F415982

General Info

Members Datasets Scaffolds Average Seq Length
344 234 689 362

Family's Representative Sequence

Representative Sequence 3300025303|Ga0209051_1001370|Ga0209051_10013705
Length 406
Sequence MRRRPLLAALWPAGWAGALAGPWPRAHGAADSPPPDNPPLGISRRPLRFPADHGAHPDTHVEWWYVTGWLRRAAASAESGRSADEAAHRPDFGFQVTFFRTRTGVAALSASRFAARQLVFAHVALTDLAAASPSGRSNGPVLLHDQRIAREGFGLAGTPGTAGRQVARLQDWTLVRPPASPGDAGTLDIAIRAERFALALTLRATQPVMLQGEDGYSQKGPLPRQASHYYSEPQLAVQGRVQRRADGASAQSADVIGRAWLDHEWSDEYLPSEAVGWDWIGFNLFDGGALMAFRLRRPDGSALWGGGTHRDARGSQRAFAAGELAFRPLRTWTSPRTGVRYPVEWQVETPVGTFRVAALADDQELDSRGSTGALYWEGLSSLAGADGRTLGWGYLELTGYAERLKM

Samples

Sample ID Description Type Environment
1 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
108 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
109 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
137 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
185 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
186 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
187 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
191 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
192 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
198 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
199 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
200 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
201 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
202 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
203 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
204 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
205 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
206 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
207 2643221658 Variovorax sp. Root411 Isolate Unclassified
208 2643221672 Variovorax sp. Root434 Isolate Unclassified
209 2643221683 Variovorax sp. Root473 Isolate Unclassified
210 2738541307 Variovorax sp. GV008 Isolate Unclassified
211 2738543013 Variovorax sp. BT01 Isolate Unclassified
212 2818991446 Variovorax sp. 1180 Isolate Unclassified
213 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
214 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
215 2842677519 Variovorax sp. R-72495 Isolate Unclassified
216 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
217 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
218 2885198086 Variovorax sp. 679 Isolate Unclassified
219 2885211737 Variovorax sp. 553 Isolate Unclassified
220 2899924645 Variovorax sp. 369 Isolate Unclassified
221 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
222 2904456579 Variovorax sp. 2002 Isolate Unclassified
223 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
224 2928037797 Variovorax sp. 1126 Isolate Unclassified
225 2928044640 Variovorax sp. 1128 Isolate Unclassified
226 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
227 2928070936 Variovorax gossypii 1167 Isolate Unclassified
228 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
229 2929520902 Variovorax beijingensis 502 Isolate Unclassified
230 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
231 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
232 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
233 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
234 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 0.87
Isolates 9.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 41.28
Nodule 0.29
Rhizoplane 1.45
Rhizosphere 42.15
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209051_1001370 3300025303 Bacteria 21049
2 JGI25156J39149_1000107 3300002705 Bacteria 59945
3 JGI25154J39366_1001935 3300002738 Bacteria 6174
4 JGI25157J39369_1000020 3300002741 Bacteria 173287
5 JGI25150J39212_1002658 3300002774 Bacteria 4376
6 JGI25159J45721_1001248 3300002987 Bacteria 10718
7 JGI25159J45721_1003167 3300002987 Bacteria 5912
8 JGI25159J45721_1005442 3300002987 Bacteria 3997
9 JGI25151J46595_10000705 3300003187 Bacteria 28005
10 JGI25151J46595_10002797 3300003187 Bacteria 10103
11 JGI25151J46595_10006420 3300003187 Bacteria 5912
12 JGI25151J46595_10007579 3300003187 Bacteria 5303
13 JGI25153J46596_10006429 3300003215 Bacteria 5939
14 JGI25153J46596_10007596 3300003215 Bacteria 5303
15 rootH1_10000505 3300003316 Bacteria 1581
16 rootH2_10002841 3300003320 Bacteria 14481
17 rootH1_10031932 3300003323 Bacteria 3451
18 rootH1_10050444 3300003316 Bacteria 5160
19 rootH1_10050444 3300003323 Bacteria 2324
20 JGI25160J50197_1001845 3300003354 Bacteria 10175
21 JGI25160J50197_1004630 3300003354 Bacteria 5912
22 JGI25161J50226_1001605 3300003374 Bacteria 6588
23 JGI25161J50226_1001761 3300003374 Bacteria 6114
24 Ga0006562J51391_1164890 3300003578 Bacteria 1225
25 Ga0006562J51391_1182103 3300003578 Bacteria 5329
26 Ga0006562J51391_1182104 3300003578 Bacteria 5313
27 Ga0055539_1000155 3300003752 Bacteria 65927
28 Ga0055539_1000799 3300003752 Bacteria 7472
29 Ga0055533_1000028 3300003756 Bacteria 311012
30 Ga0055535_1000575 3300003761 Bacteria 30861
31 Ga0055542_1000109 3300003762 Bacteria 111107
32 Ga0055529_1000619 3300003763 Bacteria 26617
33 Ga0055526_1002404 3300003771 Bacteria 12680
34 Ga0055526_1007100 3300003771 Bacteria 5912
35 Ga0055537_1001373 3300003773 Bacteria 9748
36 Ga0055537_1002602 3300003773 Bacteria 5912
37 Ga0055524_1001600 3300003775 Bacteria 12680
38 Ga0055524_1005136 3300003775 Bacteria 5912
39 Ga0055536_1001548 3300003781 Bacteria 13787
40 Ga0055534_1001370 3300003784 Bacteria 9752
41 Ga0055534_1003166 3300003784 Bacteria 5326
42 Ga0055534_1009504 3300003784 Bacteria 2107
43 Ga0055528_1002424 3300003790 Bacteria 10010
44 Ga0055528_1005471 3300003790 Bacteria 5912
45 Ga0055530_10001578 3300003791 Bacteria 16321
46 Ga0055540_1001235 3300003792 Bacteria 15714
47 Ga0055540_1001858 3300003792 Bacteria 11881
48 Ga0055540_1002365 3300003792 Bacteria 10080
49 Ga0055531_10003446 3300003794 Bacteria 10080
50 Ga0055531_10004445 3300003794 Bacteria 8528
51 Ga0055531_10008627 3300003794 Bacteria 5339
52 Ga0055543_1001178 3300004625 Bacteria 11076
53 Ga0055543_1002544 3300004625 Bacteria 5950
54 Ga0065165_1002959 3300005262 Bacteria 12935
55 Ga0065165_1003750 3300005262 Bacteria 10213
56 Ga0065165_1006677 3300005262 Bacteria 5950
57 Ga0070658_10059695 3300005327 Bacteria 3106
58 Ga0070658_10099333 3300005327 Bacteria 2405
59 Ga0070690_100010988 3300005330 Bacteria 5286
60 Ga0070660_100029506 3300005339 Bacteria 4111
61 Ga0070673_100011599 3300005364 Bacteria 6021
62 Ga0070659_100009180 3300005366 Bacteria 7256
63 Ga0070667_100006076 3300005367 Bacteria 10026
64 Ga0068853_100015947 3300005539 Bacteria 6177
65 Ga0068855_100000405 3300005563 Bacteria 53352
66 Ga0068855_100064160 3300005563 Bacteria 4284
67 Ga0070664_100047309 3300005564 Bacteria 3633
68 Ga0068857_100003994 3300005577 Bacteria 12427
69 Ga0068854_100036140 3300005578 Bacteria 3461
70 Ga0068854_100066074 3300005578 Bacteria 2631
71 Ga0068856_100000790 3300005614 Bacteria 34216
72 Ga0068861_100038339 3300005719 Bacteria 3567
73 Ga0068862_100084715 3300005844 Bacteria 2754
74 Ga0075362_10009134 3300006177 Bacteria 3818
75 Ga0075366_10049918 3300006195 Bacteria 2483
76 Ga0075370_10005461 3300006353 Bacteria 6323
77 Ga0075370_10037641 3300006353 Bacteria 2721
78 Ga0075370_10083922 3300006353 Bacteria 1833
79 Ga0075428_100065380 3300006844 Bacteria 3983
80 Ga0105244_10001556 3300009036 Bacteria 18234
81 Ga0105244_10086487 3300009036 Bacteria 1545
82 Ga0105240_10015439 3300009093 Bacteria 10385
83 Ga0105240_10051037 3300009093 Bacteria 5208
84 Ga0105240_10247291 3300009093 Bacteria 2064
85 Ga0105247_10011103 3300009101 Bacteria 5432
86 Ga0105243_10000362 3300009148 Bacteria 48567
87 Ga0105243_10005539 3300009148 Bacteria 9837
88 Ga0105243_10017939 3300009148 Bacteria 5356
89 Ga0105237_10069964 3300009545 Bacteria 3504
90 Ga0105238_10060386 3300009551 Bacteria 3795
91 Ga0105239_10043505 3300010375 Bacteria 4923
92 Ga0157373_10061610 3300013100 Bacteria 2657
93 Ga0157370_10015039 3300013104 Bacteria 7888
94 Ga0157370_10084914 3300013104 Bacteria 2974
95 Ga0163162_10231036 3300013306 Bacteria 1980
96 Ga0157372_10280073 3300013307 Bacteria 1939
97 Ga0182008_10004163 3300014497 Bacteria 8506
98 Ga0182008_10004941 3300014497 Bacteria 7686
99 Ga0182006_1008988 3300015261 Bacteria 4502
100 Ga0182007_10003476 3300015262 Bacteria 7415
101 Ga0163161_10000157 3300017792 Bacteria 62919
102 Ga0163161_10036173 3300017792 Bacteria 3536
103 Ga0213872_10012537 3300021361 Bacteria 3987
104 Ga0209436_101142 3300025208 Bacteria 9819
105 Ga0209674_100007 3300025226 Bacteria 1077082
106 Ga0209672_102943 3300025228 Bacteria 3779
107 Ga0209563_100033 3300025230 Bacteria 457883
108 Ga0207427_100501 3300025231 Bacteria 20836
109 Ga0209258_100048 3300025242 Bacteria 365881
110 Ga0209258_100575 3300025242 Bacteria 30925
111 Ga0209258_100655 3300025242 Bacteria 25327
112 Ga0207425_1001149 3300025245 Bacteria 11896
113 Ga0207425_1003165 3300025245 Bacteria 5384
114 Ga0209646_1000062 3300025246 Bacteria 252045
115 Ga0209026_1000026 3300025250 Bacteria 352109
116 Ga0209677_100082 3300025253 Bacteria 118875
117 Ga0209677_100116 3300025253 Bacteria 82606
118 Ga0209148_1000040 3300025254 Bacteria 473531
119 Ga0209759_1000050 3300025256 Bacteria 215979
120 Ga0209759_1000916 3300025256 Bacteria 21727
121 Ga0209759_1001283 3300025256 Bacteria 15000
122 Ga0209759_1002072 3300025256 Bacteria 9387
123 Ga0209129_1000083 3300025258 Bacteria 183270
124 Ga0209129_1003857 3300025258 Bacteria 6248
125 Ga0209129_1004533 3300025258 Bacteria 5370
126 Ga0209565_1001201 3300025263 Bacteria 12340
127 Ga0209565_1002397 3300025263 Bacteria 6794
128 Ga0209455_1000093 3300025272 Bacteria 220487
129 Ga0209673_1001556 3300025273 Bacteria 20644
130 Ga0209673_1001607 3300025273 Bacteria 19784
131 Ga0209673_1005055 3300025273 Bacteria 6794
132 Ga0209130_1001602 3300025284 Bacteria 14108
133 Ga0209130_1001679 3300025284 Bacteria 13484
134 Ga0209130_1002207 3300025284 Bacteria 10227
135 Ga0209675_1001120 3300025291 Bacteria 16341
136 Ga0209675_1003946 3300025291 Bacteria 6794
137 Ga0209675_1005321 3300025291 Bacteria 5418
138 Ga0209676_1000004 3300025292 Bacteria 1138360
139 Ga0209676_1001760 3300025292 Bacteria 18385
140 Ga0209676_1002922 3300025292 Bacteria 11168
141 Ga0209676_1006079 3300025292 Bacteria 6074
142 Ga0209676_1017268 3300025292 Bacteria 2562
143 Ga0209025_1005595 3300025294 Bacteria 10155
144 Ga0209025_1009280 3300025294 Bacteria 6886
145 Ga0209025_1012617 3300025294 Bacteria 5398
146 Ga0209025_1019409 3300025294 Bacteria 3782
147 Ga0209564_1002853 3300025295 Bacteria 12709
148 Ga0209564_1005805 3300025295 Bacteria 6886
149 Ga0209758_1000132 3300025297 Bacteria 183273
150 Ga0209758_1005241 3300025297 Bacteria 10155
151 Ga0209758_1010805 3300025297 Bacteria 5398
152 Ga0209050_1000002 3300025298 Bacteria 1792849
153 Ga0209050_1001170 3300025298 Bacteria 31017
154 Ga0209256_1000750 3300025299 Bacteria 42266
155 Ga0209256_1002639 3300025299 Bacteria 14108
156 Ga0207426_1000762 3300025302 Bacteria 35839
157 Ga0207426_1002041 3300025302 Bacteria 14108
158 Ga0207426_1002276 3300025302 Bacteria 12679
159 Ga0209051_1000002 3300025303 Bacteria 1631846
160 Ga0209051_1000533 3300025303 Bacteria 47141
161 Ga0209051_1000770 3300025303 Bacteria 33998
162 Ga0209051_1001870 3300025303 Bacteria 16527
163 Ga0209051_1002364 3300025303 Bacteria 13645
164 Ga0209051_1011686 3300025303 Bacteria 4312
165 Ga0209257_1000002 3300025304 Bacteria 1767052
166 Ga0209257_1000361 3300025304 Bacteria 92239
167 Ga0209257_1006334 3300025304 Bacteria 7693
168 Ga0209257_1007228 3300025304 Bacteria 6794
169 Ga0209257_1016040 3300025304 Bacteria 3060
170 Ga0207695_10075325 3300025913 Bacteria 3434
171 Ga0207671_10032164 3300025914 Bacteria 3905
172 Ga0207657_10017817 3300025919 Bacteria 6800
173 Ga0207649_10261334 3300025920 Bacteria 1251
174 Ga0207690_10050601 3300025932 Bacteria 2774
175 Ga0207709_10000323 3300025935 Bacteria 51730
176 Ga0207709_10088486 3300025935 Bacteria 2016
177 Ga0207679_10004897 3300025945 Bacteria 8346
178 Ga0207667_10007080 3300025949 Bacteria 13546
179 Ga0207667_10042485 3300025949 Bacteria 4831
180 Ga0207667_10079406 3300025949 Bacteria 3401
181 Ga0207667_10446382 3300025949 Bacteria 1315
182 Ga0207651_10002388 3300025960 Bacteria 8968
183 Ga0207640_10009561 3300025981 Bacteria 5433
184 Ga0207658_10004133 3300025986 Bacteria 10122
185 Ga0207702_10000225 3300026078 Bacteria 65968
186 Ga0207676_10017877 3300026095 Bacteria 5145
187 Ga0207674_10013546 3300026116 Bacteria 9042
188 Ga0207674_10152263 3300026116 Bacteria 2269
189 Ga0207674_10201792 3300026116 Bacteria 1938
190 Ga0268265_10056979 3300028380 Bacteria 2976
191 Ga0307517_10000644 3300028786 Bacteria 59773
192 Ga0307515_10000195 3300028794 Bacteria 148138
193 Ga0307515_10000902 3300028794 Bacteria 68371
194 Ga0307515_10006527 3300028794 Bacteria 23330
195 Ga0307512_10128583 3300030522 Bacteria 1598
196 Ga0314311_1026772 3300030733 Bacteria 4221
197 Ga0265332_10001920 3300031238 Bacteria 11004
198 Ga0307513_10011390 3300031456 Bacteria 11056
199 Ga0307513_10166904 3300031456 Bacteria 2084
200 Ga0307509_10000033 3300031507 Bacteria 194363
201 Ga0307408_100112898 3300031548 Bacteria 2090
202 Ga0307508_10074140 3300031616 Bacteria 2979
203 Ga0307514_10012861 3300031649 Bacteria 6956
204 Ga0307514_10066812 3300031649 Bacteria 2717
205 Ga0316578_10001590 3300031728 Bacteria 9374
206 Ga0307405_10009955 3300031731 Bacteria 4900
207 Ga0307405_10250066 3300031731 Bacteria 1318
208 Ga0307406_10002205 3300031901 Bacteria 10598
209 Ga0307412_10023200 3300031911 Bacteria 3814
210 Ga0307412_10100697 3300031911 Bacteria 2043
211 Ga0307412_10130835 3300031911 Bacteria 1822
212 Ga0307416_100113313 3300032002 Bacteria 2396
213 Ga0307414_10020394 3300032004 Bacteria 4131
214 Ga0307414_10045515 3300032004 Bacteria 3005
215 Ga0307411_10015511 3300032005 Bacteria 4282
216 Ga0373934_0010396 3300035086 Bacteria 3494
217 Ga0373932_0003714 3300035112 Bacteria 3646
218 Ga0373931_0002383 3300035691 Bacteria 8319
219 Ga0373931_0012816 3300035691 Bacteria 4070
220 Ga0373947_0241563 3300035725 Bacteria 1192
221 Ga0373925_0077575 3300037068 Bacteria 2522
222 Ga0395901_0038816 3300038443 Bacteria 4925
223 Ga0436361_0606884 3300039447 Bacteria 4680
224 Ga0439436_0002689 3300041404 Bacteria 5364
225 Ga0439447_025969 3300041407 Bacteria 1505
226 Ga0439465_0007887 3300041413 Bacteria 3373
227 Ga0451807_0003847 3300041486 Bacteria 2494
228 Ga0439431_0010222 3300041997 Bacteria 2127
229 Ga0439433_0008519 3300041999 Bacteria 2225
230 Ga0439442_012563 3300042002 Bacteria 1731
231 Ga0439432_001197 3300042006 Bacteria 9813
232 Ga0439449_0042669 3300042007 Bacteria 1685
233 Ga0439449_0066217 3300042007 Bacteria 1332
234 Ga0439452_001501 3300042010 Bacteria 9458
235 Ga0439457_007065 3300042014 Bacteria 2709
236 Ga0439462_0009604 3300042015 Bacteria 2446
237 Ga0439446_0030792 3300042156 Bacteria 1551
238 Ga0439434_0001920 3300042435 Bacteria 6024
239 Ga0495629_0111319 3300046459 Bacteria 1909
240 Ga0495638_0073946 3300046460 Bacteria 2079
241 Ga0495639_0004933 3300046475 Bacteria 5722
242 Ga0495585_0012962 3300046492 Bacteria 4898
243 Ga0495583_0000245 3300046506 Bacteria 89398
244 Ga0495606_0073007 3300046507 Bacteria 2154
245 Ga0495606_0092797 3300046507 Bacteria 1853
246 Ga0495610_0043666 3300046512 Bacteria 2231
247 Ga0495616_0002253 3300046513 Bacteria 12909
248 Ga0495620_0031449 3300046515 Bacteria 2432
249 Ga0495631_0000589 3300046518 Bacteria 24095
250 Ga0495637_0021145 3300046520 Bacteria 2985
251 Ga0495637_0049706 3300046520 Bacteria 1760
252 Ga0495654_0040331 3300046530 Bacteria 2327
253 Ga0495668_0158500 3300046616 Bacteria 1240
254 Ga0495625_0003582 3300046660 Bacteria 15309
255 Ga0495625_0006197 3300046660 Bacteria 10714
256 Ga0495625_0054593 3300046660 Bacteria 2852
257 Ga0495661_0123124 3300046665 Bacteria 1430
258 Ga0495588_0008286 3300046674 Bacteria 4762
259 Ga0495588_0018052 3300046674 Bacteria 3435
260 Ga0495588_0066016 3300046674 Bacteria 1878
261 Ga0495669_0032072 3300046684 Unclassified 2308
262 Ga0495624_0037607 3300046690 Bacteria 3112
263 Ga0495624_0057068 3300046690 Bacteria 2456
264 Ga0495671_0025107 3300046692 Bacteria 3099
265 Ga0495649_0000400 3300046694 Bacteria 37554
266 Ga0495589_0049481 3300046794 Bacteria 2080
267 Ga0495660_0083053 3300046810 Bacteria 1676
268 Ga0495676_0024655 3300047321 Bacteria 5203
269 Ga0495593_0025212 3300047673 Bacteria 3291
270 Ga0495602_0100312 3300048088 Bacteria 2378
271 Ga0495614_0002409 3300048089 Bacteria 8314
272 Ga0496109_0183289 3300048912 Bacteria 1967
273 Ga0496117_0026477 3300048920 Bacteria 4537
274 Ga0496117_0069663 3300048920 Bacteria 2367
275 Ga0496118_0004662 3300048921 Bacteria 16079
276 Ga0496118_0031865 3300048921 Bacteria 4359
277 Ga0496121_0097186 3300048924 Bacteria 2283
278 Ga0496121_0143337 3300048924 Bacteria 1769
279 Ga0496125_0003750 3300048928 Bacteria 18096
280 Ga0501262_001268 3300049759 Bacteria 2834
281 nmdc:mga03683_825_c2 3300050489 Bacteria 4086
282 nmdc:mga03n38_39079_c1 3300050490 Bacteria 2056
283 nmdc:mga07m45_16754_c1 3300050496 Bacteria 3926
284 nmdc:mga07m45_422_c1 3300050496 Bacteria 17511
285 nmdc:mga07m45_75726_c1 3300050496 Bacteria 1918
286 nmdc:mga07m45_77891_c1 3300050496 Bacteria 1891
287 nmdc:mga0sz30_26500_c1 3300050516 Bacteria 2376
288 Ga0500610_0015348 3300053079 Bacteria 3624
289 Ga0500610_0034433 3300053079 Bacteria 2591
290 Ga0500610_0100938 3300053079 Bacteria 1493
291 Ga0500635_0000160 3300053080 Bacteria 36139
292 Ga0500643_026677 3300053087 Bacteria 1805
293 Ga0500651_0000164 3300053093 Bacteria 42896
294 Ga0500562_009099 3300053108 Bacteria 2511
295 Ga0500571_059565 3300053110 Bacteria 1971
296 Ga0500593_014349 3300053117 Bacteria 3397
297 Ga0500607_037464 3300053121 Bacteria 2642
298 Ga0500608_063994 3300053122 Bacteria 1755
299 Ga0500618_023646 3300053125 Bacteria 1486
300 Ga0500626_039844 3300053128 Bacteria 2125
301 Ga0500655_005500 3300053133 Bacteria 2283
302 Ga0500658_0000132 3300053134 Bacteria 35240
303 Ga0500658_0000180 3300053134 Bacteria 30355
304 Ga0500559_0033637 3300053136 Bacteria 2207
305 Ga0500564_036993 3300053138 Bacteria 2251
306 Ga0500568_0000864 3300053139 Bacteria 21265
307 Ga0500616_0090579 3300053153 Bacteria 1515
308 Ga0500627_0010611 3300053158 Bacteria 3366
309 Ga0500634_0091598 3300053161 Bacteria 1541
310 Ga0500638_031955 3300053162 Bacteria 2540
311 Ga0500661_005716 3300055283 Bacteria 2318
312 2513230767 2513020051 Bacteria 6053213
313 2599622952 2599185214 Bacteria 8209958
314 2599671431 2599185226 Bacteria 8233575
315 2599679532 2599185227 Bacteria 8246414
316 2599691548 2599185229 Bacteria 8216126
317 2644304112 2643221654 Bacteria 5273570
318 2644325079 2643221658 Bacteria 6064537
319 2644400193 2643221672 Bacteria 6322190
320 2644467633 2643221683 Bacteria 5749203
321 2738886627 2738541307 Bacteria 8606193
322 2739252275 2738543013 Bacteria 5618633
323 2819602255 2818991446 Bacteria 7757362
324 2831265783 2831265667 Bacteria 7184833
325 2838056497 2838054893 Bacteria 7451788
326 2842681765 2842677519 Bacteria 5615038
327 2881101168 2881101125 Bacteria 4590519
328 2885196127 2885192300 Bacteria 5882526
329 2885203367 2885198086 Bacteria 7212419
330 2885217283 2885211737 Bacteria 7212420
331 2899930534 2899924645 Bacteria 7487985
332 2904456324 2904449895 Bacteria 6927402
333 2904462833 2904456579 Bacteria 6819253
334 2919463992 2919462493 Bacteria 5817112
335 2928039648 2928037797 Bacteria 7273642
336 2928044747 2928044640 Bacteria 7271509
337 2928064790 2928064002 Bacteria 7419480
338 2928074742 2928070936 Bacteria 8062541
339 2928087122 2928084124 Bacteria 7159212
340 2929524416 2929520902 Bacteria 6765052
341 2945910943 2945909444 Bacteria 7065066
342 2945946803 2945945610 Bacteria 5951079
343 2945976517 2945972063 Bacteria 6086495
344 2945986821 2945984333 Bacteria 7358892
345 2954771541 2954767861 Bacteria 5535784
346 Ga0209051_1001370
347 JGI25156J39149_1000107
348 JGI25154J39366_1001935
349 JGI25157J39369_1000020
350 JGI25150J39212_1002658
351 JGI25159J45721_1001248
352 JGI25159J45721_1003167
353 JGI25159J45721_1005442
354 JGI25151J46595_10000705
355 JGI25151J46595_10002797
356 JGI25151J46595_10006420
357 JGI25151J46595_10007579
358 JGI25153J46596_10006429
359 JGI25153J46596_10007596
360 rootH1_10000505
361 rootH2_10002841
362 rootH1_10031932
363 rootH1_10050444
364 JGI25160J50197_1001845
365 JGI25160J50197_1004630
366 JGI25161J50226_1001605
367 JGI25161J50226_1001761
368 Ga0006562J51391_1164890
369 Ga0006562J51391_1182103
370 Ga0006562J51391_1182104
371 Ga0055539_1000155
372 Ga0055539_1000799
373 Ga0055533_1000028
374 Ga0055535_1000575
375 Ga0055542_1000109
376 Ga0055529_1000619
377 Ga0055526_1002404
378 Ga0055526_1007100
379 Ga0055537_1001373
380 Ga0055537_1002602
381 Ga0055524_1001600
382 Ga0055524_1005136
383 Ga0055536_1001548
384 Ga0055534_1001370
385 Ga0055534_1003166
386 Ga0055534_1009504
387 Ga0055528_1002424
388 Ga0055528_1005471
389 Ga0055530_10001578
390 Ga0055540_1001235
391 Ga0055540_1001858
392 Ga0055540_1002365
393 Ga0055531_10003446
394 Ga0055531_10004445
395 Ga0055531_10008627
396 Ga0055543_1001178
397 Ga0055543_1002544
398 Ga0065165_1002959
399 Ga0065165_1003750
400 Ga0065165_1006677
401 Ga0070658_10059695
402 Ga0070658_10099333
403 Ga0070690_100010988
404 Ga0070660_100029506
405 Ga0070673_100011599
406 Ga0070659_100009180
407 Ga0070667_100006076
408 Ga0068853_100015947
409 Ga0068855_100000405
410 Ga0068855_100064160
411 Ga0070664_100047309
412 Ga0068857_100003994
413 Ga0068854_100036140
414 Ga0068854_100066074
415 Ga0068856_100000790
416 Ga0068861_100038339
417 Ga0068862_100084715
418 Ga0075362_10009134
419 Ga0075366_10049918
420 Ga0075370_10005461
421 Ga0075370_10037641
422 Ga0075370_10083922
423 Ga0075428_100065380
424 Ga0105244_10001556
425 Ga0105244_10086487
426 Ga0105240_10015439
427 Ga0105240_10051037
428 Ga0105240_10247291
429 Ga0105247_10011103
430 Ga0105243_10000362
431 Ga0105243_10005539
432 Ga0105243_10017939
433 Ga0105237_10069964
434 Ga0105238_10060386
435 Ga0105239_10043505
436 Ga0157373_10061610
437 Ga0157370_10015039
438 Ga0157370_10084914
439 Ga0163162_10231036
440 Ga0157372_10280073
441 Ga0182008_10004163
442 Ga0182008_10004941
443 Ga0182006_1008988
444 Ga0182007_10003476
445 Ga0163161_10000157
446 Ga0163161_10036173
447 Ga0213872_10012537
448 Ga0209436_101142
449 Ga0209674_100007
450 Ga0209672_102943
451 Ga0209563_100033
452 Ga0207427_100501
453 Ga0209258_100048
454 Ga0209258_100575
455 Ga0209258_100655
456 Ga0207425_1001149
457 Ga0207425_1003165
458 Ga0209646_1000062
459 Ga0209026_1000026
460 Ga0209677_100082
461 Ga0209677_100116
462 Ga0209148_1000040
463 Ga0209759_1000050
464 Ga0209759_1000916
465 Ga0209759_1001283
466 Ga0209759_1002072
467 Ga0209129_1000083
468 Ga0209129_1003857
469 Ga0209129_1004533
470 Ga0209565_1001201
471 Ga0209565_1002397
472 Ga0209455_1000093
473 Ga0209673_1001556
474 Ga0209673_1001607
475 Ga0209673_1005055
476 Ga0209130_1001602
477 Ga0209130_1001679
478 Ga0209130_1002207
479 Ga0209675_1001120
480 Ga0209675_1003946
481 Ga0209675_1005321
482 Ga0209676_1000004
483 Ga0209676_1001760
484 Ga0209676_1002922
485 Ga0209676_1006079
486 Ga0209676_1017268
487 Ga0209025_1005595
488 Ga0209025_1009280
489 Ga0209025_1012617
490 Ga0209025_1019409
491 Ga0209564_1002853
492 Ga0209564_1005805
493 Ga0209758_1000132
494 Ga0209758_1005241
495 Ga0209758_1010805
496 Ga0209050_1000002
497 Ga0209050_1001170
498 Ga0209256_1000750
499 Ga0209256_1002639
500 Ga0207426_1000762
501 Ga0207426_1002041
502 Ga0207426_1002276
503 Ga0209051_1000002
504 Ga0209051_1000533
505 Ga0209051_1000770
506 Ga0209051_1001870
507 Ga0209051_1002364
508 Ga0209051_1011686
509 Ga0209257_1000002
510 Ga0209257_1000361
511 Ga0209257_1006334
512 Ga0209257_1007228
513 Ga0209257_1016040
514 Ga0207695_10075325
515 Ga0207671_10032164
516 Ga0207657_10017817
517 Ga0207649_10261334
518 Ga0207690_10050601
519 Ga0207709_10000323
520 Ga0207709_10088486
521 Ga0207679_10004897
522 Ga0207667_10007080
523 Ga0207667_10042485
524 Ga0207667_10079406
525 Ga0207667_10446382
526 Ga0207651_10002388
527 Ga0207640_10009561
528 Ga0207658_10004133
529 Ga0207702_10000225
530 Ga0207676_10017877
531 Ga0207674_10013546
532 Ga0207674_10152263
533 Ga0207674_10201792
534 Ga0268265_10056979
535 Ga0307517_10000644
536 Ga0307515_10000195
537 Ga0307515_10000902
538 Ga0307515_10006527
539 Ga0307512_10128583
540 Ga0314311_1026772
541 Ga0265332_10001920
542 Ga0307513_10011390
543 Ga0307513_10166904
544 Ga0307509_10000033
545 Ga0307408_100112898
546 Ga0307508_10074140
547 Ga0307514_10012861
548 Ga0307514_10066812
549 Ga0316578_10001590
550 Ga0307405_10009955
551 Ga0307405_10250066
552 Ga0307406_10002205
553 Ga0307412_10023200
554 Ga0307412_10100697
555 Ga0307412_10130835
556 Ga0307416_100113313
557 Ga0307414_10020394
558 Ga0307414_10045515
559 Ga0307411_10015511
560 Ga0373934_0010396
561 Ga0373932_0003714
562 Ga0373931_0002383
563 Ga0373931_0012816
564 Ga0373947_0241563
565 Ga0373925_0077575
566 Ga0395901_0038816
567 Ga0436361_0606884
568 Ga0439436_0002689
569 Ga0439447_025969
570 Ga0439465_0007887
571 Ga0451807_0003847
572 Ga0439431_0010222
573 Ga0439433_0008519
574 Ga0439442_012563
575 Ga0439432_001197
576 Ga0439449_0042669
577 Ga0439449_0066217
578 Ga0439452_001501
579 Ga0439457_007065
580 Ga0439462_0009604
581 Ga0439446_0030792
582 Ga0439434_0001920
583 Ga0495629_0111319
584 Ga0495638_0073946
585 Ga0495639_0004933
586 Ga0495585_0012962
587 Ga0495583_0000245
588 Ga0495606_0073007
589 Ga0495606_0092797
590 Ga0495610_0043666
591 Ga0495616_0002253
592 Ga0495620_0031449
593 Ga0495631_0000589
594 Ga0495637_0021145
595 Ga0495637_0049706
596 Ga0495654_0040331
597 Ga0495668_0158500
598 Ga0495625_0003582
599 Ga0495625_0006197
600 Ga0495625_0054593
601 Ga0495661_0123124
602 Ga0495588_0008286
603 Ga0495588_0018052
604 Ga0495588_0066016
605 Ga0495669_0032072
606 Ga0495624_0037607
607 Ga0495624_0057068
608 Ga0495671_0025107
609 Ga0495649_0000400
610 Ga0495589_0049481
611 Ga0495660_0083053
612 Ga0495676_0024655
613 Ga0495593_0025212
614 Ga0495602_0100312
615 Ga0495614_0002409
616 Ga0496109_0183289
617 Ga0496117_0026477
618 Ga0496117_0069663
619 Ga0496118_0004662
620 Ga0496118_0031865
621 Ga0496121_0097186
622 Ga0496121_0143337
623 Ga0496125_0003750
624 Ga0501262_001268
625 nmdc:mga03683_825_c2
626 nmdc:mga03n38_39079_c1
627 nmdc:mga07m45_16754_c1
628 nmdc:mga07m45_422_c1
629 nmdc:mga07m45_75726_c1
630 nmdc:mga07m45_77891_c1
631 nmdc:mga0sz30_26500_c1
632 Ga0500610_0015348
633 Ga0500610_0034433
634 Ga0500610_0100938
635 Ga0500635_0000160
636 Ga0500643_026677
637 Ga0500651_0000164
638 Ga0500562_009099
639 Ga0500571_059565
640 Ga0500593_014349
641 Ga0500607_037464
642 Ga0500608_063994
643 Ga0500618_023646
644 Ga0500626_039844
645 Ga0500655_005500
646 Ga0500658_0000132
647 Ga0500658_0000180
648 Ga0500559_0033637
649 Ga0500564_036993
650 Ga0500568_0000864
651 Ga0500616_0090579
652 Ga0500627_0010611
653 Ga0500634_0091598
654 Ga0500638_031955
655 Ga0500661_005716
656 2513230767
657 2599622952
658 2599671431
659 2599679532
660 2599691548
661 2644304112
662 2644325079
663 2644400193
664 2644467633
665 2738886627
666 2739252275
667 2819602255
668 2831265783
669 2838056497
670 2842681765
671 2881101168
672 2885196127
673 2885203367
674 2885217283
675 2899930534
676 2904456324
677 2904462833
678 2919463992
679 2928039648
680 2928044747
681 2928064790
682 2928074742
683 2928087122
684 2929524416
685 2945910943
686 2945946803
687 2945976517
688 2945986821
689 2954771541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17186

Lipocalin_9

Lipocalin-like domain

270

400

0.96

PF07143

CrtC

CrtC N-terminal lipocalin domain

61

267

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.9272 36 371
2ich-assembly1.cif.gz_A crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.921 33 371
2ich-assembly1.cif.gz_A crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.9126 33 371
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.9077 36 371
7a0q-assembly1.cif.gz_A crystal structure of kievitone hydratase from nectria haematococca (c2 sg) 0.6989 34 373
ID Description Score Start End Superfamily
2ichA02 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.9245 245 371 2.40.370.10
2ichA02 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.9105 245 371 2.40.370.10
2ichA01 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8876 43 244 2.40.370.10
2ichA01 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8829 43 244 2.40.370.10
af_O86370_59_249_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.877 43 242 2.40.370.10
ID Description Score Start End GO Terms
AF-A0A257GX40-F1-model_v4 Uncharacterized protein 0.9813 255 377
AF-A0A4Q3K823-F1-model_v4 deleted 0.9748 183 377
AF-A0A3C0KDV8-F1-model_v4 Carotenoid 1,2-hydratase 0.9732 234 377
AF-A0A2N2V8H4-F1-model_v4 Carotenoid 1,2-hydratase 0.9701 164 377
AF-A0A4Q3K823-F1-model_v4 deleted 0.9602 183 377

Map