0395899_0276976
632 Ga0395900_0037519
633 Ga0395900_0038911
634 Ga0395900_0055889
635 Ga0395900_0163233
636 Ga0395900_0191801
637 Ga0395900_0194889
638 Ga0395900_0284816
639 Ga0395900_0366782
640 Ga0395898_0213545
641 Ga0395898_0305878
642 Ga0395898_0328524
643 Ga0395898_0603277
644 Ga0395905_0014513
645 Ga0395905_0035197
646 Ga0395905_0050664
647 Ga0395905_0152909
648 Ga0395905_0262982
649 Ga0395901_0042520
650 Ga0395901_0115339
651 Ga0395901_0154930
652 Ga0395901_0225700
653 Ga0439436_0015190
654 Ga0450917_000725
655 Ga0450903_015902
656 Ga0450905_000818
657 Ga0450889_000253
658 Ga0439458_0038294
659 Ga0466972_0065499
660 Ga0466972_0171080
661 Ga0466972_0223190
662 Ga0466961_0027441
663 Ga0466963_0006612
664 Ga0466963_0131505
665 Ga0466971_0100939
666 Ga0466970_0013852
667 Ga0466970_0156343
668 Ga0466957_0056627
669 Ga0466957_0319882
670 Ga0466959_0128169
671 Ga0466958_0007241
672 Ga0466967_0007359
673 Ga0466967_0197197
674 Ga0466967_0604951
675 Ga0495648_0198093
676 Ga0495668_0158085
677 Ga0495677_0005616
678 Ga0496101_0018917
679 Ga0496101_0034477
680 Ga0496105_0405245
681 Ga0496109_0512806
682 Ga0496110_0044062
683 Ga0496110_0182960
684 Ga0496112_0025671
685 Ga0496114_0047006
686 Ga0496115_0000571
687 nmdc:mga08y16_18229_c1
688 Ga0500658_0000133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02237

BPL_C

Biotin protein ligase C terminal domain

176

218

0.91

PF16917

BPL_LplA_LipB_2

Biotin/lipoate A/B protein ligase family

40

165

0.9

PF03099

BPL_LplA_LipB

Biotin/lipoate A/B protein ligase family

7

110

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tse-assembly3.cif.gz_A crystal structure of the mib repeat domain of mind bomb 1 0.8932 191 216
4tse-assembly3.cif.gz_B crystal structure of the mib repeat domain of mind bomb 1 0.8894 191 216
4xu2-assembly1.cif.gz_A mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 87 with a 3'deoxy ribose 0.878 1 219
4xtw-assembly1.cif.gz_A mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh 0.8757 1 219
3efs-assembly2.cif.gz_B biotin protein ligase from aquifex aeolicus in complex with biotin and atp 0.87 2 219
ID Description Score Start End Superfamily
af_Q4DXV2_4_197_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8924 2 172 3.30.930.10
af_A4I6N1_2_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8763 2 172 3.30.930.10
2dxuB02 Mainly Beta;Roll;SH3 type barrels.; 0.8661 176 216 2.30.30.100
4xtuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8549 1 175 3.30.930.10
2dxuB02 Mainly Beta;Roll;SH3 type barrels.; 0.8442 176 216 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A0P7ZS27-F1-model_v4 Bifunctional biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase BirA 0.9451 2 139 GO:0004077
GO:0005737
GO:0036211
AF-A0A0H4VYJ2-F1-model_v4 BPL/LPL catalytic domain-containing protein 0.9445 3 219 GO:0004077
GO:0005737
GO:0036211
AF-A0A838VC91-F1-model_v4 Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) 0.9396 3 152 GO:0004077
GO:0005737
GO:0036211
AF-A0A520D5R3-F1-model_v4 deleted 0.9394 1 139
AF-A0A6G7YTQ0-F1-model_v4 biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) 0.9382 1 219 GO:0004077
GO:0005737
GO:0036211

Map