F415986

General Info

Members Datasets Scaffolds Average Seq Length
344 147 688 202

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10157813|Ga0207699_101578133
Length 234
Sequence VQKIRALFWDVGGVLLTNAWDHEERDQAVEKFLLAKTKFEERHKELVPMFEEGNLSLDDYLDRVIFYEPRTFSREEFKQFIFSLSKPKPQSLELAKALSAKYFMGTINNESRELNEYRIQSFGLAEYFDVFVSSCYVALRKPDQRIYKLALDLTQHTPEECCFIDDRPPNIEGATKAGFATVLMRDPQQLRRDLQALGIEPSTVHPIFRQGFILPRALRLLQSSTACAPPFVPG

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
65 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 1.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.78
Rhizosphere 95.35
Stem 0
Stem Tuber 0
Unclassified 25.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10157813 3300025906 Unclassified 1507
2 Ga0070683_100048298 3300005329 Unclassified 3935
3 Ga0070683_100070083 3300005329 Unclassified 3271
4 Ga0070683_100273104 3300005329 Unclassified 1608
5 Ga0070690_100039578 3300005330 Bacteria 2978
6 Ga0070690_100075248 3300005330 Bacteria 2201
7 Ga0068869_100005664 3300005334 Bacteria 7874
8 Ga0070680_100121670 3300005336 Unclassified 2179
9 Ga0070680_100265110 3300005336 Bacteria 1454
10 Ga0068868_100012075 3300005338 Bacteria 6307
11 Ga0068868_100139374 3300005338 Bacteria 1990
12 Ga0070689_100183418 3300005340 Unclassified 1701
13 Ga0070691_10089093 3300005341 Unclassified 1519
14 Ga0070687_100020545 3300005343 Unclassified 3089
15 Ga0070671_100053582 3300005355 Bacteria 3353
16 Ga0070673_100514399 3300005364 Bacteria 1084
17 Ga0070709_10000357 3300005434 Bacteria 28272
18 Ga0070709_10086292 3300005434 Bacteria 2060
19 Ga0070709_10193965 3300005434 Bacteria 1435
20 Ga0070709_10231890 3300005434 Bacteria 1321
21 Ga0070709_10575702 3300005434 Bacteria 864
22 Ga0070709_10587311 3300005434 Unclassified 856
23 Ga0070709_10637535 3300005434 Bacteria 824
24 Ga0070709_10798945 3300005434 Bacteria 740
25 Ga0070714_100039928 3300005435 Bacteria 3954
26 Ga0070714_100063593 3300005435 Bacteria 3174
27 Ga0070714_100096936 3300005435 Bacteria 2592
28 Ga0070714_100105612 3300005435 Unclassified 2487
29 Ga0070714_100230399 3300005435 Bacteria 1706
30 Ga0070714_100326430 3300005435 Unclassified 1436
31 Ga0070714_100335914 3300005435 Bacteria 1416
32 Ga0070714_100426630 3300005435 Unclassified 1257
33 Ga0070714_100751804 3300005435 Bacteria 943
34 Ga0070713_100000330 3300005436 Bacteria 31020
35 Ga0070713_100005884 3300005436 Bacteria 8432
36 Ga0070713_100025346 3300005436 Bacteria 4635
37 Ga0070713_100078650 3300005436 Bacteria 2808
38 Ga0070713_100101503 3300005436 Bacteria 2493
39 Ga0070713_100122554 3300005436 Bacteria 2282
40 Ga0070713_100560028 3300005436 Unclassified 1083
41 Ga0070710_10002243 3300005437 Bacteria 9144
42 Ga0070710_10058068 3300005437 Bacteria 2194
43 Ga0070710_10752733 3300005437 Unclassified 692
44 Ga0070711_100025091 3300005439 Bacteria 3896
45 Ga0070711_100112159 3300005439 Bacteria 2003
46 Ga0070711_100178018 3300005439 Bacteria 1626
47 Ga0070711_100178544 3300005439 Bacteria 1624
48 Ga0070711_100692796 3300005439 Bacteria 857
49 Ga0070711_100748730 3300005439 Bacteria 826
50 Ga0070708_100034360 3300005445 Unclassified 4411
51 Ga0070662_100246227 3300005457 Unclassified 1435
52 Ga0070681_10000195 3300005458 Bacteria 47245
53 Ga0070681_10282447 3300005458 Unclassified 1570
54 Ga0070706_100463931 3300005467 Bacteria 1178
55 Ga0070707_100476496 3300005468 Unclassified 1209
56 Ga0070707_100771137 3300005468 Bacteria 925
57 Ga0070679_100013742 3300005530 Bacteria 7756
58 Ga0070679_100526407 3300005530 Bacteria 1126
59 Ga0070684_100005845 3300005535 Bacteria 9466
60 Ga0070684_100046453 3300005535 Unclassified 3762
61 Ga0070697_100005539 3300005536 Bacteria 9731
62 Ga0070697_100160205 3300005536 Bacteria 1901
63 Ga0068853_100022540 3300005539 Bacteria 5260
64 Ga0068853_100205133 3300005539 Bacteria 1795
65 Ga0070693_100174771 3300005547 Unclassified 1378
66 Ga0070665_100853962 3300005548 Unclassified 923
67 Ga0068855_100000978 3300005563 Bacteria 35574
68 Ga0068855_100005912 3300005563 Bacteria 14919
69 Ga0068855_100009066 3300005563 Bacteria 12023
70 Ga0068855_100090039 3300005563 Bacteria 3542
71 Ga0068855_100311448 3300005563 Bacteria 1741
72 Ga0068855_100845806 3300005563 Unclassified 970
73 Ga0070664_100001252 3300005564 Bacteria 20328
74 Ga0070664_100132746 3300005564 Bacteria 2188
75 Ga0070664_100151630 3300005564 Bacteria 2047
76 Ga0068857_100000437 3300005577 Bacteria 29548
77 Ga0068857_100002172 3300005577 Bacteria 15945
78 Ga0068854_100011436 3300005578 Bacteria 5780
79 Ga0068854_100060772 3300005578 Bacteria 2735
80 Ga0068854_100375532 3300005578 Bacteria 1170
81 Ga0068856_100000107 3300005614 Bacteria 81707
82 Ga0068856_100000483 3300005614 Bacteria 44122
83 Ga0068856_100000812 3300005614 Bacteria 33746
84 Ga0068856_100002817 3300005614 Bacteria 17805
85 Ga0068856_100013864 3300005614 Bacteria 7795
86 Ga0068852_100038607 3300005616 Unclassified 4015
87 Ga0068852_100307976 3300005616 Unclassified 1535
88 Ga0068859_100000951 3300005617 Bacteria 29624
89 Ga0068859_100381290 3300005617 Bacteria 1505
90 Ga0068864_100007554 3300005618 Bacteria 8957
91 Ga0068864_100026305 3300005618 Bacteria 4908
92 Ga0068866_10146739 3300005718 Bacteria 1361
93 Ga0068861_100808658 3300005719 Unclassified 880
94 Ga0068851_10361975 3300005834 Unclassified 846
95 Ga0068858_100002793 3300005842 Bacteria 17549
96 Ga0068858_100241850 3300005842 Bacteria 1713
97 Ga0068860_100004530 3300005843 Bacteria 14182
98 Ga0068860_100670933 3300005843 Unclassified 1045
99 Ga0070717_10013225 3300006028 Bacteria 6315
100 Ga0070717_10020262 3300006028 Bacteria 5226
101 Ga0070717_10023176 3300006028 Bacteria 4915
102 Ga0070717_10023247 3300006028 Bacteria 4909
103 Ga0070717_10065406 3300006028 Unclassified 3023
104 Ga0070717_10069651 3300006028 Bacteria 2930
105 Ga0070717_10290703 3300006028 Unclassified 1451
106 Ga0070717_10395569 3300006028 Unclassified 1241
107 Ga0070717_10726244 3300006028 Bacteria 903
108 Ga0070717_10810878 3300006028 Unclassified 851
109 Ga0070715_10003381 3300006163 Bacteria 5059
110 Ga0070716_100000383 3300006173 Bacteria 18047
111 Ga0070716_100030351 3300006173 Bacteria 2931
112 Ga0070716_100121250 3300006173 Bacteria 1637
113 Ga0070716_100192295 3300006173 Bacteria 1349
114 Ga0070712_100000030 3300006175 Bacteria 72702
115 Ga0070712_100014308 3300006175 Bacteria 5094
116 Ga0070712_100073599 3300006175 Bacteria 2451
117 Ga0070712_100394447 3300006175 Bacteria 1142
118 Ga0097621_100003554 3300006237 Bacteria 10768
119 Ga0097621_100004921 3300006237 Bacteria 9369
120 Ga0097621_100054438 3300006237 Unclassified 3263
121 Ga0097621_100218739 3300006237 Unclassified 1659
122 Ga0097621_100444864 3300006237 Unclassified 1167
123 Ga0068871_100000410 3300006358 Bacteria 29656
124 Ga0068871_100001081 3300006358 Bacteria 18287
125 Ga0068871_100180442 3300006358 Unclassified 1814
126 Ga0068865_100050996 3300006881 Unclassified 2862
127 Ga0068865_100067026 3300006881 Bacteria 2534
128 Ga0097620_100000951 3300006931 Bacteria 29624
129 Ga0097620_100381341 3300006931 Bacteria 1505
130 Ga0105240_10002618 3300009093 Bacteria 28698
131 Ga0105240_10020773 3300009093 Bacteria 8747
132 Ga0105240_10137738 3300009093 Bacteria 2921
133 Ga0105240_10318127 3300009093 Bacteria 1775
134 Ga0105240_10333036 3300009093 Bacteria 1727
135 Ga0105240_10433865 3300009093 Unclassified 1474
136 Ga0105240_10561654 3300009093 Bacteria 1261
137 Ga0105241_10142502 3300009174 Bacteria 1953
138 Ga0105241_10151750 3300009174 Unclassified 1896
139 Ga0105241_10867758 3300009174 Unclassified 836
140 Ga0105248_10003183 3300009177 Bacteria 18192
141 Ga0105248_10168819 3300009177 Bacteria 2466
142 Ga0105237_10119482 3300009545 Bacteria 2630
143 Ga0105237_10229352 3300009545 Bacteria 1858
144 Ga0105237_10292913 3300009545 Bacteria 1630
145 Ga0105237_10551401 3300009545 Unclassified 1159
146 Ga0105237_10723192 3300009545 Unclassified 1002
147 Ga0105238_10000090 3300009551 Bacteria 102374
148 Ga0105238_10059240 3300009551 Bacteria 3836
149 Ga0105238_10136946 3300009551 Bacteria 2426
150 Ga0105238_10235865 3300009551 Unclassified 1806
151 Ga0105238_10501380 3300009551 Unclassified 1215
152 Ga0105238_10555011 3300009551 Unclassified 1153
153 Ga0105239_10015829 3300010375 Bacteria 8347
154 Ga0105239_10036107 3300010375 Bacteria 5427
155 Ga0105239_10475244 3300010375 Unclassified 1420
156 Ga0105239_10687471 3300010375 Unclassified 1169
157 Ga0157371_10157248 3300013102 Bacteria 1623
158 Ga0157370_10153590 3300013104 Bacteria 2142
159 Ga0157370_10167724 3300013104 Unclassified 2041
160 Ga0157369_10005632 3300013105 Bacteria 14551
161 Ga0157369_10059227 3300013105 Bacteria 4129
162 Ga0157369_10137923 3300013105 Bacteria 2581
163 Ga0157369_10254232 3300013105 Unclassified 1833
164 Ga0157374_10000305 3300013296 Bacteria 45523
165 Ga0157374_10000684 3300013296 Bacteria 29878
166 Ga0157374_10001524 3300013296 Bacteria 19513
167 Ga0157374_10047123 3300013296 Bacteria 3995
168 Ga0157374_10093411 3300013296 Bacteria 2872
169 Ga0157378_10000265 3300013297 Bacteria 50886
170 Ga0157378_10001362 3300013297 Bacteria 21956
171 Ga0157378_10017027 3300013297 Bacteria 6372
172 Ga0157378_10020663 3300013297 Bacteria 5791
173 Ga0157372_10000766 3300013307 Bacteria 34848
174 Ga0157372_10001033 3300013307 Bacteria 30439
175 Ga0157372_10002516 3300013307 Bacteria 19887
176 Ga0157372_10010175 3300013307 Bacteria 9987
177 Ga0157372_10015853 3300013307 Bacteria 8084
178 Ga0157372_10025715 3300013307 Bacteria 6404
179 Ga0157372_10057145 3300013307 Bacteria 4361
180 Ga0157372_10123491 3300013307 Bacteria 2976
181 Ga0163163_10170022 3300014325 Unclassified 2226
182 Ga0157377_10106835 3300014745 Unclassified 1677
183 Ga0157376_10011558 3300014969 Bacteria 6514
184 Ga0157376_10019983 3300014969 Bacteria 5172
185 Ga0224570_103327 3300022730 Bacteria 1023
186 Ga0224572_1001704 3300024225 Unclassified 3339
187 Ga0207656_10160534 3300025321 Unclassified 1069
188 Ga0207692_10020078 3300025898 Bacteria 3032
189 Ga0207692_10154502 3300025898 Unclassified 1317
190 Ga0207692_10160145 3300025898 Bacteria 1296
191 Ga0207647_10048602 3300025904 Bacteria 2634
192 Ga0207685_10002236 3300025905 Bacteria 4383
193 Ga0207685_10166995 3300025905 Bacteria 1009
194 Ga0207699_10000657 3300025906 Bacteria 16671
195 Ga0207699_10078491 3300025906 Bacteria 2039
196 Ga0207699_10092420 3300025906 Bacteria 1902
197 Ga0207699_10164683 3300025906 Bacteria 1479
198 Ga0207654_10151987 3300025911 Bacteria 1487
199 Ga0207707_10001239 3300025912 Bacteria 23957
200 Ga0207707_10005687 3300025912 Bacteria 10909
201 Ga0207707_10062791 3300025912 Bacteria 3233
202 Ga0207695_10004905 3300025913 Bacteria 18026
203 Ga0207695_10050045 3300025913 Bacteria 4398
204 Ga0207695_10655536 3300025913 Bacteria 931
205 Ga0207671_10074026 3300025914 Bacteria 2545
206 Ga0207671_10136641 3300025914 Bacteria 1885
207 Ga0207671_10465873 3300025914 Bacteria 1007
208 Ga0207693_10000024 3300025915 Bacteria 125885
209 Ga0207693_10008761 3300025915 Bacteria 8270
210 Ga0207693_10014119 3300025915 Bacteria 6432
211 Ga0207693_10041239 3300025915 Bacteria 3634
212 Ga0207663_10003427 3300025916 Bacteria 7762
213 Ga0207663_10256067 3300025916 Bacteria 1290
214 Ga0207663_10898711 3300025916 Unclassified 708
215 Ga0207660_10145493 3300025917 Bacteria 1816
216 Ga0207652_10022711 3300025921 Bacteria 5194
217 Ga0207652_10427715 3300025921 Unclassified 1194
218 Ga0207646_10049585 3300025922 Unclassified 3760
219 Ga0207646_10555210 3300025922 Unclassified 1032
220 Ga0207694_10001381 3300025924 Bacteria 20900
221 Ga0207700_10000479 3300025928 Bacteria 23487
222 Ga0207700_10037479 3300025928 Bacteria 3511
223 Ga0207700_10037836 3300025928 Bacteria 3498
224 Ga0207700_10347340 3300025928 Unclassified 1291
225 Ga0207700_10452892 3300025928 Bacteria 1131
226 Ga0207664_10064079 3300025929 Bacteria 2938
227 Ga0207664_10080749 3300025929 Unclassified 2644
228 Ga0207664_10315412 3300025929 Bacteria 1378
229 Ga0207664_10319409 3300025929 Bacteria 1370
230 Ga0207664_10518243 3300025929 Bacteria 1068
231 Ga0207644_10044417 3300025931 Bacteria 3157
232 Ga0207706_10222343 3300025933 Bacteria 1653
233 Ga0207686_10340416 3300025934 Unclassified 1126
234 Ga0207670_10099195 3300025936 Bacteria 2077
235 Ga0207704_10053459 3300025938 Bacteria 2455
236 Ga0207665_10000263 3300025939 Bacteria 36526
237 Ga0207665_10027759 3300025939 Bacteria 3740
238 Ga0207665_10060711 3300025939 Unclassified 2561
239 Ga0207665_10162005 3300025939 Bacteria 1610
240 Ga0207665_10398318 3300025939 Bacteria 1048
241 Ga0207711_10401416 3300025941 Bacteria 1274
242 Ga0207689_10011670 3300025942 Bacteria 7531
243 Ga0207661_10200725 3300025944 Bacteria 1753
244 Ga0207661_10214744 3300025944 Unclassified 1697
245 Ga0207661_10683901 3300025944 Unclassified 943
246 Ga0207679_10050465 3300025945 Unclassified 3040
247 Ga0207679_10102942 3300025945 Bacteria 2237
248 Ga0207679_10232629 3300025945 Unclassified 1557
249 Ga0207667_10001904 3300025949 Bacteria 26195
250 Ga0207667_10025672 3300025949 Bacteria 6447
251 Ga0207667_10194282 3300025949 Unclassified 2082
252 Ga0207651_10405114 3300025960 Bacteria 1161
253 Ga0207640_10086493 3300025981 Bacteria 2159
254 Ga0207658_10725776 3300025986 Bacteria 899
255 Ga0207677_10007414 3300026023 Bacteria 6065
256 Ga0207703_10028440 3300026035 Bacteria 4406
257 Ga0207703_10126185 3300026035 Bacteria 2204
258 Ga0207639_10010305 3300026041 Bacteria 6469
259 Ga0207639_10258220 3300026041 Bacteria 1523
260 Ga0207702_10000103 3300026078 Bacteria 99037
261 Ga0207702_10000772 3300026078 Bacteria 33916
262 Ga0207702_10034730 3300026078 Unclassified 4217
263 Ga0207648_10013458 3300026089 Bacteria 7611
264 Ga0207676_10001149 3300026095 Bacteria 19942
265 Ga0207676_10242541 3300026095 Bacteria 1617
266 Ga0207674_10001635 3300026116 Bacteria 28838
267 Ga0207674_10014919 3300026116 Bacteria 8562
268 Ga0207675_100245154 3300026118 Bacteria 1732
269 Ga0207698_10131153 3300026142 Unclassified 2142
270 Ga0265356_1000672 3300028017 Bacteria 5919
271 Ga0265356_1007319 3300028017 Bacteria 1275
272 Ga0268266_10762808 3300028379 Unclassified 934
273 Ga0268264_10010842 3300028381 Bacteria 7531
274 Ga0268264_10235696 3300028381 Unclassified 1692
275 Ga0268264_10490463 3300028381 Bacteria 1196
276 Ga0265762_1000992 3300030760 Bacteria 5095
277 Ga0265762_1002971 3300030760 Unclassified 3031
278 Ga0265760_10001162 3300031090 Bacteria 7678
279 Ga0265760_10002302 3300031090 Bacteria 5573
280 Ga0265760_10013501 3300031090 Bacteria 2338
281 Ga0316212_1003870 3300033547 Unclassified 2171
282 Ga0373943_0057237 3300035170 Bacteria 1937
283 Ga0373927_0020780 3300035695 Bacteria 4304
284 Ga0373933_0077874 3300035724 Unclassified 2027
285 Ga0373947_0194151 3300035725 Bacteria 1326
286 Ga0373937_0136063 3300036401 Bacteria 2297
287 Ga0373925_0005185 3300037068 Bacteria 9751
288 Ga0373925_0011385 3300037068 Bacteria 6450
289 Ga0373925_0463827 3300037068 Viruses 1038
290 Ga0373925_0893609 3300037068 Unclassified 732
291 Ga0436365_0774058 3300039437 Bacteria 1962
292 Ga0436363_0685953 3300039450 Unclassified 1148
293 Ga0453683_0016462 3300044673 Bacteria 4770
294 Ga0466964_0180070 3300044706 Unclassified 1001
295 Ga0451576_0284196 3300045051 Bacteria 1730
296 Ga0451576_0610085 3300045051 Bacteria 1147
297 Ga0466958_0286522 3300045836 Unclassified 1056
298 Ga0466967_0114877 3300045976 Bacteria 2478
299 Ga0466967_0186533 3300045976 Unclassified 1958
300 Ga0495580_0005183 3300046472 Bacteria 10832
301 Ga0495580_0008974 3300046472 Bacteria 7899
302 Ga0495580_0024721 3300046472 Bacteria 4394
303 Ga0495580_0351107 3300046472 Bacteria 999
304 Ga0495580_0441075 3300046472 Bacteria 874
305 Ga0495580_0474595 3300046472 Bacteria 837
306 Ga0495674_0192383 3300047319 Bacteria 1695
307 Ga0495675_0126176 3300047444 Bacteria 1592
308 Ga0495675_0434182 3300047444 Bacteria 762
309 Ga0495602_0030871 3300048088 Bacteria 5075
310 Ga0495602_0268208 3300048088 Unclassified 1263
311 Ga0496101_0237875 3300048904 Bacteria 1417
312 Ga0496101_0706337 3300048904 Bacteria 796
313 Ga0496102_0198079 3300048905 Bacteria 1893
314 Ga0496102_0264417 3300048905 Bacteria 1622
315 Ga0496104_0033603 3300048907 Unclassified 4781
316 Ga0496104_0204972 3300048907 Bacteria 1884
317 Ga0496112_0008815 3300048915 Bacteria 9054
318 Ga0496112_0076201 3300048915 Unclassified 3317
319 Ga0496112_0174772 3300048915 Bacteria 2113
320 Ga0496114_0189274 3300048917 Bacteria 1800
321 Ga0496114_0585121 3300048917 Unclassified 985
322 Ga0496115_0174945 3300048918 Unclassified 1775
323 Ga0496115_0213561 3300048918 Unclassified 1593
324 Ga0501031_0014072 3300049568 Bacteria 5205
325 Ga0501031_0383273 3300049568 Bacteria 909
326 Ga0501032_0059934 3300049569 Unclassified 2553
327 Ga0501036_0149175 3300049572 Bacteria 1972
328 Ga0501037_0162163 3300049573 Bacteria 1593
329 Ga0501038_0055892 3300049574 Unclassified 3390
330 Ga0501038_0074648 3300049574 Bacteria 2868
331 Ga0501039_0002900 3300049575 Bacteria 12830
332 Ga0501039_0045512 3300049575 Bacteria 3390
333 Ga0501040_0551064 3300049576 Bacteria 832
334 Ga0501041_0091173 3300049577 Bacteria 1881
335 Ga0501041_0162927 3300049577 Bacteria 1394
336 Ga0501042_0000289 3300049578 Bacteria 24825
337 Ga0501042_0213373 3300049578 Bacteria 1392
338 Ga0501046_0051582 3300049580 Unclassified 3246
339 Ga0501046_0082173 3300049580 Bacteria 2488
340 Ga0501075_0237336 3300049591 Bacteria 1390
341 Ga0501076_0050209 3300049592 Unclassified 3300
342 Ga0501035_0006479 3300049822 Bacteria 10999
343 Ga0501035_0185382 3300049822 Bacteria 1791
344 Ga0501045_0143933 3300049824 Bacteria 1773
345 Ga0207699_10157813
346 Ga0070683_100048298
347 Ga0070683_100070083
348 Ga0070683_100273104
349 Ga0070690_100039578
350 Ga0070690_100075248
351 Ga0068869_100005664
352 Ga0070680_100121670
353 Ga0070680_100265110
354 Ga0068868_100012075
355 Ga0068868_100139374
356 Ga0070689_100183418
357 Ga0070691_10089093
358 Ga0070687_100020545
359 Ga0070671_100053582
360 Ga0070673_100514399
361 Ga0070709_10000357
362 Ga0070709_10086292
363 Ga0070709_10193965
364 Ga0070709_10231890
365 Ga0070709_10575702
366 Ga0070709_10587311
367 Ga0070709_10637535
368 Ga0070709_10798945
369 Ga0070714_100039928
370 Ga0070714_100063593
371 Ga0070714_100096936
372 Ga0070714_100105612
373 Ga0070714_100230399
374 Ga0070714_100326430
375 Ga0070714_100335914
376 Ga0070714_100426630
377 Ga0070714_100751804
378 Ga0070713_100000330
379 Ga0070713_100005884
380 Ga0070713_100025346
381 Ga0070713_100078650
382 Ga0070713_100101503
383 Ga0070713_100122554
384 Ga0070713_100560028
385 Ga0070710_10002243
386 Ga0070710_10058068
387 Ga0070710_10752733
388 Ga0070711_100025091
389 Ga0070711_100112159
390 Ga0070711_100178018
391 Ga0070711_100178544
392 Ga0070711_100692796
393 Ga0070711_100748730
394 Ga0070708_100034360
395 Ga0070662_100246227
396 Ga0070681_10000195
397 Ga0070681_10282447
398 Ga0070706_100463931
399 Ga0070707_100476496
400 Ga0070707_100771137
401 Ga0070679_100013742
402 Ga0070679_100526407
403 Ga0070684_100005845
404 Ga0070684_100046453
405 Ga0070697_100005539
406 Ga0070697_100160205
407 Ga0068853_100022540
408 Ga0068853_100205133
409 Ga0070693_100174771
410 Ga0070665_100853962
411 Ga0068855_100000978
412 Ga0068855_100005912
413 Ga0068855_100009066
414 Ga0068855_100090039
415 Ga0068855_100311448
416 Ga0068855_100845806
417 Ga0070664_100001252
418 Ga0070664_100132746
419 Ga0070664_100151630
420 Ga0068857_100000437
421 Ga0068857_100002172
422 Ga0068854_100011436
423 Ga0068854_100060772
424 Ga0068854_100375532
425 Ga0068856_100000107
426 Ga0068856_100000483
427 Ga0068856_100000812
428 Ga0068856_100002817
429 Ga0068856_100013864
430 Ga0068852_100038607
431 Ga0068852_100307976
432 Ga0068859_100000951
433 Ga0068859_100381290
434 Ga0068864_100007554
435 Ga0068864_100026305
436 Ga0068866_10146739
437 Ga0068861_100808658
438 Ga0068851_10361975
439 Ga0068858_100002793
440 Ga0068858_100241850
441 Ga0068860_100004530
442 Ga0068860_100670933
443 Ga0070717_10013225
444 Ga0070717_10020262
445 Ga0070717_10023176
446 Ga0070717_10023247
447 Ga0070717_10065406
448 Ga0070717_10069651
449 Ga0070717_10290703
450 Ga0070717_10395569
451 Ga0070717_10726244
452 Ga0070717_10810878
453 Ga0070715_10003381
454 Ga0070716_100000383
455 Ga0070716_100030351
456 Ga0070716_100121250
457 Ga0070716_100192295
458 Ga0070712_100000030
459 Ga0070712_100014308
460 Ga0070712_100073599
461 Ga0070712_100394447
462 Ga0097621_100003554
463 Ga0097621_100004921
464 Ga0097621_100054438
465 Ga0097621_100218739
466 Ga0097621_100444864
467 Ga0068871_100000410
468 Ga0068871_100001081
469 Ga0068871_100180442
470 Ga0068865_100050996
471 Ga0068865_100067026
472 Ga0097620_100000951
473 Ga0097620_100381341
474 Ga0105240_10002618
475 Ga0105240_10020773
476 Ga0105240_10137738
477 Ga0105240_10318127
478 Ga0105240_10333036
479 Ga0105240_10433865
480 Ga0105240_10561654
481 Ga0105241_10142502
482 Ga0105241_10151750
483 Ga0105241_10867758
484 Ga0105248_10003183
485 Ga0105248_10168819
486 Ga0105237_10119482
487 Ga0105237_10229352
488 Ga0105237_10292913
489 Ga0105237_10551401
490 Ga0105237_10723192
491 Ga0105238_10000090
492 Ga0105238_10059240
493 Ga0105238_10136946
494 Ga0105238_10235865
495 Ga0105238_10501380
496 Ga0105238_10555011
497 Ga0105239_10015829
498 Ga0105239_10036107
499 Ga0105239_10475244
500 Ga0105239_10687471
501 Ga0157371_10157248
502 Ga0157370_10153590
503 Ga0157370_10167724
504 Ga0157369_10005632
505 Ga0157369_10059227
506 Ga0157369_10137923
507 Ga0157369_10254232
508 Ga0157374_10000305
509 Ga0157374_10000684
510 Ga0157374_10001524
511 Ga0157374_10047123
512 Ga0157374_10093411
513 Ga0157378_10000265
514 Ga0157378_10001362
515 Ga0157378_10017027
516 Ga0157378_10020663
517 Ga0157372_10000766
518 Ga0157372_10001033
519 Ga0157372_10002516
520 Ga0157372_10010175
521 Ga0157372_10015853
522 Ga0157372_10025715
523 Ga0157372_10057145
524 Ga0157372_10123491
525 Ga0163163_10170022
526 Ga0157377_10106835
527 Ga0157376_10011558
528 Ga0157376_10019983
529 Ga0224570_103327
530 Ga0224572_1001704
531 Ga0207656_10160534
532 Ga0207692_10020078
533 Ga0207692_10154502
534 Ga0207692_10160145
535 Ga0207647_10048602
536 Ga0207685_10002236
537 Ga0207685_10166995
538 Ga0207699_10000657
539 Ga0207699_10078491
540 Ga0207699_10092420
541 Ga0207699_10164683
542 Ga0207654_10151987
543 Ga0207707_10001239
544 Ga0207707_10005687
545 Ga0207707_10062791
546 Ga0207695_10004905
547 Ga0207695_10050045
548 Ga0207695_10655536
549 Ga0207671_10074026
550 Ga0207671_10136641
551 Ga0207671_10465873
552 Ga0207693_10000024
553 Ga0207693_10008761
554 Ga0207693_10014119
555 Ga0207693_10041239
556 Ga0207663_10003427
557 Ga0207663_10256067
558 Ga0207663_10898711
559 Ga0207660_10145493
560 Ga0207652_10022711
561 Ga0207652_10427715
562 Ga0207646_10049585
563 Ga0207646_10555210
564 Ga0207694_10001381
565 Ga0207700_10000479
566 Ga0207700_10037479
567 Ga0207700_10037836
568 Ga0207700_10347340
569 Ga0207700_10452892
570 Ga0207664_10064079
571 Ga0207664_10080749
572 Ga0207664_10315412
573 Ga0207664_10319409
574 Ga0207664_10518243
575 Ga0207644_10044417
576 Ga0207706_10222343
577 Ga0207686_10340416
578 Ga0207670_10099195
579 Ga0207704_10053459
580 Ga0207665_10000263
581 Ga0207665_10027759
582 Ga0207665_10060711
583 Ga0207665_10162005
584 Ga0207665_10398318
585 Ga0207711_10401416
586 Ga0207689_10011670
587 Ga0207661_10200725
588 Ga0207661_10214744
589 Ga0207661_10683901
590 Ga0207679_10050465
591 Ga0207679_10102942
592 Ga0207679_10232629
593 Ga0207667_10001904
594 Ga0207667_10025672
595 Ga0207667_10194282
596 Ga0207651_10405114
597 Ga0207640_10086493
598 Ga0207658_10725776
599 Ga0207677_10007414
600 Ga0207703_10028440
601 Ga0207703_10126185
602 Ga0207639_10010305
603 Ga0207639_10258220
604 Ga0207702_10000103
605 Ga0207702_10000772
606 Ga0207702_10034730
607 Ga0207648_10013458
608 Ga0207676_10001149
609 Ga0207676_10242541
610 Ga0207674_10001635
611 Ga0207674_10014919
612 Ga0207675_100245154
613 Ga0207698_10131153
614 Ga0265356_1000672
615 Ga0265356_1007319
616 Ga0268266_10762808
617 Ga0268264_10010842
618 Ga0268264_10235696
619 Ga0268264_10490463
620 Ga0265762_1000992
621 Ga0265762_1002971
622 Ga0265760_10001162
623 Ga0265760_10002302
624 Ga0265760_10013501
625 Ga0316212_1003870
626 Ga0373943_0057237
627 Ga0373927_0020780
628 Ga0373933_0077874
629 Ga0373947_0194151
630 Ga0373937_0136063
631 Ga0373925_0005185
632 Ga0373925_0011385
633 Ga0373925_0463827
634 Ga0373925_0893609
635 Ga0436365_0774058
636 Ga0436363_0685953
637 Ga0453683_0016462
638 Ga0466964_0180070
639 Ga0451576_0284196
640 Ga0451576_0610085
641 Ga0466958_0286522
642 Ga0466967_0114877
643 Ga0466967_0186533
644 Ga0495580_0005183
645 Ga0495580_0008974
646 Ga0495580_0024721
647 Ga0495580_0351107
648 Ga0495580_0441075
649 Ga0495580_0474595
650 Ga0495674_0192383
651 Ga0495675_0126176
652 Ga0495675_0434182
653 Ga0495602_0030871
654 Ga0495602_0268208
655 Ga0496101_0237875
656 Ga0496101_0706337
657 Ga0496102_0198079
658 Ga0496102_0264417
659 Ga0496104_0033603
660 Ga0496104_0204972
661 Ga0496112_0008815
662 Ga0496112_0076201
663 Ga0496112_0174772
664 Ga0496114_0189274
665 Ga0496114_0585121
666 Ga0496115_0174945
667 Ga0496115_0213561
668 Ga0501031_0014072
669 Ga0501031_0383273
670 Ga0501032_0059934
671 Ga0501036_0149175
672 Ga0501037_0162163
673 Ga0501038_0055892
674 Ga0501038_0074648
675 Ga0501039_0002900
676 Ga0501039_0045512
677 Ga0501040_0551064
678 Ga0501041_0091173
679 Ga0501041_0162927
680 Ga0501042_0000289
681 Ga0501042_0213373
682 Ga0501046_0051582
683 Ga0501046_0082173
684 Ga0501075_0237336
685 Ga0501076_0050209
686 Ga0501035_0006479
687 Ga0501035_0185382
688 Ga0501045_0143933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

138

210

0.93

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

24

184

0.87

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

4

178

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.9906 2 200
3cnh-assembly2.cif.gz_B crystal structure of predicted hydrolase of haloacid dehalogenase-like superfamily (np_295428.1) from deinococcus radiodurans at 1.66 a resolution 0.9857 2 200
4dcc-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 from bacteroides thetaiotaomicron (target efi-501088) 0.8679 2 185
4dfd-assembly2.cif.gz_B crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, magnesium complex 0.8364 2 192
4f72-assembly1.cif.gz_A crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate 0.8318 4 185
ID Description Score Start End Superfamily
3cnhA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9915 20 80 1.10.150.240
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9608 3 200 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9532 3 200 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9301 86 185 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.92 87 185 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V9MLM4-F1-model_v4 Hydrolase 0.9972 4 186 GO:0016787
AF-A0A2V9Q3A1-F1-model_v4 Hydrolase 0.9955 3 201 GO:0016787
AF-A0A7W1TH27-F1-model_v4 HAD family phosphatase 0.9946 2 201
AF-A0A2V9DHN9-F1-model_v4 Hydrolase 0.994 1 200
AF-A0A7W0YPE8-F1-model_v4 HAD family phosphatase 0.9938 2 201

Map