F415893

General Info

Members Datasets Scaffolds Average Seq Length
344 207 688 154

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100413441|Ga0068863_1004134412
Length 155
Sequence MKLTTKGRFAVTAMLDLALHNAQGPVALAGISERQKISLSYLEQLFGKLRRRELVESVRGPGGGYNLARDASRVSIADIIRAVEEPLDSTQCGGRENCHGNNQRCMTHDLWEELNTTVQGFLSGVMLSQLVEKQRTRAVAIHRAPKARDTHPLSA

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
132 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
207 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.7
Metatranscriptomes 8.72
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.49
Nodule 0
Rhizoplane 0.29
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100413441 3300005841 Bacteria 1321
2 Ga0070676_10333195 3300005328 Bacteria 1038
3 Ga0070690_100578901 3300005330 Bacteria 850
4 Ga0070690_101521513 3300005330 Bacteria 541
5 Ga0070670_100666602 3300005331 Bacteria 934
6 Ga0068869_100570701 3300005334 Bacteria 953
7 Ga0068868_100329467 3300005338 Bacteria 1303
8 Ga0068868_100806814 3300005338 Bacteria 847
9 Ga0070689_100012797 3300005340 Bacteria 6056
10 Ga0070689_100117901 3300005340 Bacteria 2118
11 Ga0070689_100341792 3300005340 Bacteria 1253
12 Ga0070687_100501659 3300005343 Bacteria 817
13 Ga0070661_101029374 3300005344 Bacteria 684
14 Ga0070669_100024733 3300005353 Bacteria 4308
15 Ga0070675_100004581 3300005354 Bacteria 10556
16 Ga0070674_100010839 3300005356 Bacteria 5528
17 Ga0070674_100239103 3300005356 Bacteria 1421
18 Ga0070674_100992082 3300005356 Bacteria 736
19 Ga0070673_100072413 3300005364 Bacteria 2771
20 Ga0070673_100117215 3300005364 Bacteria 2216
21 Ga0070673_100780753 3300005364 Bacteria 881
22 Ga0070673_100851428 3300005364 Bacteria 844
23 Ga0070688_100051933 3300005365 Bacteria 2559
24 Ga0070688_100391333 3300005365 Bacteria 1027
25 Ga0070710_11171827 3300005437 Bacteria 567
26 Ga0070711_100353724 3300005439 Bacteria 1182
27 Ga0070700_100256164 3300005441 Bacteria 1258
28 Ga0070694_101059937 3300005444 Bacteria 675
29 Ga0070678_100688779 3300005456 Bacteria 920
30 Ga0070662_101233386 3300005457 Bacteria 643
31 Ga0068867_100098689 3300005459 Bacteria 2227
32 Ga0068867_100145851 3300005459 Bacteria 1855
33 Ga0070685_10013293 3300005466 Bacteria 4339
34 Ga0068853_100067306 3300005539 Bacteria 3111
35 Ga0068853_100419388 3300005539 Bacteria 1255
36 Ga0070672_100085984 3300005543 Bacteria 2528
37 Ga0070672_100784122 3300005543 Bacteria 838
38 Ga0070686_100457256 3300005544 Bacteria 983
39 Ga0070696_100072638 3300005546 Bacteria 2423
40 Ga0070696_100337218 3300005546 Bacteria 1164
41 Ga0070693_100005048 3300005547 Bacteria 6304
42 Ga0070693_100049529 3300005547 Bacteria 2397
43 Ga0070693_100201879 3300005547 Bacteria 1292
44 Ga0070704_100133469 3300005549 Bacteria 1928
45 Ga0068857_100067139 3300005577 Bacteria 3192
46 Ga0068854_100289874 3300005578 Bacteria 1321
47 Ga0068856_100001616 3300005614 Bacteria 23579
48 Ga0068856_100807201 3300005614 Bacteria 958
49 Ga0070702_100328396 3300005615 Bacteria 1069
50 Ga0068852_100062107 3300005616 Bacteria 3248
51 Ga0068852_100138394 3300005616 Bacteria 2250
52 Ga0068852_100798659 3300005616 Bacteria 958
53 Ga0068859_100104816 3300005617 Bacteria 2887
54 Ga0068859_100160266 3300005617 Bacteria 2329
55 Ga0068859_101118683 3300005617 Bacteria 867
56 Ga0068859_101227855 3300005617 Bacteria 826
57 Ga0068859_102274962 3300005617 Bacteria 598
58 Ga0068864_100772573 3300005618 Bacteria 943
59 Ga0068864_101611866 3300005618 Bacteria 653
60 Ga0068866_10683775 3300005718 Bacteria 702
61 Ga0068861_100817325 3300005719 Bacteria 876
62 Ga0068851_10566421 3300005834 Bacteria 688
63 Ga0068858_100007075 3300005842 Bacteria 10889
64 Ga0068858_100032725 3300005842 Bacteria 4828
65 Ga0068858_100638875 3300005842 Bacteria 1034
66 Ga0068858_101383260 3300005842 Bacteria 693
67 Ga0068860_100721179 3300005843 Bacteria 1008
68 Ga0068862_101494407 3300005844 Bacteria 681
69 Ga0070717_10136914 3300006028 Bacteria 2110
70 Ga0075364_10254363 3300006051 Bacteria 1194
71 Ga0075364_10938385 3300006051 Bacteria 589
72 Ga0070715_10224614 3300006163 Bacteria 967
73 Ga0070712_100126976 3300006175 Bacteria 1928
74 Ga0075367_10293456 3300006178 Bacteria 1023
75 Ga0075367_10508929 3300006178 Bacteria 764
76 Ga0075366_10020010 3300006195 Bacteria 3880
77 Ga0075366_10064367 3300006195 Bacteria 2181
78 Ga0097621_100033241 3300006237 Bacteria 4105
79 Ga0097621_100177443 3300006237 Bacteria 1839
80 Ga0097621_100822601 3300006237 Bacteria 861
81 Ga0075370_10164197 3300006353 Bacteria 1304
82 Ga0068871_100006498 3300006358 Bacteria 8277
83 Ga0068871_100305025 3300006358 Bacteria 1398
84 Ga0068871_100338816 3300006358 Bacteria 1327
85 Ga0075428_100009835 3300006844 Bacteria 10629
86 Ga0068865_100010302 3300006881 Bacteria 5814
87 Ga0068865_100423022 3300006881 Bacteria 1096
88 Ga0075436_100332642 3300006914 Bacteria 1093
89 Ga0097620_100104800 3300006931 Bacteria 2887
90 Ga0097620_100160267 3300006931 Bacteria 2329
91 Ga0097620_101118639 3300006931 Bacteria 867
92 Ga0097620_101227801 3300006931 Bacteria 826
93 Ga0097620_102274280 3300006931 Bacteria 598
94 Ga0111539_10001926 3300009094 Bacteria 27651
95 Ga0111539_11468504 3300009094 Bacteria 791
96 Ga0105245_10259313 3300009098 Bacteria 1691
97 Ga0105245_10274903 3300009098 Bacteria 1644
98 Ga0105245_10278058 3300009098 Bacteria 1635
99 Ga0105245_10386947 3300009098 Bacteria 1394
100 Ga0114129_10766623 3300009147 Bacteria 1234
101 Ga0105241_10007611 3300009174 Bacteria 7960
102 Ga0105241_10289147 3300009174 Bacteria 1403
103 Ga0105242_10005030 3300009176 Bacteria 10214
104 Ga0105242_10460959 3300009176 Bacteria 1200
105 Ga0105248_10026009 3300009177 Bacteria 6510
106 Ga0105248_10092521 3300009177 Bacteria 3406
107 Ga0105248_10395824 3300009177 Bacteria 1555
108 Ga0105248_11125669 3300009177 Bacteria 887
109 Ga0105238_10027224 3300009551 Bacteria 5825
110 Ga0105238_10191133 3300009551 Bacteria 2023
111 Ga0105238_11700613 3300009551 Bacteria 662
112 Ga0105249_10125264 3300009553 Bacteria 2446
113 Ga0105239_10326435 3300010375 Bacteria 1731
114 Ga0105239_10437940 3300010375 Bacteria 1482
115 Ga0157325_1002900 3300012485 Bacteria 910
116 Ga0157373_10509774 3300013100 Bacteria 870
117 Ga0157370_10104506 3300013104 Bacteria 2651
118 Ga0157369_10192920 3300013105 Bacteria 2140
119 Ga0157378_10063614 3300013297 Bacteria 3297
120 Ga0157378_11147840 3300013297 Bacteria 815
121 Ga0163162_10077689 3300013306 Bacteria 3384
122 Ga0163162_10741877 3300013306 Bacteria 1102
123 Ga0157372_10042119 3300013307 Bacteria 5049
124 Ga0157372_10079516 3300013307 Bacteria 3708
125 Ga0157375_10122245 3300013308 Bacteria 2714
126 Ga0157375_10236650 3300013308 Bacteria 1985
127 Ga0157380_10075981 3300014326 Bacteria 2732
128 Ga0157380_10131968 3300014326 Bacteria 2133
129 Ga0157380_11064587 3300014326 Bacteria 846
130 Ga0157380_11434248 3300014326 Bacteria 742
131 Ga0157377_10003991 3300014745 Bacteria 6733
132 Ga0157379_10175667 3300014968 Bacteria 1934
133 Ga0157376_10127641 3300014969 Bacteria 2264
134 Ga0157376_11110519 3300014969 Bacteria 817
135 Ga0213872_10047900 3300021361 Bacteria 1943
136 Ga0213876_10171274 3300021384 Bacteria 1155
137 Ga0207656_10269415 3300025321 Bacteria 838
138 Ga0207682_10378740 3300025893 Bacteria 668
139 Ga0207688_10264549 3300025901 Bacteria 1045
140 Ga0207688_10387569 3300025901 Bacteria 865
141 Ga0207685_10165098 3300025905 Bacteria 1014
142 Ga0207643_10065303 3300025908 Bacteria 2084
143 Ga0207654_10014171 3300025911 Bacteria 4114
144 Ga0207663_10089292 3300025916 Bacteria 2040
145 Ga0207662_10082521 3300025918 Bacteria 1963
146 Ga0207662_10497907 3300025918 Bacteria 839
147 Ga0207662_10876619 3300025918 Bacteria 635
148 Ga0207662_11222449 3300025918 Bacteria 534
149 Ga0207681_10443601 3300025923 Bacteria 1055
150 Ga0207694_10030390 3300025924 Bacteria 4125
151 Ga0207694_10063675 3300025924 Bacteria 2873
152 Ga0207659_10020968 3300025926 Bacteria 4329
153 Ga0207687_10065359 3300025927 Bacteria 2583
154 Ga0207687_10506988 3300025927 Bacteria 1008
155 Ga0207700_10009038 3300025928 Bacteria 6203
156 Ga0207686_10057194 3300025934 Bacteria 2455
157 Ga0207709_11124005 3300025935 Bacteria 646
158 Ga0207670_10003510 3300025936 Bacteria 8321
159 Ga0207670_10016847 3300025936 Bacteria 4403
160 Ga0207670_10747748 3300025936 Bacteria 812
161 Ga0207669_10614065 3300025937 Bacteria 885
162 Ga0207669_11389846 3300025937 Bacteria 597
163 Ga0207669_11597163 3300025937 Bacteria 557
164 Ga0207704_10106146 3300025938 Bacteria 1886
165 Ga0207691_10048698 3300025940 Bacteria 3884
166 Ga0207691_10066699 3300025940 Bacteria 3256
167 Ga0207711_10065336 3300025941 Bacteria 3145
168 Ga0207711_10330257 3300025941 Bacteria 1410
169 Ga0207711_10661118 3300025941 Bacteria 975
170 Ga0207689_10231519 3300025942 Bacteria 1527
171 Ga0207689_10374172 3300025942 Bacteria 1186
172 Ga0207661_11465655 3300025944 Bacteria 626
173 Ga0207651_10240474 3300025960 Bacteria 1475
174 Ga0207651_10716724 3300025960 Bacteria 882
175 Ga0207640_10075410 3300025981 Bacteria 2286
176 Ga0207677_10470606 3300026023 Bacteria 1081
177 Ga0207703_10136945 3300026035 Bacteria 2120
178 Ga0207703_10191350 3300026035 Bacteria 1812
179 Ga0207639_10370157 3300026041 Bacteria 1284
180 Ga0207708_10313746 3300026075 Bacteria 1278
181 Ga0207702_10039025 3300026078 Bacteria 3978
182 Ga0207641_10176849 3300026088 Bacteria 1952
183 Ga0207641_10440276 3300026088 Bacteria 1258
184 Ga0207648_10023686 3300026089 Bacteria 5495
185 Ga0207648_10146827 3300026089 Bacteria 2080
186 Ga0207648_10437757 3300026089 Bacteria 1189
187 Ga0207648_10476855 3300026089 Bacteria 1139
188 Ga0207648_11396544 3300026089 Bacteria 658
189 Ga0207676_11500857 3300026095 Bacteria 671
190 Ga0207674_10095103 3300026116 Bacteria 2966
191 Ga0207675_100353134 3300026118 Bacteria 1441
192 Ga0207675_100433313 3300026118 Bacteria 1300
193 Ga0207675_100654595 3300026118 Bacteria 1057
194 Ga0207683_10015967 3300026121 Bacteria 6390
195 Ga0207698_10171419 3300026142 Bacteria 1911
196 Ga0207698_10301634 3300026142 Bacteria 1491
197 Ga0207698_10361941 3300026142 Bacteria 1374
198 Ga0207698_10874768 3300026142 Bacteria 905
199 Ga0207428_10010038 3300027907 Bacteria 8474
200 Ga0207428_10481496 3300027907 Bacteria 903
201 Ga0268265_11157120 3300028380 Bacteria 770
202 Ga0268265_11439721 3300028380 Bacteria 692
203 Ga0265340_10185248 3300031247 Bacteria 940
204 Ga0307408_100068489 3300031548 Bacteria 2614
205 Ga0307408_100094510 3300031548 Bacteria 2264
206 Ga0307408_100699122 3300031548 Bacteria 911
207 Ga0307408_100718102 3300031548 Bacteria 900
208 Ga0316579_10003331 3300031691 Bacteria 6242
209 Ga0316579_10026368 3300031691 Bacteria 2631
210 Ga0265314_10208230 3300031711 Bacteria 1150
211 Ga0265342_10117073 3300031712 Bacteria 1504
212 Ga0316576_10000833 3300031727 Bacteria 15617
213 Ga0316578_10000152 3300031728 Bacteria 18135
214 Ga0316578_10075722 3300031728 Bacteria 1997
215 Ga0307405_10066693 3300031731 Bacteria 2296
216 Ga0307405_10341398 3300031731 Bacteria 1152
217 Ga0316577_10000176 3300031733 Bacteria 20573
218 Ga0316577_10232438 3300031733 Bacteria 1042
219 Ga0307406_10876474 3300031901 Bacteria 763
220 Ga0307407_11219268 3300031903 Bacteria 588
221 Ga0307412_10153328 3300031911 Bacteria 1703
222 Ga0307412_10378707 3300031911 Bacteria 1145
223 Ga0307409_101130912 3300031995 Bacteria 805
224 Ga0307416_100025334 3300032002 Bacteria 4347
225 Ga0307416_100123729 3300032002 Bacteria 2312
226 Ga0307416_100695121 3300032002 Bacteria 1106
227 Ga0307416_101130420 3300032002 Bacteria 888
228 Ga0307416_101430251 3300032002 Bacteria 797
229 Ga0307416_101823172 3300032002 Bacteria 712
230 Ga0316585_10035078 3300032137 Bacteria 1588
231 Ga0316580_10191952 3300032139 Bacteria 629
232 Ga0316593_10000339 3300032168 Bacteria 8111
233 Ga0316593_10000373 3300032168 Bacteria 7941
234 Ga0316593_10002678 3300032168 Bacteria 4281
235 Ga0316593_10004071 3300032168 Bacteria 3708
236 Ga0316593_10004344 3300032168 Bacteria 3631
237 Ga0316593_10005367 3300032168 Bacteria 3372
238 Ga0316593_10010512 3300032168 Bacteria 2656
239 Ga0316593_10018649 3300032168 Bacteria 2135
240 Ga0316593_10021586 3300032168 Bacteria 2015
241 Ga0316593_10029738 3300032168 Bacteria 1769
242 Ga0316593_10104308 3300032168 Bacteria 1008
243 Ga0316593_10136363 3300032168 Bacteria 888
244 Ga0316592_1021595 3300033524 Bacteria 1372
245 Ga0316592_1086301 3300033524 Bacteria 716
246 Ga0316586_1000415 3300033527 Bacteria 4093
247 Ga0316586_1010026 3300033527 Bacteria 1429
248 Ga0316586_1073454 3300033527 Bacteria 632
249 Ga0316588_1002351 3300033528 Bacteria 3286
250 Ga0316588_1002377 3300033528 Bacteria 3271
251 Ga0316587_1000598 3300033529 Bacteria 3809
252 Ga0316587_1001092 3300033529 Bacteria 3186
253 Ga0316587_1001118 3300033529 Bacteria 3164
254 Ga0316587_1005710 3300033529 Bacteria 1877
255 Ga0316587_1010144 3300033529 Bacteria 1503
256 Ga0316587_1062967 3300033529 Bacteria 689
257 Ga0316587_1066559 3300033529 Bacteria 672
258 Ga0316596_1002516 3300033541 Bacteria 3923
259 Ga0316596_1003520 3300033541 Bacteria 3441
260 Ga0316596_1003678 3300033541 Bacteria 3383
261 Ga0316596_1073025 3300033541 Bacteria 919
262 Ga0373934_0257552 3300035086 Bacteria 722
263 Ga0373953_0114160 3300035117 Bacteria 1144
264 Ga0373954_0053927 3300035118 Bacteria 1891
265 Ga0373956_0107591 3300035119 Bacteria 1297
266 Ga0316574_0130987 3300035398 Bacteria 1614
267 Ga0373931_0211109 3300035691 Bacteria 1164
268 Ga0373931_0322738 3300035691 Bacteria 959
269 Ga0373927_0091061 3300035695 Bacteria 1981
270 Ga0373937_0024931 3300036401 Bacteria 5398
271 Ga0316582_0588288 3300036647 Bacteria 766
272 Ga0316584_0005568 3300036712 Bacteria 8475
273 Ga0316584_0202985 3300036712 Bacteria 1462
274 Ga0373925_0736305 3300037068 Bacteria 813
275 Ga0373925_0986847 3300037068 Bacteria 694
276 Ga0316581_0006117 3300037588 Bacteria 3172
277 Ga0400483_103086 3300039062 Bacteria 1091
278 Ga0400483_219833 3300039062 Bacteria 2162
279 Ga0436365_0787909 3300039437 Bacteria 2838
280 Ga0436361_0429827 3300039447 Bacteria 5724
281 Ga0436361_0445788 3300039447 Bacteria 9657
282 Ga0451807_0059921 3300041486 Bacteria 1300
283 Ga0439441_065938 3300042001 Bacteria 769
284 Ga0453683_0503505 3300044673 Bacteria 786
285 Ga0466965_0003431 3300044683 Bacteria 6952
286 Ga0466966_0195157 3300044684 Bacteria 1226
287 Ga0466961_0080405 3300044693 Bacteria 2063
288 Ga0466959_0040672 3300045049 Bacteria 3433
289 Ga0495592_0218032 3300046454 Bacteria 1277
290 Ga0495628_0104833 3300046516 Bacteria 2179
291 Ga0495652_0125350 3300046529 Bacteria 2041
292 Ga0495645_0003235 3300046543 Bacteria 11047
293 Ga0495667_0049085 3300046559 Bacteria 2786
294 Ga0495657_0166618 3300046675 Bacteria 1360
295 Ga0495599_0016655 3300046678 Bacteria 4565
296 Ga0495623_0014789 3300046679 Bacteria 5045
297 Ga0495646_0662069 3300046680 Bacteria 527
298 Ga0495658_0132974 3300046683 Bacteria 1516
299 Ga0495684_0265372 3300047471 Bacteria 1244
300 Ga0495602_0293698 3300048088 Bacteria 1192
301 Ga0501039_0061019 3300049575 Bacteria 2920
302 Ga0501041_0000884 3300049577 Bacteria 16204
303 Ga0501042_0080101 3300049578 Bacteria 2340
304 Ga0501043_0288809 3300049579 Bacteria 1256
305 Ga0501046_0045675 3300049580 Bacteria 3479
306 Ga0501046_0291185 3300049580 Bacteria 1194
307 Ga0501047_0000828 3300049581 Bacteria 31895
308 Ga0501048_0628018 3300049582 Bacteria 771
309 Ga0501068_0129914 3300049584 Bacteria 1575
310 Ga0501069_0082161 3300049585 Bacteria 1815
311 Ga0501070_0015098 3300049586 Bacteria 6501
312 Ga0501071_0017275 3300049587 Bacteria 4973
313 Ga0501072_1455917 3300049588 Bacteria 529
314 Ga0501073_0000792 3300049589 Bacteria 22503
315 Ga0501074_0002597 3300049590 Bacteria 12618
316 Ga0501075_0011337 3300049591 Bacteria 6308
317 Ga0501257_157608 3300049686 Bacteria 630
318 Ga0501079_0003898 3300049741 Bacteria 11013
319 Ga0501079_0031571 3300049741 Bacteria 4071
320 Ga0501080_0009455 3300049742 Bacteria 8891
321 Ga0501080_0053833 3300049742 Bacteria 3748
322 Ga0501081_0002318 3300049743 Bacteria 11987
323 Ga0501081_0060393 3300049743 Bacteria 2626
324 Ga0501083_0001704 3300049744 Bacteria 14985
325 Ga0501035_0123733 3300049822 Bacteria 2259
326 Ga0501035_0182540 3300049822 Bacteria 1807
327 Ga0501044_1488785 3300049823 Bacteria 542
328 nmdc:mga00v17_353020_c1 3300050491 Bacteria 956
329 nmdc:mga0k408_12409_c1 3300050493 Bacteria 4657
330 nmdc:mga0k408_411710_c1 3300050493 Bacteria 804
331 nmdc:mga0k408_60544_c1 3300050493 Bacteria 2200
332 nmdc:mga06z11_298629_c1 3300050494 Bacteria 957
333 nmdc:mga09592_305720_c1 3300050508 Bacteria 1378
334 nmdc:mga08y16_32438_c1 3300050511 Bacteria 5491
335 nmdc:mga0a205_50513_c1 3300050515 Bacteria 4015
336 Ga0495601_0022391 3300053077 Bacteria 3878
337 Ga0495595_0341296 3300053084 Bacteria 755
338 Ga0495619_0111815 3300053085 Bacteria 1867
339 Ga0590071_069529 3300059421 Bacteria 867
340 Ga0501082_0069783 3300060353 Bacteria 3026
341 Ga0501082_0517302 3300060353 Bacteria 1043
342 Ga0530510_0937559 3300061734 Bacteria 662
343 2738715053 2738541276 Bacteria 4690596
344 2998345745 2998344455 Bacteria 4222996
345 Ga0068863_100413441
346 Ga0070676_10333195
347 Ga0070690_100578901
348 Ga0070690_101521513
349 Ga0070670_100666602
350 Ga0068869_100570701
351 Ga0068868_100329467
352 Ga0068868_100806814
353 Ga0070689_100012797
354 Ga0070689_100117901
355 Ga0070689_100341792
356 Ga0070687_100501659
357 Ga0070661_101029374
358 Ga0070669_100024733
359 Ga0070675_100004581
360 Ga0070674_100010839
361 Ga0070674_100239103
362 Ga0070674_100992082
363 Ga0070673_100072413
364 Ga0070673_100117215
365 Ga0070673_100780753
366 Ga0070673_100851428
367 Ga0070688_100051933
368 Ga0070688_100391333
369 Ga0070710_11171827
370 Ga0070711_100353724
371 Ga0070700_100256164
372 Ga0070694_101059937
373 Ga0070678_100688779
374 Ga0070662_101233386
375 Ga0068867_100098689
376 Ga0068867_100145851
377 Ga0070685_10013293
378 Ga0068853_100067306
379 Ga0068853_100419388
380 Ga0070672_100085984
381 Ga0070672_100784122
382 Ga0070686_100457256
383 Ga0070696_100072638
384 Ga0070696_100337218
385 Ga0070693_100005048
386 Ga0070693_100049529
387 Ga0070693_100201879
388 Ga0070704_100133469
389 Ga0068857_100067139
390 Ga0068854_100289874
391 Ga0068856_100001616
392 Ga0068856_100807201
393 Ga0070702_100328396
394 Ga0068852_100062107
395 Ga0068852_100138394
396 Ga0068852_100798659
397 Ga0068859_100104816
398 Ga0068859_100160266
399 Ga0068859_101118683
400 Ga0068859_101227855
401 Ga0068859_102274962
402 Ga0068864_100772573
403 Ga0068864_101611866
404 Ga0068866_10683775
405 Ga0068861_100817325
406 Ga0068851_10566421
407 Ga0068858_100007075
408 Ga0068858_100032725
409 Ga0068858_100638875
410 Ga0068858_101383260
411 Ga0068860_100721179
412 Ga0068862_101494407
413 Ga0070717_10136914
414 Ga0075364_10254363
415 Ga0075364_10938385
416 Ga0070715_10224614
417 Ga0070712_100126976
418 Ga0075367_10293456
419 Ga0075367_10508929
420 Ga0075366_10020010
421 Ga0075366_10064367
422 Ga0097621_100033241
423 Ga0097621_100177443
424 Ga0097621_100822601
425 Ga0075370_10164197
426 Ga0068871_100006498
427 Ga0068871_100305025
428 Ga0068871_100338816
429 Ga0075428_100009835
430 Ga0068865_100010302
431 Ga0068865_100423022
432 Ga0075436_100332642
433 Ga0097620_100104800
434 Ga0097620_100160267
435 Ga0097620_101118639
436 Ga0097620_101227801
437 Ga0097620_102274280
438 Ga0111539_10001926
439 Ga0111539_11468504
440 Ga0105245_10259313
441 Ga0105245_10274903
442 Ga0105245_10278058
443 Ga0105245_10386947
444 Ga0114129_10766623
445 Ga0105241_10007611
446 Ga0105241_10289147
447 Ga0105242_10005030
448 Ga0105242_10460959
449 Ga0105248_10026009
450 Ga0105248_10092521
451 Ga0105248_10395824
452 Ga0105248_11125669
453 Ga0105238_10027224
454 Ga0105238_10191133
455 Ga0105238_11700613
456 Ga0105249_10125264
457 Ga0105239_10326435
458 Ga0105239_10437940
459 Ga0157325_1002900
460 Ga0157373_10509774
461 Ga0157370_10104506
462 Ga0157369_10192920
463 Ga0157378_10063614
464 Ga0157378_11147840
465 Ga0163162_10077689
466 Ga0163162_10741877
467 Ga0157372_10042119
468 Ga0157372_10079516
469 Ga0157375_10122245
470 Ga0157375_10236650
471 Ga0157380_10075981
472 Ga0157380_10131968
473 Ga0157380_11064587
474 Ga0157380_11434248
475 Ga0157377_10003991
476 Ga0157379_10175667
477 Ga0157376_10127641
478 Ga0157376_11110519
479 Ga0213872_10047900
480 Ga0213876_10171274
481 Ga0207656_10269415
482 Ga0207682_10378740
483 Ga0207688_10264549
484 Ga0207688_10387569
485 Ga0207685_10165098
486 Ga0207643_10065303
487 Ga0207654_10014171
488 Ga0207663_10089292
489 Ga0207662_10082521
490 Ga0207662_10497907
491 Ga0207662_10876619
492 Ga0207662_11222449
493 Ga0207681_10443601
494 Ga0207694_10030390
495 Ga0207694_10063675
496 Ga0207659_10020968
497 Ga0207687_10065359
498 Ga0207687_10506988
499 Ga0207700_10009038
500 Ga0207686_10057194
501 Ga0207709_11124005
502 Ga0207670_10003510
503 Ga0207670_10016847
504 Ga0207670_10747748
505 Ga0207669_10614065
506 Ga0207669_11389846
507 Ga0207669_11597163
508 Ga0207704_10106146
509 Ga0207691_10048698
510 Ga0207691_10066699
511 Ga0207711_10065336
512 Ga0207711_10330257
513 Ga0207711_10661118
514 Ga0207689_10231519
515 Ga0207689_10374172
516 Ga0207661_11465655
517 Ga0207651_10240474
518 Ga0207651_10716724
519 Ga0207640_10075410
520 Ga0207677_10470606
521 Ga0207703_10136945
522 Ga0207703_10191350
523 Ga0207639_10370157
524 Ga0207708_10313746
525 Ga0207702_10039025
526 Ga0207641_10176849
527 Ga0207641_10440276
528 Ga0207648_10023686
529 Ga0207648_10146827
530 Ga0207648_10437757
531 Ga0207648_10476855
532 Ga0207648_11396544
533 Ga0207676_11500857
534 Ga0207674_10095103
535 Ga0207675_100353134
536 Ga0207675_100433313
537 Ga0207675_100654595
538 Ga0207683_10015967
539 Ga0207698_10171419
540 Ga0207698_10301634
541 Ga0207698_10361941
542 Ga0207698_10874768
543 Ga0207428_10010038
544 Ga0207428_10481496
545 Ga0268265_11157120
546 Ga0268265_11439721
547 Ga0265340_10185248
548 Ga0307408_100068489
549 Ga0307408_100094510
550 Ga0307408_100699122
551 Ga0307408_100718102
552 Ga0316579_10003331
553 Ga0316579_10026368
554 Ga0265314_10208230
555 Ga0265342_10117073
556 Ga0316576_10000833
557 Ga0316578_10000152
558 Ga0316578_10075722
559 Ga0307405_10066693
560 Ga0307405_10341398
561 Ga0316577_10000176
562 Ga0316577_10232438
563 Ga0307406_10876474
564 Ga0307407_11219268
565 Ga0307412_10153328
566 Ga0307412_10378707
567 Ga0307409_101130912
568 Ga0307416_100025334
569 Ga0307416_100123729
570 Ga0307416_100695121
571 Ga0307416_101130420
572 Ga0307416_101430251
573 Ga0307416_101823172
574 Ga0316585_10035078
575 Ga0316580_10191952
576 Ga0316593_10000339
577 Ga0316593_10000373
578 Ga0316593_10002678
579 Ga0316593_10004071
580 Ga0316593_10004344
581 Ga0316593_10005367
582 Ga0316593_10010512
583 Ga0316593_10018649
584 Ga0316593_10021586
585 Ga0316593_10029738
586 Ga0316593_10104308
587 Ga0316593_10136363
588 Ga0316592_1021595
589 Ga0316592_1086301
590 Ga0316586_1000415
591 Ga0316586_1010026
592 Ga0316586_1073454
593 Ga0316588_1002351
594 Ga0316588_1002377
595 Ga0316587_1000598
596 Ga0316587_1001092
597 Ga0316587_1001118
598 Ga0316587_1005710
599 Ga0316587_1010144
600 Ga0316587_1062967
601 Ga0316587_1066559
602 Ga0316596_1002516
603 Ga0316596_1003520
604 Ga0316596_1003678
605 Ga0316596_1073025
606 Ga0373934_0257552
607 Ga0373953_0114160
608 Ga0373954_0053927
609 Ga0373956_0107591
610 Ga0316574_0130987
611 Ga0373931_0211109
612 Ga0373931_0322738
613 Ga0373927_0091061
614 Ga0373937_0024931
615 Ga0316582_0588288
616 Ga0316584_0005568
617 Ga0316584_0202985
618 Ga0373925_0736305
619 Ga0373925_0986847
620 Ga0316581_0006117
621 Ga0400483_103086
622 Ga0400483_219833
623 Ga0436365_0787909
624 Ga0436361_0429827
625 Ga0436361_0445788
626 Ga0451807_0059921
627 Ga0439441_065938
628 Ga0453683_0503505
629 Ga0466965_0003431
630 Ga0466966_0195157
631 Ga0466961_0080405
632 Ga0466959_0040672
633 Ga0495592_0218032
634 Ga0495628_0104833
635 Ga0495652_0125350
636 Ga0495645_0003235
637 Ga0495667_0049085
638 Ga0495657_0166618
639 Ga0495599_0016655
640 Ga0495623_0014789
641 Ga0495646_0662069
642 Ga0495658_0132974
643 Ga0495684_0265372
644 Ga0495602_0293698
645 Ga0501039_0061019
646 Ga0501041_0000884
647 Ga0501042_0080101
648 Ga0501043_0288809
649 Ga0501046_0045675
650 Ga0501046_0291185
651 Ga0501047_0000828
652 Ga0501048_0628018
653 Ga0501068_0129914
654 Ga0501069_0082161
655 Ga0501070_0015098
656 Ga0501071_0017275
657 Ga0501072_1455917
658 Ga0501073_0000792
659 Ga0501074_0002597
660 Ga0501075_0011337
661 Ga0501257_157608
662 Ga0501079_0003898
663 Ga0501079_0031571
664 Ga0501080_0009455
665 Ga0501080_0053833
666 Ga0501081_0002318
667 Ga0501081_0060393
668 Ga0501083_0001704
669 Ga0501035_0123733
670 Ga0501035_0182540
671 Ga0501044_1488785
672 nmdc:mga00v17_353020_c1
673 nmdc:mga0k408_12409_c1
674 nmdc:mga0k408_411710_c1
675 nmdc:mga0k408_60544_c1
676 nmdc:mga06z11_298629_c1
677 nmdc:mga09592_305720_c1
678 nmdc:mga08y16_32438_c1
679 nmdc:mga0a205_50513_c1
680 Ga0495601_0022391
681 Ga0495595_0341296
682 Ga0495619_0111815
683 Ga0590071_069529
684 Ga0501082_0069783
685 Ga0501082_0517302
686 Ga0530510_0937559
687 2738715053
688 2998345745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

3

133

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hf0-assembly1.cif.gz_B crystal structure of apo iscr 0.9442 1 133
4hf0-assembly1.cif.gz_A crystal structure of apo iscr 0.9288 1 133
4hf2-assembly1.cif.gz_B crystal structure of e43a iscr mutant bound to its promoter 0.9246 1 134
4hf0-assembly1.cif.gz_A crystal structure of apo iscr 0.9213 1 133
4hf0-assembly1.cif.gz_B crystal structure of apo iscr 0.9208 1 133
ID Description Score Start End Superfamily
4hf2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9152 1 131 1.10.10.10
2xroE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9129 8 67 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 4 69 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9074 8 67 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9052 11 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A421K148-F1-model_v4 Rrf2 family transcriptional regulator 0.9156 1 134 GO:0003700
GO:0005829
AF-A0A238HGS5-F1-model_v4 HTH-type transcriptional regulator IscR 0.9136 1 134 GO:0003700
GO:0005829
AF-A0A0M1JEH8-F1-model_v4 Rrf2 family transcriptional regulator 0.9105 1 134 GO:0003700
GO:0005829
AF-A0A3P2AAS4-F1-model_v4 Rrf2 family transcriptional regulator 0.9102 1 134 GO:0003700
GO:0005829
AF-A0A1I4QH47-F1-model_v4 Transcriptional regulator, BadM/Rrf2 family 0.908 1 134 GO:0003690
GO:0003700
GO:0005829

Map