F416166

General Info

Members Datasets Scaffolds Average Seq Length
344 232 688 158

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_64530_c1|nmdc:mga0qj67_64530_c1_25_603
Length 192
Sequence VRARRESGAVSSVAGLPSTLKPAHDEHRIASRRSKDVHRHTARVSWLRNGAAFTDNRYSRGHQWSFDGGARIAASSSPSVVPLPYSVAEAVDPEEALVAAASSCHMLTFLYVAAKQGFVVDSYEDDAYGTMAKNAAGRIGIDRITLRPKIEFAGTKVPNVDELASLHHAAHQECFIANSVKCEITVEGVGGA

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
176 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
177 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
178 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.78
Nodule 0
Rhizoplane 1.45
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_64530_c1 3300050509 Bacteria 2913
2 JGI25406J46586_10006082 3300003203 Bacteria 5577
3 Ga0065714_10174651 3300005288 Unclassified 988
4 Ga0065712_10391296 3300005290 Bacteria 728
5 Ga0065715_10117355 3300005293 Bacteria 2351
6 Ga0065715_10130506 3300005293 Bacteria 2025
7 Ga0065707_10046849 3300005295 Bacteria 971
8 Ga0070676_10012209 3300005328 Bacteria 4684
9 Ga0070676_10013099 3300005328 Bacteria 4544
10 Ga0070683_100290763 3300005329 Bacteria 1554
11 Ga0070670_100002328 3300005331 Bacteria 15650
12 Ga0070670_100065883 3300005331 Bacteria 3108
13 Ga0070670_100114928 3300005331 Unclassified 2320
14 Ga0070670_100123911 3300005331 Bacteria 2230
15 Ga0070677_10002689 3300005333 Bacteria 5687
16 Ga0068869_100002258 3300005334 Bacteria 11594
17 Ga0070666_10607024 3300005335 Bacteria 799
18 Ga0070680_100000090 3300005336 Bacteria 51110
19 Ga0070682_100000162 3300005337 Bacteria 51215
20 Ga0070660_100000899 3300005339 Bacteria 19892
21 Ga0070689_100205588 3300005340 Bacteria 1609
22 Ga0070691_10010379 3300005341 Bacteria 4248
23 Ga0070691_10123284 3300005341 Bacteria 1307
24 Ga0070687_100113429 3300005343 Bacteria 1538
25 Ga0070661_100003027 3300005344 Bacteria 11561
26 Ga0070692_10000960 3300005345 Bacteria 9826
27 Ga0070669_100028890 3300005353 Bacteria 3994
28 Ga0070669_100355208 3300005353 Bacteria 1190
29 Ga0070675_100110145 3300005354 Bacteria 2328
30 Ga0070671_101350877 3300005355 Bacteria 629
31 Ga0070674_100007709 3300005356 Bacteria 6357
32 Ga0070674_100064184 3300005356 Bacteria 2572
33 Ga0070673_100004562 3300005364 Bacteria 8777
34 Ga0070673_100023151 3300005364 Bacteria 4535
35 Ga0070688_100264610 3300005365 Bacteria 1229
36 Ga0070659_100001226 3300005366 Bacteria 18631
37 Ga0070659_101303993 3300005366 Bacteria 644
38 Ga0070703_10003344 3300005406 Bacteria 4576
39 Ga0070713_101526459 3300005436 Unclassified 648
40 Ga0070701_10092057 3300005438 Bacteria 1663
41 Ga0070701_10116411 3300005438 Bacteria 1500
42 Ga0070701_10437215 3300005438 Bacteria 837
43 Ga0070701_10533386 3300005438 Bacteria 767
44 Ga0070705_100000632 3300005440 Bacteria 20239
45 Ga0070700_100029242 3300005441 Bacteria 3284
46 Ga0070700_100106841 3300005441 Bacteria 1854
47 Ga0070700_100134587 3300005441 Bacteria 1672
48 Ga0070700_100315924 3300005441 Bacteria 1146
49 Ga0070694_100000169 3300005444 Bacteria 33670
50 Ga0070694_100111001 3300005444 Bacteria 1953
51 Ga0070694_100332050 3300005444 Bacteria 1173
52 Ga0070694_100570184 3300005444 Bacteria 908
53 Ga0070663_100000723 3300005455 Bacteria 17811
54 Ga0070678_100010213 3300005456 Bacteria 5723
55 Ga0070662_100103768 3300005457 Bacteria 2156
56 Ga0070662_100214260 3300005457 Bacteria 1534
57 Ga0070681_10433131 3300005458 Bacteria 1227
58 Ga0070681_10885371 3300005458 Bacteria 811
59 Ga0070681_11295564 3300005458 Bacteria 651
60 Ga0068867_100000366 3300005459 Bacteria 30109
61 Ga0068867_100013778 3300005459 Bacteria 5725
62 Ga0068867_100180417 3300005459 Bacteria 1678
63 Ga0068867_100533577 3300005459 Unclassified 1014
64 Ga0070698_101189191 3300005471 Bacteria 712
65 Ga0070679_100030315 3300005530 Bacteria 5341
66 Ga0070684_100030739 3300005535 Bacteria 4567
67 Ga0068853_100000163 3300005539 Bacteria 45425
68 Ga0070672_100018193 3300005543 Bacteria 5074
69 Ga0070672_100061075 3300005543 Bacteria 2970
70 Ga0070672_100144637 3300005543 Bacteria 1964
71 Ga0070686_100023412 3300005544 Bacteria 3690
72 Ga0070695_100003433 3300005545 Bacteria 9258
73 Ga0070695_100116101 3300005545 Bacteria 1824
74 Ga0070696_100000864 3300005546 Bacteria 19586
75 Ga0070696_101001266 3300005546 Bacteria 698
76 Ga0070693_100000214 3300005547 Bacteria 26958
77 Ga0070665_100440518 3300005548 Bacteria 1312
78 Ga0070704_100000066 3300005549 Bacteria 34508
79 Ga0068855_100000802 3300005563 Bacteria 38912
80 Ga0068855_100784912 3300005563 Bacteria 1013
81 Ga0070664_100001574 3300005564 Bacteria 18242
82 Ga0068857_100026932 3300005577 Bacteria 5069
83 Ga0068857_100068270 3300005577 Bacteria 3164
84 Ga0068854_100001721 3300005578 Bacteria 13338
85 Ga0068856_100001017 3300005614 Bacteria 29866
86 Ga0070702_100512567 3300005615 Bacteria 883
87 Ga0068859_100000501 3300005617 Bacteria 38572
88 Ga0068859_100078586 3300005617 Bacteria 3340
89 Ga0068859_100504347 3300005617 Bacteria 1305
90 Ga0068864_100000978 3300005618 Bacteria 23978
91 Ga0068864_101280623 3300005618 Bacteria 733
92 Ga0068861_100026940 3300005719 Bacteria 4183
93 Ga0068861_100036796 3300005719 Bacteria 3635
94 Ga0068870_10000094 3300005840 Bacteria 29013
95 Ga0068863_100653194 3300005841 Bacteria 1043
96 Ga0068858_100021761 3300005842 Bacteria 5990
97 Ga0068858_100637584 3300005842 Bacteria 1035
98 Ga0068858_101095630 3300005842 Bacteria 782
99 Ga0068860_100030100 3300005843 Bacteria 5222
100 Ga0068862_100006068 3300005844 Bacteria 10060
101 Ga0068862_100841358 3300005844 Bacteria 899
102 Ga0081455_10083682 3300005937 Bacteria 2606
103 Ga0081539_10003162 3300005985 Bacteria 20881
104 Ga0081539_10227762 3300005985 Bacteria 843
105 Ga0075364_10013406 3300006051 Bacteria 5037
106 Ga0070712_100716610 3300006175 Bacteria 854
107 Ga0075362_10082660 3300006177 Bacteria 1482
108 Ga0075367_10133782 3300006178 Bacteria 1534
109 Ga0075428_100026197 3300006844 Bacteria 6457
110 Ga0075428_100035701 3300006844 Bacteria 5479
111 Ga0075428_100868108 3300006844 Bacteria 958
112 Ga0075430_100040268 3300006846 Bacteria 3956
113 Ga0075430_100415442 3300006846 Bacteria 1111
114 Ga0075431_100012643 3300006847 Bacteria 8525
115 Ga0075431_100018084 3300006847 Bacteria 7169
116 Ga0075431_100038837 3300006847 Bacteria 4904
117 Ga0075433_10528726 3300006852 Unclassified 1037
118 Ga0075434_100021977 3300006871 Bacteria 6210
119 Ga0075434_100749278 3300006871 Bacteria 994
120 Ga0075429_100028746 3300006880 Bacteria 4828
121 Ga0075429_100560795 3300006880 Bacteria 1001
122 Ga0075429_101308053 3300006880 Bacteria 632
123 Ga0068865_100041645 3300006881 Bacteria 3127
124 Ga0068865_100191632 3300006881 Bacteria 1581
125 Ga0068865_100354743 3300006881 Bacteria 1189
126 Ga0068865_100567912 3300006881 Bacteria 955
127 Ga0075436_100192668 3300006914 Bacteria 1442
128 Ga0097620_100000501 3300006931 Bacteria 38572
129 Ga0097620_100078584 3300006931 Bacteria 3340
130 Ga0097620_100504380 3300006931 Bacteria 1305
131 Ga0075435_100251249 3300007076 Bacteria 1505
132 Ga0099794_10002660 3300007265 Bacteria 6652
133 Ga0111539_10041580 3300009094 Bacteria 5525
134 Ga0111539_10393621 3300009094 Bacteria 1614
135 Ga0111539_11298840 3300009094 Bacteria 844
136 Ga0111539_11618387 3300009094 Bacteria 751
137 Ga0111539_11772589 3300009094 Bacteria 716
138 Ga0105245_12982320 3300009098 Unclassified 525
139 Ga0114129_10000586 3300009147 Bacteria 44931
140 Ga0114129_10866901 3300009147 Bacteria 1147
141 Ga0105243_10281386 3300009148 Bacteria 1498
142 Ga0105243_10461409 3300009148 Bacteria 1194
143 Ga0105241_10000522 3300009174 Bacteria 28914
144 Ga0105248_10231946 3300009177 Unclassified 2078
145 Ga0105248_13040830 3300009177 Bacteria 534
146 Ga0105249_10382593 3300009553 Bacteria 1433
147 Ga0105239_10464596 3300010375 Bacteria 1437
148 Ga0157373_10000051 3300013100 Bacteria 105264
149 Ga0157370_10061902 3300013104 Bacteria 3551
150 Ga0157369_10016193 3300013105 Bacteria 8392
151 Ga0157374_10718045 3300013296 Bacteria 1013
152 Ga0157378_11458309 3300013297 Bacteria 728
153 Ga0157378_12297974 3300013297 Bacteria 591
154 Ga0163162_10524883 3300013306 Bacteria 1313
155 Ga0163162_10721675 3300013306 Bacteria 1117
156 Ga0163162_10906906 3300013306 Bacteria 994
157 Ga0157372_10000119 3300013307 Bacteria 83602
158 Ga0157375_10075042 3300013308 Bacteria 3405
159 Ga0157375_10128266 3300013308 Bacteria 2654
160 Ga0157375_10562944 3300013308 Bacteria 1301
161 Ga0157380_10107193 3300014326 Bacteria 2340
162 Ga0157380_10832748 3300014326 Bacteria 943
163 Ga0157380_11042830 3300014326 Bacteria 854
164 Ga0182008_10036322 3300014497 Bacteria 2465
165 Ga0157377_10346555 3300014745 Bacteria 995
166 Ga0182007_10199081 3300015262 Bacteria 699
167 Ga0163161_10471034 3300017792 Bacteria 1018
168 Ga0207653_10001500 3300025885 Bacteria 7551
169 Ga0207682_10001461 3300025893 Bacteria 10921
170 Ga0207682_10016075 3300025893 Bacteria 2916
171 Ga0207688_10036857 3300025901 Bacteria 2711
172 Ga0207680_10185848 3300025903 Bacteria 1408
173 Ga0207647_10202779 3300025904 Bacteria 1147
174 Ga0207647_10447074 3300025904 Bacteria 725
175 Ga0207643_10016047 3300025908 Bacteria 4080
176 Ga0207643_10282301 3300025908 Bacteria 1030
177 Ga0207654_10000643 3300025911 Bacteria 19695
178 Ga0207707_10000604 3300025912 Bacteria 36158
179 Ga0207707_10401548 3300025912 Bacteria 1176
180 Ga0207707_10896083 3300025912 Bacteria 734
181 Ga0207693_10457479 3300025915 Bacteria 997
182 Ga0207660_10004337 3300025917 Bacteria 9251
183 Ga0207660_10370128 3300025917 Bacteria 1151
184 Ga0207662_10067973 3300025918 Bacteria 2151
185 Ga0207662_10158931 3300025918 Bacteria 1442
186 Ga0207657_10000021 3300025919 Bacteria 155900
187 Ga0207649_10000495 3300025920 Bacteria 27982
188 Ga0207652_10000745 3300025921 Bacteria 31363
189 Ga0207681_10008978 3300025923 Bacteria 6106
190 Ga0207681_10330695 3300025923 Bacteria 1214
191 Ga0207681_10402937 3300025923 Bacteria 1105
192 Ga0207681_10643693 3300025923 Bacteria 878
193 Ga0207650_10025293 3300025925 Bacteria 4228
194 Ga0207650_10120658 3300025925 Bacteria 2041
195 Ga0207659_10018767 3300025926 Bacteria 4539
196 Ga0207644_10067897 3300025931 Bacteria 2600
197 Ga0207644_10843029 3300025931 Bacteria 767
198 Ga0207690_10002113 3300025932 Bacteria 12171
199 Ga0207706_10012297 3300025933 Bacteria 7799
200 Ga0207706_10105928 3300025933 Bacteria 2474
201 Ga0207686_10463683 3300025934 Bacteria 977
202 Ga0207686_10671272 3300025934 Bacteria 821
203 Ga0207709_10142256 3300025935 Bacteria 1650
204 Ga0207709_10214402 3300025935 Bacteria 1384
205 Ga0207670_10935239 3300025936 Bacteria 727
206 Ga0207669_10004802 3300025937 Bacteria 5996
207 Ga0207669_10016694 3300025937 Bacteria 3739
208 Ga0207704_10142645 3300025938 Bacteria 1678
209 Ga0207691_10013335 3300025940 Bacteria 7871
210 Ga0207691_10210208 3300025940 Bacteria 1690
211 Ga0207691_10939909 3300025940 Bacteria 723
212 Ga0207691_10975404 3300025940 Bacteria 708
213 Ga0207711_10363499 3300025941 Bacteria 1341
214 Ga0207689_10000119 3300025942 Bacteria 65346
215 Ga0207661_10117506 3300025944 Bacteria 2259
216 Ga0207679_10000975 3300025945 Bacteria 18382
217 Ga0207667_10001546 3300025949 Bacteria 28942
218 Ga0207667_11662829 3300025949 Unclassified 606
219 Ga0207651_10040730 3300025960 Bacteria 3077
220 Ga0207651_10697768 3300025960 Bacteria 894
221 Ga0207668_10123873 3300025972 Bacteria 1962
222 Ga0207668_11494052 3300025972 Bacteria 610
223 Ga0207677_10026309 3300026023 Bacteria 3647
224 Ga0207703_10081363 3300026035 Bacteria 2700
225 Ga0207703_11638507 3300026035 Bacteria 619
226 Ga0207639_10053084 3300026041 Bacteria 3091
227 Ga0207678_10000942 3300026067 Bacteria 26548
228 Ga0207678_10703212 3300026067 Bacteria 890
229 Ga0207708_10145983 3300026075 Bacteria 1859
230 Ga0207708_10195339 3300026075 Bacteria 1612
231 Ga0207708_10201676 3300026075 Bacteria 1587
232 Ga0207708_10441458 3300026075 Bacteria 1082
233 Ga0207702_10000786 3300026078 Bacteria 33628
234 Ga0207641_10019208 3300026088 Bacteria 5608
235 Ga0207648_10001581 3300026089 Bacteria 24964
236 Ga0207648_10001740 3300026089 Bacteria 23835
237 Ga0207648_10011945 3300026089 Bacteria 8153
238 Ga0207648_10252493 3300026089 Bacteria 1572
239 Ga0207676_10406031 3300026095 Bacteria 1274
240 Ga0207674_10000508 3300026116 Bacteria 51046
241 Ga0207675_100000180 3300026118 Bacteria 56974
242 Ga0207675_100483556 3300026118 Bacteria 1231
243 Ga0207683_10050647 3300026121 Bacteria 3638
244 Ga0209973_1000877 3300027252 Bacteria 2440
245 Ga0209982_1004599 3300027552 Bacteria 1979
246 Ga0209970_1000384 3300027614 Bacteria 7476
247 Ga0210002_1001384 3300027617 Bacteria 3399
248 Ga0209983_1002298 3300027665 Bacteria 4189
249 Ga0209588_1010207 3300027671 Bacteria 2819
250 Ga0209998_10000931 3300027717 Bacteria 7476
251 Ga0209974_10000237 3300027876 Bacteria 17757
252 Ga0207428_10139664 3300027907 Bacteria 1850
253 Ga0207428_10196641 3300027907 Bacteria 1518
254 Ga0268266_10791672 3300028379 Bacteria 916
255 Ga0268265_10058409 3300028380 Bacteria 2945
256 Ga0268265_10939812 3300028380 Bacteria 851
257 Ga0265325_10183542 3300031241 Bacteria 973
258 Ga0307408_101517183 3300031548 Bacteria 634
259 Ga0307405_10038914 3300031731 Unclassified 2870
260 Ga0307413_10000929 3300031824 Bacteria 10425
261 Ga0307406_10032919 3300031901 Bacteria 3168
262 Ga0307407_10002362 3300031903 Bacteria 7357
263 Ga0307412_10016649 3300031911 Bacteria 4385
264 Ga0307409_100000174 3300031995 Bacteria 24996
265 Ga0307416_100000208 3300032002 Bacteria 30656
266 Ga0307411_10000045 3300032005 Bacteria 36356
267 Ga0307415_100119992 3300032126 Bacteria 1969
268 Ga0373931_1205286 3300035691 Unclassified 518
269 Ga0373937_0879659 3300036401 Unclassified 845
270 Ga0436363_1295498 3300039450 Bacteria 670
271 Ga0436362_0136997 3300039453 Bacteria 1436
272 Ga0439453_0041121 3300041408 Bacteria 906
273 Ga0439448_0000124 3300042005 Bacteria 14517
274 Ga0439455_0001305 3300042012 Bacteria 4100
275 Ga0450895_017458 3300042132 Bacteria 650
276 Ga0450889_004765 3300042144 Bacteria 1343
277 Ga0439458_0003338 3300042157 Bacteria 3773
278 Ga0439435_0005631 3300042436 Bacteria 2768
279 Ga0439459_0000133 3300042438 Bacteria 7422
280 Ga0439464_0087578 3300042439 Bacteria 936
281 Ga0439460_0009028 3300042461 Bacteria 2523
282 Ga0451577_0060887 3300042876 Bacteria 3365
283 Ga0439440_0012749 3300042993 Bacteria 1793
284 Ga0453683_0295016 3300044673 Bacteria 1037
285 Ga0453684_0194769 3300044712 Bacteria 2368
286 Ga0451576_0020546 3300045051 Bacteria 7187
287 Ga0495638_0056894 3300046460 Bacteria 2426
288 Ga0495676_0201650 3300047321 Bacteria 1382
289 Ga0496102_0021278 3300048905 Bacteria 5737
290 Ga0496106_0160392 3300048909 Bacteria 1778
291 Ga0496106_0272263 3300048909 Bacteria 1356
292 Ga0496108_1010879 3300048911 Bacteria 710
293 Ga0496112_0109310 3300048915 Bacteria 2735
294 Ga0501036_0088422 3300049572 Bacteria 2618
295 Ga0501037_0495483 3300049573 Unclassified 829
296 Ga0501038_0246956 3300049574 Bacteria 1415
297 Ga0501039_0015319 3300049575 Bacteria 5868
298 Ga0501040_0009533 3300049576 Bacteria 6334
299 Ga0501041_0017212 3300049577 Bacteria 4301
300 Ga0501046_0067297 3300049580 Bacteria 2789
301 Ga0501048_0067130 3300049582 Bacteria 2536
302 Ga0501067_0089178 3300049583 Bacteria 1712
303 Ga0501068_0022642 3300049584 Unclassified 3675
304 Ga0501071_0025487 3300049587 Unclassified 4143
305 Ga0501072_0008262 3300049588 Bacteria 7908
306 Ga0501074_0024666 3300049590 Unclassified 4369
307 Ga0501075_1281509 3300049591 Unclassified 555
308 Ga0501076_0066853 3300049592 Bacteria 2869
309 Ga0501077_0015611 3300049593 Bacteria 4783
310 Ga0501079_0007009 3300049741 Bacteria 8499
311 Ga0501079_0015891 3300049741 Bacteria 5753
312 Ga0501081_0001345 3300049743 Bacteria 14996
313 Ga0501083_0222834 3300049744 Bacteria 1228
314 Ga0501083_0507331 3300049744 Bacteria 785
315 Ga0501045_0024700 3300049824 Bacteria 4315
316 nmdc:mga0k408_444287_c1 3300050493 Bacteria 770
317 nmdc:mga0k408_77731_c1 3300050493 Bacteria 1941
318 nmdc:mga05p37_179_c1 3300050507 Bacteria 62007
319 nmdc:mga09592_11693_c1 3300050508 Bacteria 7139
320 nmdc:mga0qj67_13986_c1 3300050509 Bacteria 6061
321 nmdc:mga06r32_16253_c1 3300050510 Bacteria 6779
322 nmdc:mga06r32_485185_c1 3300050510 Bacteria 1214
323 nmdc:mga08y16_1311972_c1 3300050511 Bacteria 690
324 nmdc:mga08y16_276523_c1 3300050511 Bacteria 1733
325 nmdc:mga08y16_431490_c1 3300050511 Bacteria 1346
326 nmdc:mga08y16_539879_c1 3300050511 Bacteria 1181
327 nmdc:mga08y16_689260_c1 3300050511 Bacteria 1023
328 nmdc:mga08y16_87607_c1 3300050511 Bacteria 3244
329 nmdc:mga0n895_1642950_c1 3300050512 Bacteria 606
330 nmdc:mga0n895_60386_c1 3300050512 Bacteria 3741
331 nmdc:mga0rr50_95343_c1 3300050513 Bacteria 1500
332 nmdc:mga0a205_539901_c1 3300050515 Bacteria 1022
333 nmdc:mga0sz30_237995_c1 3300050516 Bacteria 810
334 Ga0500646_0121128 3300053090 Bacteria 841
335 Ga0500650_0170739 3300053098 Bacteria 1000
336 Ga0500642_0035562 3300053130 Bacteria 2116
337 Ga0500658_0217209 3300053134 Bacteria 876
338 Ga0500577_0209375 3300053142 Bacteria 842
339 Ga0500616_0018559 3300053153 Bacteria 3931
340 Ga0500636_0347235 3300053177 Bacteria 710
341 Ga0501084_0061616 3300054114 Bacteria 3141
342 Ga0501082_0006879 3300060353 Bacteria 9837
343 Ga0501082_0100335 3300060353 Bacteria 2504
344 Ga0530510_0010878 3300061734 Bacteria 6384
345 nmdc:mga0qj67_64530_c1
346 JGI25406J46586_10006082
347 Ga0065714_10174651
348 Ga0065712_10391296
349 Ga0065715_10117355
350 Ga0065715_10130506
351 Ga0065707_10046849
352 Ga0070676_10012209
353 Ga0070676_10013099
354 Ga0070683_100290763
355 Ga0070670_100002328
356 Ga0070670_100065883
357 Ga0070670_100114928
358 Ga0070670_100123911
359 Ga0070677_10002689
360 Ga0068869_100002258
361 Ga0070666_10607024
362 Ga0070680_100000090
363 Ga0070682_100000162
364 Ga0070660_100000899
365 Ga0070689_100205588
366 Ga0070691_10010379
367 Ga0070691_10123284
368 Ga0070687_100113429
369 Ga0070661_100003027
370 Ga0070692_10000960
371 Ga0070669_100028890
372 Ga0070669_100355208
373 Ga0070675_100110145
374 Ga0070671_101350877
375 Ga0070674_100007709
376 Ga0070674_100064184
377 Ga0070673_100004562
378 Ga0070673_100023151
379 Ga0070688_100264610
380 Ga0070659_100001226
381 Ga0070659_101303993
382 Ga0070703_10003344
383 Ga0070713_101526459
384 Ga0070701_10092057
385 Ga0070701_10116411
386 Ga0070701_10437215
387 Ga0070701_10533386
388 Ga0070705_100000632
389 Ga0070700_100029242
390 Ga0070700_100106841
391 Ga0070700_100134587
392 Ga0070700_100315924
393 Ga0070694_100000169
394 Ga0070694_100111001
395 Ga0070694_100332050
396 Ga0070694_100570184
397 Ga0070663_100000723
398 Ga0070678_100010213
399 Ga0070662_100103768
400 Ga0070662_100214260
401 Ga0070681_10433131
402 Ga0070681_10885371
403 Ga0070681_11295564
404 Ga0068867_100000366
405 Ga0068867_100013778
406 Ga0068867_100180417
407 Ga0068867_100533577
408 Ga0070698_101189191
409 Ga0070679_100030315
410 Ga0070684_100030739
411 Ga0068853_100000163
412 Ga0070672_100018193
413 Ga0070672_100061075
414 Ga0070672_100144637
415 Ga0070686_100023412
416 Ga0070695_100003433
417 Ga0070695_100116101
418 Ga0070696_100000864
419 Ga0070696_101001266
420 Ga0070693_100000214
421 Ga0070665_100440518
422 Ga0070704_100000066
423 Ga0068855_100000802
424 Ga0068855_100784912
425 Ga0070664_100001574
426 Ga0068857_100026932
427 Ga0068857_100068270
428 Ga0068854_100001721
429 Ga0068856_100001017
430 Ga0070702_100512567
431 Ga0068859_100000501
432 Ga0068859_100078586
433 Ga0068859_100504347
434 Ga0068864_100000978
435 Ga0068864_101280623
436 Ga0068861_100026940
437 Ga0068861_100036796
438 Ga0068870_10000094
439 Ga0068863_100653194
440 Ga0068858_100021761
441 Ga0068858_100637584
442 Ga0068858_101095630
443 Ga0068860_100030100
444 Ga0068862_100006068
445 Ga0068862_100841358
446 Ga0081455_10083682
447 Ga0081539_10003162
448 Ga0081539_10227762
449 Ga0075364_10013406
450 Ga0070712_100716610
451 Ga0075362_10082660
452 Ga0075367_10133782
453 Ga0075428_100026197
454 Ga0075428_100035701
455 Ga0075428_100868108
456 Ga0075430_100040268
457 Ga0075430_100415442
458 Ga0075431_100012643
459 Ga0075431_100018084
460 Ga0075431_100038837
461 Ga0075433_10528726
462 Ga0075434_100021977
463 Ga0075434_100749278
464 Ga0075429_100028746
465 Ga0075429_100560795
466 Ga0075429_101308053
467 Ga0068865_100041645
468 Ga0068865_100191632
469 Ga0068865_100354743
470 Ga0068865_100567912
471 Ga0075436_100192668
472 Ga0097620_100000501
473 Ga0097620_100078584
474 Ga0097620_100504380
475 Ga0075435_100251249
476 Ga0099794_10002660
477 Ga0111539_10041580
478 Ga0111539_10393621
479 Ga0111539_11298840
480 Ga0111539_11618387
481 Ga0111539_11772589
482 Ga0105245_12982320
483 Ga0114129_10000586
484 Ga0114129_10866901
485 Ga0105243_10281386
486 Ga0105243_10461409
487 Ga0105241_10000522
488 Ga0105248_10231946
489 Ga0105248_13040830
490 Ga0105249_10382593
491 Ga0105239_10464596
492 Ga0157373_10000051
493 Ga0157370_10061902
494 Ga0157369_10016193
495 Ga0157374_10718045
496 Ga0157378_11458309
497 Ga0157378_12297974
498 Ga0163162_10524883
499 Ga0163162_10721675
500 Ga0163162_10906906
501 Ga0157372_10000119
502 Ga0157375_10075042
503 Ga0157375_10128266
504 Ga0157375_10562944
505 Ga0157380_10107193
506 Ga0157380_10832748
507 Ga0157380_11042830
508 Ga0182008_10036322
509 Ga0157377_10346555
510 Ga0182007_10199081
511 Ga0163161_10471034
512 Ga0207653_10001500
513 Ga0207682_10001461
514 Ga0207682_10016075
515 Ga0207688_10036857
516 Ga0207680_10185848
517 Ga0207647_10202779
518 Ga0207647_10447074
519 Ga0207643_10016047
520 Ga0207643_10282301
521 Ga0207654_10000643
522 Ga0207707_10000604
523 Ga0207707_10401548
524 Ga0207707_10896083
525 Ga0207693_10457479
526 Ga0207660_10004337
527 Ga0207660_10370128
528 Ga0207662_10067973
529 Ga0207662_10158931
530 Ga0207657_10000021
531 Ga0207649_10000495
532 Ga0207652_10000745
533 Ga0207681_10008978
534 Ga0207681_10330695
535 Ga0207681_10402937
536 Ga0207681_10643693
537 Ga0207650_10025293
538 Ga0207650_10120658
539 Ga0207659_10018767
540 Ga0207644_10067897
541 Ga0207644_10843029
542 Ga0207690_10002113
543 Ga0207706_10012297
544 Ga0207706_10105928
545 Ga0207686_10463683
546 Ga0207686_10671272
547 Ga0207709_10142256
548 Ga0207709_10214402
549 Ga0207670_10935239
550 Ga0207669_10004802
551 Ga0207669_10016694
552 Ga0207704_10142645
553 Ga0207691_10013335
554 Ga0207691_10210208
555 Ga0207691_10939909
556 Ga0207691_10975404
557 Ga0207711_10363499
558 Ga0207689_10000119
559 Ga0207661_10117506
560 Ga0207679_10000975
561 Ga0207667_10001546
562 Ga0207667_11662829
563 Ga0207651_10040730
564 Ga0207651_10697768
565 Ga0207668_10123873
566 Ga0207668_11494052
567 Ga0207677_10026309
568 Ga0207703_10081363
569 Ga0207703_11638507
570 Ga0207639_10053084
571 Ga0207678_10000942
572 Ga0207678_10703212
573 Ga0207708_10145983
574 Ga0207708_10195339
575 Ga0207708_10201676
576 Ga0207708_10441458
577 Ga0207702_10000786
578 Ga0207641_10019208
579 Ga0207648_10001581
580 Ga0207648_10001740
581 Ga0207648_10011945
582 Ga0207648_10252493
583 Ga0207676_10406031
584 Ga0207674_10000508
585 Ga0207675_100000180
586 Ga0207675_100483556
587 Ga0207683_10050647
588 Ga0209973_1000877
589 Ga0209982_1004599
590 Ga0209970_1000384
591 Ga0210002_1001384
592 Ga0209983_1002298
593 Ga0209588_1010207
594 Ga0209998_10000931
595 Ga0209974_10000237
596 Ga0207428_10139664
597 Ga0207428_10196641
598 Ga0268266_10791672
599 Ga0268265_10058409
600 Ga0268265_10939812
601 Ga0265325_10183542
602 Ga0307408_101517183
603 Ga0307405_10038914
604 Ga0307413_10000929
605 Ga0307406_10032919
606 Ga0307407_10002362
607 Ga0307412_10016649
608 Ga0307409_100000174
609 Ga0307416_100000208
610 Ga0307411_10000045
611 Ga0307415_100119992
612 Ga0373931_1205286
613 Ga0373937_0879659
614 Ga0436363_1295498
615 Ga0436362_0136997
616 Ga0439453_0041121
617 Ga0439448_0000124
618 Ga0439455_0001305
619 Ga0450895_017458
620 Ga0450889_004765
621 Ga0439458_0003338
622 Ga0439435_0005631
623 Ga0439459_0000133
624 Ga0439464_0087578
625 Ga0439460_0009028
626 Ga0451577_0060887
627 Ga0439440_0012749
628 Ga0453683_0295016
629 Ga0453684_0194769
630 Ga0451576_0020546
631 Ga0495638_0056894
632 Ga0495676_0201650
633 Ga0496102_0021278
634 Ga0496106_0160392
635 Ga0496106_0272263
636 Ga0496108_1010879
637 Ga0496112_0109310
638 Ga0501036_0088422
639 Ga0501037_0495483
640 Ga0501038_0246956
641 Ga0501039_0015319
642 Ga0501040_0009533
643 Ga0501041_0017212
644 Ga0501046_0067297
645 Ga0501048_0067130
646 Ga0501067_0089178
647 Ga0501068_0022642
648 Ga0501071_0025487
649 Ga0501072_0008262
650 Ga0501074_0024666
651 Ga0501075_1281509
652 Ga0501076_0066853
653 Ga0501077_0015611
654 Ga0501079_0007009
655 Ga0501079_0015891
656 Ga0501081_0001345
657 Ga0501083_0222834
658 Ga0501083_0507331
659 Ga0501045_0024700
660 nmdc:mga0k408_444287_c1
661 nmdc:mga0k408_77731_c1
662 nmdc:mga05p37_179_c1
663 nmdc:mga09592_11693_c1
664 nmdc:mga0qj67_13986_c1
665 nmdc:mga06r32_16253_c1
666 nmdc:mga06r32_485185_c1
667 nmdc:mga08y16_1311972_c1
668 nmdc:mga08y16_276523_c1
669 nmdc:mga08y16_431490_c1
670 nmdc:mga08y16_539879_c1
671 nmdc:mga08y16_689260_c1
672 nmdc:mga08y16_87607_c1
673 nmdc:mga0n895_1642950_c1
674 nmdc:mga0n895_60386_c1
675 nmdc:mga0rr50_95343_c1
676 nmdc:mga0a205_539901_c1
677 nmdc:mga0sz30_237995_c1
678 Ga0500646_0121128
679 Ga0500650_0170739
680 Ga0500642_0035562
681 Ga0500658_0217209
682 Ga0500577_0209375
683 Ga0500616_0018559
684 Ga0500636_0347235
685 Ga0501084_0061616
686 Ga0501082_0006879
687 Ga0501082_0100335
688 Ga0530510_0010878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

86

188

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.945 2 149
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9036 2 149
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8918 1 147
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8393 1 147
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.832 2 147
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9438 3 149 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9017 3 149 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8775 8 147 3.30.300.20
af_Q2FXK3_6_143_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8525 6 147 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8419 59 147 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A853WSU6-F1-model_v4 deleted 0.9572 2 145
AF-A0A536ZRM3-F1-model_v4 Peroxiredoxin 0.957 2 125
AF-A0A4S1E7C5-F1-model_v4 OsmC family peroxiredoxin 0.9505 1 145
AF-A0A2N7SF35-F1-model_v4 deleted 0.9484 40 149
AF-W2UFP9-F1-model_v4 OsmC-like protein 0.9437 2 138

Map