F415972

General Info

Members Datasets Scaffolds Average Seq Length
344 210 688 278

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10370444|Ga0157375_103704442
Length 312
Sequence MARPIQAAAPGRRKQGPTLTEGRSPYSASEEHHVDKYVVAGNPVEHSQSPFIHAEFARQTGEAMEYGRLLWPIGHFAESVRALAQSGAKGCNITVPFKFDAFREGKRLTPRARLAQAANVLRFDAEGWLADNTDGVGLVTDVERNAGVALAGRRVLLIGAGGAASGVLGPLLATRPQEIVVANRTLDKARALIDRHAPVAGSVRLDACALDDCGSGYDVVLNASASSMQGAAIPVAPGVLAPGALALDMMYGLAARPFIDWAESHGARGRDGLGMLVEQAAAAFELWRGVHPETAPVLAALRARMAQGAARL

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
130 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
137 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
138 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
141 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
180 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
195 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
202 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
203 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
204 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
205 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
206 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
207 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
208 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
209 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
210 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25
Nodule 0.58
Rhizoplane 1.16
Rhizosphere 56.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10370444 3300013308 Bacteria 1598
2 JGI24740J21852_10011214 3300001979 Bacteria 3419
3 JGI25153J46596_10001512 3300003215 Bacteria 13857
4 JGI25153J46596_10006965 3300003215 Bacteria 5632
5 rootH1_10062733 3300003316 Bacteria 1793
6 rootH1_10129582 3300003323 Bacteria 1323
7 Ga0055524_1000109 3300003775 Bacteria 100308
8 Ga0055524_1000146 3300003775 Bacteria 84190
9 Ga0055530_10021203 3300003791 Bacteria 1921
10 Ga0055540_1000401 3300003792 Bacteria 35216
11 Ga0055540_1007525 3300003792 Bacteria 4089
12 Ga0055531_10001570 3300003794 Bacteria 16720
13 Ga0055531_10003024 3300003794 Bacteria 10912
14 Ga0065165_1007008 3300005262 Bacteria 5686
15 Ga0070658_10345909 3300005327 Bacteria 1272
16 Ga0070676_10002353 3300005328 Bacteria 9679
17 Ga0070676_10101013 3300005328 Bacteria 1782
18 Ga0068869_100016765 3300005334 Bacteria 4946
19 Ga0068868_100009022 3300005338 Bacteria 7157
20 Ga0070660_100193890 3300005339 Bacteria 1646
21 Ga0070687_100068188 3300005343 Bacteria 1901
22 Ga0070661_100000191 3300005344 Bacteria 50550
23 Ga0070675_100005231 3300005354 Bacteria 9903
24 Ga0070675_100349044 3300005354 Bacteria 1312
25 Ga0070671_100005899 3300005355 Bacteria 9760
26 Ga0070673_100009689 3300005364 Bacteria 6480
27 Ga0070659_100002121 3300005366 Bacteria 14125
28 Ga0070667_100039064 3300005367 Bacteria 3978
29 Ga0070667_100362082 3300005367 Bacteria 1315
30 Ga0070667_100427470 3300005367 Bacteria 1208
31 Ga0070708_100064215 3300005445 Bacteria 3289
32 Ga0070662_100081218 3300005457 Bacteria 2415
33 Ga0068867_100001021 3300005459 Bacteria 19150
34 Ga0068867_100005705 3300005459 Bacteria 8826
35 Ga0070706_100001272 3300005467 Bacteria 26932
36 Ga0070706_100083698 3300005467 Bacteria 2956
37 Ga0070707_100172792 3300005468 Bacteria 2106
38 Ga0070698_100223973 3300005471 Bacteria 1814
39 Ga0070672_100003578 3300005543 Bacteria 10065
40 Ga0070665_100068735 3300005548 Bacteria 3551
41 Ga0070664_100001381 3300005564 Bacteria 19335
42 Ga0070664_100025394 3300005564 Bacteria 4910
43 Ga0068856_100027385 3300005614 Bacteria 5561
44 Ga0068852_100240470 3300005616 Bacteria 1730
45 Ga0068852_100717225 3300005616 Bacteria 1011
46 Ga0068870_10039137 3300005840 Bacteria 2452
47 Ga0068863_100010638 3300005841 Bacteria 8931
48 Ga0068863_100081020 3300005841 Bacteria 3075
49 Ga0068860_100255518 3300005843 Bacteria 1707
50 Ga0068862_100297742 3300005844 Bacteria 1483
51 Ga0068862_100554362 3300005844 Bacteria 1098
52 Ga0075365_10042544 3300006038 Bacteria 2970
53 Ga0075365_10081977 3300006038 Bacteria 2187
54 Ga0075368_10011203 3300006042 Bacteria 3258
55 Ga0075368_10081721 3300006042 Bacteria 1315
56 Ga0075363_100034513 3300006048 Bacteria 2641
57 Ga0075363_100061018 3300006048 Bacteria 2031
58 Ga0075364_10010377 3300006051 Bacteria 5625
59 Ga0075362_10003105 3300006177 Bacteria 5728
60 Ga0075362_10009818 3300006177 Bacteria 3715
61 Ga0075367_10009505 3300006178 Bacteria 5086
62 Ga0075367_10034083 3300006178 Bacteria 2938
63 Ga0075369_10015885 3300006186 Bacteria 3029
64 Ga0075369_10150658 3300006186 Bacteria 1063
65 Ga0075366_10005597 3300006195 Bacteria 6814
66 Ga0075366_10006389 3300006195 Bacteria 6456
67 Ga0075366_10014216 3300006195 Bacteria 4545
68 Ga0075366_10047676 3300006195 Bacteria 2540
69 Ga0075366_10086121 3300006195 Bacteria 1880
70 Ga0075366_10088273 3300006195 Bacteria 1857
71 Ga0075370_10000655 3300006353 Bacteria 13473
72 Ga0075370_10009074 3300006353 Bacteria 5143
73 Ga0075370_10045058 3300006353 Bacteria 2494
74 Ga0075370_10051300 3300006353 Bacteria 2340
75 Ga0075430_100063044 3300006846 Bacteria 3114
76 Ga0075429_100004433 3300006880 Bacteria 12064
77 Ga0079104_1000001 3300006946 Bacteria 521847
78 Ga0105240_10012876 3300009093 Bacteria 11520
79 Ga0105245_10267279 3300009098 Bacteria 1666
80 Ga0105245_10597482 3300009098 Bacteria 1130
81 Ga0105243_10000717 3300009148 Bacteria 31849
82 Ga0105243_10053189 3300009148 Bacteria 3211
83 Ga0105242_10532352 3300009176 Bacteria 1123
84 Ga0105248_10017366 3300009177 Bacteria 7932
85 Ga0105237_10000556 3300009545 Bacteria 52272
86 Ga0105237_10023375 3300009545 Bacteria 6334
87 Ga0105238_10027759 3300009551 Bacteria 5769
88 Ga0105239_10003145 3300010375 Bacteria 20491
89 Ga0105239_10040868 3300010375 Bacteria 5082
90 Ga0157374_10177392 3300013296 Bacteria 2080
91 Ga0157378_10563487 3300013297 Bacteria 1146
92 Ga0157375_10006468 3300013308 Bacteria 10209
93 Ga0157377_10000032 3300014745 Bacteria 121003
94 Ga0157379_10325214 3300014968 Bacteria 1404
95 Ga0207425_1001180 3300025245 Bacteria 11637
96 Ga0209129_1000342 3300025258 Bacteria 40192
97 Ga0209673_1008984 3300025273 Bacteria 4389
98 Ga0209564_1000136 3300025295 Bacteria 185198
99 Ga0209758_1000045 3300025297 Bacteria 369174
100 Ga0209758_1000502 3300025297 Bacteria 63375
101 Ga0209758_1039976 3300025297 Bacteria 1775
102 Ga0209050_1000179 3300025298 Bacteria 143878
103 Ga0209256_1000015 3300025299 Bacteria 622953
104 Ga0209051_1000022 3300025303 Bacteria 474879
105 Ga0209051_1000025 3300025303 Bacteria 415397
106 Ga0209051_1029817 3300025303 Bacteria 2128
107 Ga0209257_1000030 3300025304 Bacteria 689812
108 Ga0209257_1000039 3300025304 Bacteria 591694
109 Ga0207642_10275269 3300025899 Bacteria 966
110 Ga0207680_10105637 3300025903 Bacteria 1817
111 Ga0207645_10004178 3300025907 Bacteria 10720
112 Ga0207645_10134013 3300025907 Bacteria 1613
113 Ga0207643_10026718 3300025908 Bacteria 3197
114 Ga0207695_10008486 3300025913 Bacteria 12850
115 Ga0207671_10001994 3300025914 Bacteria 22499
116 Ga0207671_10031203 3300025914 Bacteria 3971
117 Ga0207657_10279749 3300025919 Bacteria 1325
118 Ga0207649_10001361 3300025920 Bacteria 14506
119 Ga0207646_10217939 3300025922 Bacteria 1724
120 Ga0207694_10012667 3300025924 Bacteria 6354
121 Ga0207650_10104828 3300025925 Bacteria 2182
122 Ga0207659_10016587 3300025926 Bacteria 4796
123 Ga0207659_10291587 3300025926 Bacteria 1337
124 Ga0207687_10229223 3300025927 Bacteria 1467
125 Ga0207687_10236539 3300025927 Bacteria 1445
126 Ga0207690_10001370 3300025932 Bacteria 15294
127 Ga0207706_10035099 3300025933 Bacteria 4461
128 Ga0207709_10001051 3300025935 Bacteria 20412
129 Ga0207709_10101249 3300025935 Bacteria 1905
130 Ga0207669_10087923 3300025937 Bacteria 2014
131 Ga0207704_10081424 3300025938 Bacteria 2094
132 Ga0207691_10008114 3300025940 Bacteria 10080
133 Ga0207689_10012076 3300025942 Bacteria 7398
134 Ga0207689_10028540 3300025942 Bacteria 4668
135 Ga0207679_10000313 3300025945 Bacteria 36405
136 Ga0207679_10035224 3300025945 Bacteria 3539
137 Ga0207667_10050496 3300025949 Bacteria 4388
138 Ga0207667_10556978 3300025949 Bacteria 1159
139 Ga0207658_10020803 3300025986 Bacteria 4545
140 Ga0207658_10027903 3300025986 Bacteria 3971
141 Ga0207658_10390910 3300025986 Bacteria 1220
142 Ga0207677_10008876 3300026023 Bacteria 5635
143 Ga0207641_10047762 3300026088 Bacteria 3611
144 Ga0207648_10000790 3300026089 Bacteria 35657
145 Ga0207648_10003979 3300026089 Bacteria 15346
146 Ga0207648_10342233 3300026089 Bacteria 1347
147 Ga0207674_10015017 3300026116 Bacteria 8530
148 Ga0207674_10131940 3300026116 Bacteria 2461
149 Ga0207698_10294863 3300026142 Bacteria 1507
150 Ga0207698_10418361 3300026142 Bacteria 1285
151 Ga0207698_10843048 3300026142 Bacteria 921
152 Ga0209281_1000057 3300027111 Bacteria 307145
153 Ga0209974_10008157 3300027876 Bacteria 3586
154 Ga0268265_10147017 3300028380 Bacteria 1982
155 Ga0268265_10785356 3300028380 Bacteria 927
156 Ga0268264_10087857 3300028381 Bacteria 2674
157 Ga0268264_10192750 3300028381 Bacteria 1859
158 Ga0268264_10274646 3300028381 Bacteria 1576
159 Ga0307517_10060715 3300028786 Bacteria 3591
160 Ga0307517_10062555 3300028786 Bacteria 3497
161 Ga0307517_10108321 3300028786 Bacteria 2134
162 Ga0307517_10132623 3300028786 Bacteria 1786
163 Ga0307517_10230151 3300028786 Bacteria 1114
164 Ga0307515_10000278 3300028794 Bacteria 125493
165 Ga0307515_10001613 3300028794 Bacteria 50267
166 Ga0307515_10003475 3300028794 Bacteria 33121
167 Ga0307515_10031234 3300028794 Bacteria 8891
168 Ga0307515_10054751 3300028794 Bacteria 5848
169 Ga0307515_10115937 3300028794 Bacteria 3080
170 Ga0307515_10203705 3300028794 Bacteria 1846
171 Ga0307512_10043660 3300030522 Bacteria 3695
172 Ga0265331_10015096 3300031250 Bacteria 4090
173 Ga0307513_10013433 3300031456 Bacteria 10049
174 Ga0307513_10068108 3300031456 Bacteria 3730
175 Ga0307513_10190417 3300031456 Bacteria 1904
176 Ga0307513_10227358 3300031456 Bacteria 1681
177 Ga0307509_10000991 3300031507 Bacteria 48763
178 Ga0307509_10008544 3300031507 Bacteria 13021
179 Ga0307509_10039110 3300031507 Bacteria 5170
180 Ga0307509_10058269 3300031507 Bacteria 4091
181 Ga0307509_10059174 3300031507 Bacteria 4054
182 Ga0307509_10121714 3300031507 Bacteria 2586
183 Ga0307508_10000043 3300031616 Bacteria 143889
184 Ga0307508_10003877 3300031616 Bacteria 14878
185 Ga0307508_10047088 3300031616 Bacteria 3847
186 Ga0307508_10242675 3300031616 Bacteria 1398
187 Ga0307508_10339288 3300031616 Bacteria 1094
188 Ga0307514_10084638 3300031649 Bacteria 2333
189 Ga0307514_10221763 3300031649 Bacteria 1158
190 Ga0265314_10004168 3300031711 Bacteria 13596
191 Ga0307516_10000674 3300031730 Bacteria 46280
192 Ga0307516_10000953 3300031730 Bacteria 39905
193 Ga0307516_10005507 3300031730 Bacteria 15108
194 Ga0307516_10118594 3300031730 Bacteria 2440
195 Ga0307405_10062828 3300031731 Bacteria 2353
196 Ga0307507_10052790 3300033179 Bacteria 3892
197 Ga0307507_10060445 3300033179 Bacteria 3538
198 Ga0307507_10107172 3300033179 Bacteria 2304
199 Ga0307510_10000294 3300033180 Bacteria 46056
200 Ga0307510_10027295 3300033180 Bacteria 6543
201 Ga0307510_10082098 3300033180 Bacteria 3120
202 Ga0373932_0013601 3300035112 Bacteria 2029
203 Ga0373931_0016307 3300035691 Bacteria 3656
204 Ga0373931_0228443 3300035691 Bacteria 1123
205 Ga0373937_0108960 3300036401 Bacteria 2575
206 Ga0373937_0151180 3300036401 Bacteria 2175
207 Ga0395899_0196796 3300037312 Bacteria 1407
208 Ga0395900_0000058 3300037418 Bacteria 206785
209 Ga0395900_0027223 3300037418 Bacteria 5854
210 Ga0395898_0010179 3300037466 Bacteria 9844
211 Ga0395905_0017590 3300037471 Bacteria 6784
212 Ga0395905_0083290 3300037471 Bacteria 2996
213 Ga0395901_0075881 3300038443 Bacteria 3507
214 Ga0395901_0175997 3300038443 Bacteria 2244
215 Ga0439447_010659 3300041407 Bacteria 2719
216 Ga0439466_0010664 3300041411 Bacteria 3415
217 Ga0439465_0003347 3300041413 Bacteria 5235
218 Ga0451793_0123406 3300041452 Bacteria 1433
219 Ga0439431_0003128 3300041997 Bacteria 3637
220 Ga0439433_0003917 3300041999 Bacteria 3202
221 Ga0439442_011665 3300042002 Bacteria 1792
222 Ga0439445_0002956 3300042004 Bacteria 3798
223 Ga0439445_0017329 3300042004 Bacteria 1780
224 Ga0439432_013871 3300042006 Bacteria 2732
225 Ga0439449_0000457 3300042007 Bacteria 15244
226 Ga0439449_0001290 3300042007 Bacteria 9811
227 Ga0439449_0001342 3300042007 Bacteria 9637
228 Ga0439452_001415 3300042010 Bacteria 9860
229 Ga0439462_0005244 3300042015 Bacteria 3190
230 Ga0439462_0024936 3300042015 Bacteria 1573
231 Ga0450911_000336 3300042115 Bacteria 16628
232 Ga0450920_001046 3300042122 Bacteria 4529
233 Ga0450909_008959 3300042185 Bacteria 1459
234 Ga0439434_0002526 3300042435 Bacteria 5324
235 Ga0450918_000014 3300042531 Bacteria 34950
236 Ga0450893_0001192 3300042532 Bacteria 3918
237 Ga0466969_0022072 3300044656 Bacteria 3289
238 Ga0466969_0041892 3300044656 Bacteria 2288
239 Ga0466969_0196215 3300044656 Bacteria 921
240 Ga0466972_0008579 3300044658 Bacteria 5129
241 Ga0466972_0024791 3300044658 Bacteria 2977
242 Ga0466977_0000128 3300044666 Bacteria 17503
243 Ga0466965_0015004 3300044683 Bacteria 3675
244 Ga0466965_0087370 3300044683 Bacteria 1582
245 Ga0466961_0006094 3300044693 Bacteria 7650
246 Ga0466961_0152924 3300044693 Bacteria 1440
247 Ga0453684_0075694 3300044712 Bacteria 4229
248 Ga0466960_0016896 3300044901 Bacteria 3173
249 Ga0466960_0034588 3300044901 Bacteria 2356
250 Ga0495592_0000083 3300046454 Bacteria 83092
251 Ga0495590_0045839 3300046457 Bacteria 1525
252 Ga0495650_0007705 3300046471 Bacteria 6417
253 Ga0495610_0041050 3300046512 Bacteria 2326
254 Ga0495620_0042268 3300046515 Bacteria 1992
255 Ga0495632_0146949 3300046519 Bacteria 1091
256 Ga0495625_0014961 3300046660 Bacteria 6165
257 Ga0495625_0021227 3300046660 Bacteria 5003
258 Ga0495658_0148098 3300046683 Bacteria 1440
259 Ga0495649_0012911 3300046694 Bacteria 4837
260 Ga0495687_001691 3300047443 Bacteria 19685
261 Ga0495687_033978 3300047443 Bacteria 2308
262 Ga0495686_0085875 3300047472 Bacteria 1915
263 Ga0495626_0014929 3300048091 Bacteria 3987
264 Ga0495626_0035099 3300048091 Bacteria 2395
265 Ga0496102_0015544 3300048905 Bacteria 6632
266 Ga0496113_0004477 3300048916 Bacteria 8597
267 Ga0496114_0010776 3300048917 Bacteria 7276
268 Ga0496117_0212581 3300048920 Bacteria 1083
269 Ga0496121_0009385 3300048924 Bacteria 11256
270 Ga0496121_0016833 3300048924 Bacteria 7519
271 Ga0496124_0001001 3300048927 Bacteria 44775
272 Ga0496124_0040137 3300048927 Bacteria 4051
273 Ga0496125_0006171 3300048928 Bacteria 13063
274 Ga0496125_0007743 3300048928 Bacteria 11374
275 Ga0496125_0027035 3300048928 Bacteria 5210
276 Ga0496126_0017827 3300048929 Bacteria 7066
277 Ga0495682_0118507 3300049460 Bacteria 948
278 Ga0501293_004549 3300049516 Bacteria 1093
279 Ga0501034_0252579 3300049571 Bacteria 1707
280 Ga0501039_0116275 3300049575 Bacteria 2094
281 Ga0501042_0141324 3300049578 Bacteria 1736
282 Ga0501043_0000057 3300049579 Bacteria 103997
283 Ga0501046_0000075 3300049580 Bacteria 104000
284 Ga0501046_0047014 3300049580 Bacteria 3423
285 Ga0501047_0000081 3300049581 Bacteria 122697
286 Ga0501048_0002921 3300049582 Bacteria 13057
287 Ga0501080_0069639 3300049742 Bacteria 3272
288 Ga0501262_001932 3300049759 Bacteria 2333
289 Ga0501265_000637 3300049762 Bacteria 3794
290 Ga0501044_0062784 3300049823 Bacteria 3796
291 Ga0501045_0002738 3300049824 Bacteria 12043
292 nmdc:mga03683_7894_c1 3300050489 Bacteria 3716
293 nmdc:mga00v17_210895_c1 3300050491 Bacteria 1257
294 nmdc:mga00v17_249083_c1 3300050491 Bacteria 1152
295 nmdc:mga0yw44_350218_c1 3300050492 Bacteria 994
296 nmdc:mga0k408_126242_c1 3300050493 Bacteria 1518
297 nmdc:mga0k408_146333_c1 3300050493 Bacteria 1407
298 nmdc:mga0k408_147510_c1 3300050493 Bacteria 1401
299 nmdc:mga0k408_161_c1 3300050493 Bacteria 34843
300 nmdc:mga0k408_180_c1 3300050493 Bacteria 33189
301 nmdc:mga0k408_1901_c1 3300050493 Bacteria 11173
302 nmdc:mga0k408_226028_c1 3300050493 Bacteria 1117
303 nmdc:mga0k408_227840_c1 3300050493 Bacteria 1113
304 nmdc:mga0k408_2769_c1 3300050493 Bacteria 9320
305 nmdc:mga0k408_32243_c1 3300050493 Bacteria 2994
306 nmdc:mga0k408_58692_c1 3300050493 Bacteria 2235
307 nmdc:mga0k408_76182_c1 3300050493 Bacteria 1960
308 nmdc:mga0k408_78091_c1 3300050493 Bacteria 1936
309 nmdc:mga0k408_94771_c1 3300050493 Bacteria 1756
310 nmdc:mga06z11_11307_c1 3300050494 Bacteria 3845
311 nmdc:mga06z11_96384_c1 3300050494 Bacteria 1616
312 nmdc:mga07m45_181006_c1 3300050496 Bacteria 1226
313 nmdc:mga07m45_18940_c1 3300050496 Bacteria 3725
314 nmdc:mga07m45_24569_c1 3300050496 Bacteria 3303
315 nmdc:mga07m45_260_c1 3300050496 Bacteria 21450
316 nmdc:mga07m45_31900_c1 3300050496 Bacteria 2921
317 nmdc:mga07m45_35343_c1 3300050496 Bacteria 2779
318 nmdc:mga07m45_4971_c1 3300050496 Bacteria 6562
319 nmdc:mga07m45_57700_c1 3300050496 Bacteria 2196
320 nmdc:mga07m45_59398_c1 3300050496 Bacteria 2164
321 nmdc:mga09592_3580_c1 3300050508 Bacteria 12538
322 nmdc:mga0qj67_158921_c1 3300050509 Bacteria 1834
323 nmdc:mga0qj67_49674_c1 3300050509 Bacteria 3315
324 nmdc:mga0sz30_1923_c2 3300050516 Bacteria 7090
325 Ga0500578_0002336 3300053086 Bacteria 16155
326 Ga0500658_0001840 3300053134 Bacteria 8347
327 Ga0500658_0049604 3300053134 Bacteria 1711
328 Ga0500559_0000019 3300053136 Bacteria 134862
329 Ga0500577_0001979 3300053142 Bacteria 5247
330 Ga0500604_0009570 3300053151 Bacteria 2582
331 Ga0500619_001006 3300053154 Bacteria 4865
332 Ga0500645_009531 3300053730 Bacteria 3258
333 Ga0500587_002719 3300053739 Bacteria 2504
334 Ga0466962_0027502 3300061719 Bacteria 2729
335 2587725682 2585428057 Bacteria 6737412
336 2587735117 2585428058 Bacteria 6853932
337 2587754107 2585428062 Bacteria 6842168
338 2588290613 2588253510 Bacteria 6901809
339 2643968327 2643221592 Bacteria 6608788
340 2644143520 2643221625 Bacteria 6512927
341 2644246874 2643221644 Bacteria 6865017
342 2644272105 2643221648 Bacteria 6521465
343 2644301342 2643221654 Bacteria 5273570
344 2735816385 2734482258 Unclassified 2930739
345 Ga0157375_10370444
346 JGI24740J21852_10011214
347 JGI25153J46596_10001512
348 JGI25153J46596_10006965
349 rootH1_10062733
350 rootH1_10129582
351 Ga0055524_1000109
352 Ga0055524_1000146
353 Ga0055530_10021203
354 Ga0055540_1000401
355 Ga0055540_1007525
356 Ga0055531_10001570
357 Ga0055531_10003024
358 Ga0065165_1007008
359 Ga0070658_10345909
360 Ga0070676_10002353
361 Ga0070676_10101013
362 Ga0068869_100016765
363 Ga0068868_100009022
364 Ga0070660_100193890
365 Ga0070687_100068188
366 Ga0070661_100000191
367 Ga0070675_100005231
368 Ga0070675_100349044
369 Ga0070671_100005899
370 Ga0070673_100009689
371 Ga0070659_100002121
372 Ga0070667_100039064
373 Ga0070667_100362082
374 Ga0070667_100427470
375 Ga0070708_100064215
376 Ga0070662_100081218
377 Ga0068867_100001021
378 Ga0068867_100005705
379 Ga0070706_100001272
380 Ga0070706_100083698
381 Ga0070707_100172792
382 Ga0070698_100223973
383 Ga0070672_100003578
384 Ga0070665_100068735
385 Ga0070664_100001381
386 Ga0070664_100025394
387 Ga0068856_100027385
388 Ga0068852_100240470
389 Ga0068852_100717225
390 Ga0068870_10039137
391 Ga0068863_100010638
392 Ga0068863_100081020
393 Ga0068860_100255518
394 Ga0068862_100297742
395 Ga0068862_100554362
396 Ga0075365_10042544
397 Ga0075365_10081977
398 Ga0075368_10011203
399 Ga0075368_10081721
400 Ga0075363_100034513
401 Ga0075363_100061018
402 Ga0075364_10010377
403 Ga0075362_10003105
404 Ga0075362_10009818
405 Ga0075367_10009505
406 Ga0075367_10034083
407 Ga0075369_10015885
408 Ga0075369_10150658
409 Ga0075366_10005597
410 Ga0075366_10006389
411 Ga0075366_10014216
412 Ga0075366_10047676
413 Ga0075366_10086121
414 Ga0075366_10088273
415 Ga0075370_10000655
416 Ga0075370_10009074
417 Ga0075370_10045058
418 Ga0075370_10051300
419 Ga0075430_100063044
420 Ga0075429_100004433
421 Ga0079104_1000001
422 Ga0105240_10012876
423 Ga0105245_10267279
424 Ga0105245_10597482
425 Ga0105243_10000717
426 Ga0105243_10053189
427 Ga0105242_10532352
428 Ga0105248_10017366
429 Ga0105237_10000556
430 Ga0105237_10023375
431 Ga0105238_10027759
432 Ga0105239_10003145
433 Ga0105239_10040868
434 Ga0157374_10177392
435 Ga0157378_10563487
436 Ga0157375_10006468
437 Ga0157377_10000032
438 Ga0157379_10325214
439 Ga0207425_1001180
440 Ga0209129_1000342
441 Ga0209673_1008984
442 Ga0209564_1000136
443 Ga0209758_1000045
444 Ga0209758_1000502
445 Ga0209758_1039976
446 Ga0209050_1000179
447 Ga0209256_1000015
448 Ga0209051_1000022
449 Ga0209051_1000025
450 Ga0209051_1029817
451 Ga0209257_1000030
452 Ga0209257_1000039
453 Ga0207642_10275269
454 Ga0207680_10105637
455 Ga0207645_10004178
456 Ga0207645_10134013
457 Ga0207643_10026718
458 Ga0207695_10008486
459 Ga0207671_10001994
460 Ga0207671_10031203
461 Ga0207657_10279749
462 Ga0207649_10001361
463 Ga0207646_10217939
464 Ga0207694_10012667
465 Ga0207650_10104828
466 Ga0207659_10016587
467 Ga0207659_10291587
468 Ga0207687_10229223
469 Ga0207687_10236539
470 Ga0207690_10001370
471 Ga0207706_10035099
472 Ga0207709_10001051
473 Ga0207709_10101249
474 Ga0207669_10087923
475 Ga0207704_10081424
476 Ga0207691_10008114
477 Ga0207689_10012076
478 Ga0207689_10028540
479 Ga0207679_10000313
480 Ga0207679_10035224
481 Ga0207667_10050496
482 Ga0207667_10556978
483 Ga0207658_10020803
484 Ga0207658_10027903
485 Ga0207658_10390910
486 Ga0207677_10008876
487 Ga0207641_10047762
488 Ga0207648_10000790
489 Ga0207648_10003979
490 Ga0207648_10342233
491 Ga0207674_10015017
492 Ga0207674_10131940
493 Ga0207698_10294863
494 Ga0207698_10418361
495 Ga0207698_10843048
496 Ga0209281_1000057
497 Ga0209974_10008157
498 Ga0268265_10147017
499 Ga0268265_10785356
500 Ga0268264_10087857
501 Ga0268264_10192750
502 Ga0268264_10274646
503 Ga0307517_10060715
504 Ga0307517_10062555
505 Ga0307517_10108321
506 Ga0307517_10132623
507 Ga0307517_10230151
508 Ga0307515_10000278
509 Ga0307515_10001613
510 Ga0307515_10003475
511 Ga0307515_10031234
512 Ga0307515_10054751
513 Ga0307515_10115937
514 Ga0307515_10203705
515 Ga0307512_10043660
516 Ga0265331_10015096
517 Ga0307513_10013433
518 Ga0307513_10068108
519 Ga0307513_10190417
520 Ga0307513_10227358
521 Ga0307509_10000991
522 Ga0307509_10008544
523 Ga0307509_10039110
524 Ga0307509_10058269
525 Ga0307509_10059174
526 Ga0307509_10121714
527 Ga0307508_10000043
528 Ga0307508_10003877
529 Ga0307508_10047088
530 Ga0307508_10242675
531 Ga0307508_10339288
532 Ga0307514_10084638
533 Ga0307514_10221763
534 Ga0265314_10004168
535 Ga0307516_10000674
536 Ga0307516_10000953
537 Ga0307516_10005507
538 Ga0307516_10118594
539 Ga0307405_10062828
540 Ga0307507_10052790
541 Ga0307507_10060445
542 Ga0307507_10107172
543 Ga0307510_10000294
544 Ga0307510_10027295
545 Ga0307510_10082098
546 Ga0373932_0013601
547 Ga0373931_0016307
548 Ga0373931_0228443
549 Ga0373937_0108960
550 Ga0373937_0151180
551 Ga0395899_0196796
552 Ga0395900_0000058
553 Ga0395900_0027223
554 Ga0395898_0010179
555 Ga0395905_0017590
556 Ga0395905_0083290
557 Ga0395901_0075881
558 Ga0395901_0175997
559 Ga0439447_010659
560 Ga0439466_0010664
561 Ga0439465_0003347
562 Ga0451793_0123406
563 Ga0439431_0003128
564 Ga0439433_0003917
565 Ga0439442_011665
566 Ga0439445_0002956
567 Ga0439445_0017329
568 Ga0439432_013871
569 Ga0439449_0000457
570 Ga0439449_0001290
571 Ga0439449_0001342
572 Ga0439452_001415
573 Ga0439462_0005244
574 Ga0439462_0024936
575 Ga0450911_000336
576 Ga0450920_001046
577 Ga0450909_008959
578 Ga0439434_0002526
579 Ga0450918_000014
580 Ga0450893_0001192
581 Ga0466969_0022072
582 Ga0466969_0041892
583 Ga0466969_0196215
584 Ga0466972_0008579
585 Ga0466972_0024791
586 Ga0466977_0000128
587 Ga0466965_0015004
588 Ga0466965_0087370
589 Ga0466961_0006094
590 Ga0466961_0152924
591 Ga0453684_0075694
592 Ga0466960_0016896
593 Ga0466960_0034588
594 Ga0495592_0000083
595 Ga0495590_0045839
596 Ga0495650_0007705
597 Ga0495610_0041050
598 Ga0495620_0042268
599 Ga0495632_0146949
600 Ga0495625_0014961
601 Ga0495625_0021227
602 Ga0495658_0148098
603 Ga0495649_0012911
604 Ga0495687_001691
605 Ga0495687_033978
606 Ga0495686_0085875
607 Ga0495626_0014929
608 Ga0495626_0035099
609 Ga0496102_0015544
610 Ga0496113_0004477
611 Ga0496114_0010776
612 Ga0496117_0212581
613 Ga0496121_0009385
614 Ga0496121_0016833
615 Ga0496124_0001001
616 Ga0496124_0040137
617 Ga0496125_0006171
618 Ga0496125_0007743
619 Ga0496125_0027035
620 Ga0496126_0017827
621 Ga0495682_0118507
622 Ga0501293_004549
623 Ga0501034_0252579
624 Ga0501039_0116275
625 Ga0501042_0141324
626 Ga0501043_0000057
627 Ga0501046_0000075
628 Ga0501046_0047014
629 Ga0501047_0000081
630 Ga0501048_0002921
631 Ga0501080_0069639
632 Ga0501262_001932
633 Ga0501265_000637
634 Ga0501044_0062784
635 Ga0501045_0002738
636 nmdc:mga03683_7894_c1
637 nmdc:mga00v17_210895_c1
638 nmdc:mga00v17_249083_c1
639 nmdc:mga0yw44_350218_c1
640 nmdc:mga0k408_126242_c1
641 nmdc:mga0k408_146333_c1
642 nmdc:mga0k408_147510_c1
643 nmdc:mga0k408_161_c1
644 nmdc:mga0k408_180_c1
645 nmdc:mga0k408_1901_c1
646 nmdc:mga0k408_226028_c1
647 nmdc:mga0k408_227840_c1
648 nmdc:mga0k408_2769_c1
649 nmdc:mga0k408_32243_c1
650 nmdc:mga0k408_58692_c1
651 nmdc:mga0k408_76182_c1
652 nmdc:mga0k408_78091_c1
653 nmdc:mga0k408_94771_c1
654 nmdc:mga06z11_11307_c1
655 nmdc:mga06z11_96384_c1
656 nmdc:mga07m45_181006_c1
657 nmdc:mga07m45_18940_c1
658 nmdc:mga07m45_24569_c1
659 nmdc:mga07m45_260_c1
660 nmdc:mga07m45_31900_c1
661 nmdc:mga07m45_35343_c1
662 nmdc:mga07m45_4971_c1
663 nmdc:mga07m45_57700_c1
664 nmdc:mga07m45_59398_c1
665 nmdc:mga09592_3580_c1
666 nmdc:mga0qj67_158921_c1
667 nmdc:mga0qj67_49674_c1
668 nmdc:mga0sz30_1923_c2
669 Ga0500578_0002336
670 Ga0500658_0001840
671 Ga0500658_0049604
672 Ga0500559_0000019
673 Ga0500577_0001979
674 Ga0500604_0009570
675 Ga0500619_001006
676 Ga0500645_009531
677 Ga0500587_002719
678 Ga0466962_0027502
679 2587725682
680 2587735117
681 2587754107
682 2588290613
683 2643968327
684 2644143520
685 2644246874
686 2644272105
687 2644301342
688 2735816385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08501

Shikimate_dh_N

Shikimate dehydrogenase substrate binding domain

39

121

0.98

PF18317

SDH_C

Shikimate 5'-dehydrogenase C-terminal domain

272

302

0.98

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

141

230

0.85

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

155

270

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sef-assembly2.cif.gz_C 2.4 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate and nadph 0.9675 3 276
3o8q-assembly1.cif.gz_B 1.45 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae 0.9595 1 278
3pgj-assembly2.cif.gz_C 2.49 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate 0.9589 3 276
3pgj-assembly2.cif.gz_B 2.49 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae o1 biovar eltor str. n16961 in complex with shikimate 0.9579 3 276
3o8q-assembly1.cif.gz_B 1.45 angstrom resolution crystal structure of shikimate 5-dehydrogenase (aroe) from vibrio cholerae 0.956 1 278
ID Description Score Start End Superfamily
af_P15770_4_98_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9669 5 99 2.40.10.10
af_P15770_4_98_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9569 5 99 2.40.10.10
3sefC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.949 117 223 3.40.50.720
2eggB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9461 1 276 3.40.50.10860
1p77A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9405 3 276 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A6N8J281-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9913 1 279 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A4Q5W5P3-F1-model_v4 deleted 0.9905 51 279
AF-A1TKF1-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9897 2 275 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A0Q6U395-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9889 1 275 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661
AF-A0A6N8J281-F1-model_v4 Shikimate dehydrogenase (NADP(+)) (SDH) (EC 1.1.1.25) 0.9842 1 279 GO:0004764
GO:0005829
GO:0008652
GO:0009073
GO:0009423
GO:0019632
GO:0050661

Map