F416168

General Info

Members Datasets Scaffolds Average Seq Length
344 309 120 261

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_007627|Ga0500643_007627_1242_2033
Length 263
Sequence MPLALKTYPTLAEAGSALKDAGARYIGGGTLVVRAANEGDVSLSTFVRSTDPALSEIKLEGGRAIIGASVTMSAIARHPGLSAIARAAKAVGGPAIRNMATVGGNLFAKAPYGDFAVALLALDATVHTTSGDLGIEEFLAGREGSHAVVASISFAVPPDEKFRFVKVSRIKPKGVSVLSIAAVIDAVSGKVTSARIALGCMADRPIRAKAAEKALAGATLTEEGVVRAVAAVGEGTQPITDAIASAWYRSEVLPVHFRRLLLG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
12 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
13 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
14 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
15 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
16 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
17 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
18 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
19 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
20 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
21 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
22 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
23 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
24 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
25 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
26 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
27 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
28 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
29 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
30 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
31 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
32 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
33 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
34 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
35 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
36 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
37 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
38 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
39 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
40 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
41 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
42 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
43 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
44 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
45 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
46 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
47 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
48 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
49 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
50 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
51 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
52 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
53 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
54 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
55 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
56 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
57 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
58 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
59 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
60 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
61 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
62 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
63 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
64 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
65 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
66 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
67 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
68 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
69 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
70 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
71 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
72 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
73 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
74 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
75 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
76 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
77 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
78 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
79 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
80 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
81 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
82 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
83 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
84 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
85 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
86 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
87 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
88 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
89 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
90 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
91 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
92 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
93 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
94 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
95 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
96 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
97 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
98 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
99 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
100 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
101 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
102 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
103 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
104 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
105 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
106 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
107 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
108 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
109 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
110 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
111 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
112 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
113 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
114 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
115 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
116 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
117 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
118 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
119 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
120 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
121 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
122 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
123 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
124 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
125 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
126 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
127 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
128 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
129 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
130 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
131 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
132 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
133 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
134 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
135 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
136 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
137 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
138 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
139 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
140 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
141 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
142 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
143 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
144 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
145 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
146 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
147 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
148 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
149 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
150 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
151 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
152 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
153 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
154 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
155 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
156 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
157 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
158 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
159 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
160 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
161 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
162 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
163 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
164 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
165 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
166 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
167 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
168 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
169 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
170 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
171 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
172 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
173 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
174 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
175 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
176 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
177 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
178 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
179 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
180 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
181 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
182 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
183 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
184 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
185 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
186 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
187 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
188 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
189 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
190 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
191 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
192 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
193 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
194 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
195 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
196 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
197 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
198 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
199 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
200 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
201 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
202 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
203 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
204 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
205 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
206 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
207 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
208 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
209 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
210 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
211 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
212 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
213 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
214 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
215 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
216 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
217 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
218 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
219 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
220 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
221 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
222 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
223 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
224 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
225 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
226 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
227 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
228 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
229 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
230 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
231 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
232 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
233 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
234 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
236 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
237 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
292 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
293 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
294 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
295 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
298 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
299 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
300 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
301 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
302 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
303 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
304 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
305 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
306 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
307 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
308 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
309 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 34.88
Metatranscriptomes 0
Isolates 65.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.59
Nodule 58.14
Rhizoplane 1.16
Rhizosphere 23.26
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007237 3300001989 Bacteria 4173
2 JGI25156J39149_1003722 3300002705 Bacteria 4883
3 JGI25157J39369_1001276 3300002741 Bacteria 10204
4 JGI25165J46597_1000015 3300003214 Bacteria 380891
5 Ga0055542_1000406 3300003762 Bacteria 42163
6 Ga0055529_1001789 3300003763 Bacteria 5244
7 Ga0070661_100116685 3300005344 Bacteria 1997
8 Ga0070674_100341061 3300005356 Bacteria 1207
9 Ga0070663_100225369 3300005455 Bacteria 1474
10 Ga0068853_100023657 3300005539 Bacteria 5146
11 Ga0068853_100268750 3300005539 Bacteria 1569
12 Ga0070686_100369004 3300005544 Bacteria 1083
13 Ga0070665_100061404 3300005548 Bacteria 3768
14 Ga0070665_100063098 3300005548 Bacteria 3715
15 Ga0075365_10085830 3300006038 Bacteria 2138
16 Ga0075365_10102111 3300006038 Bacteria 1965
17 Ga0075365_10109825 3300006038 Bacteria 1895
18 Ga0075365_10109881 3300006038 Bacteria 1894
19 Ga0075362_10047043 3300006177 Bacteria 1920
20 Ga0075367_10134578 3300006178 Bacteria 1529
21 Ga0075369_10000668 3300006186 Bacteria 10918
22 Ga0105240_10030702 3300009093 Bacteria 6980
23 Ga0105240_10460680 3300009093 Bacteria 1421
24 Ga0105240_10555291 3300009093 Bacteria 1270
25 Ga0105243_10059786 3300009148 Bacteria 3042
26 Ga0105237_10037546 3300009545 Bacteria 4895
27 Ga0105237_10181531 3300009545 Bacteria 2105
28 Ga0105238_10177512 3300009551 Bacteria 2107
29 Ga0105238_10844121 3300009551 Bacteria 933
30 Ga0105239_10809841 3300010375 Bacteria 1073
31 Ga0105239_11040688 3300010375 Bacteria 942
32 Ga0157370_10118827 3300013104 Bacteria 2469
33 Ga0157369_10286532 3300013105 Bacteria 1715
34 Ga0209026_1000025 3300025250 Bacteria 352548
35 Ga0209148_1000181 3300025254 Bacteria 124691
36 Ga0209148_1011276 3300025254 Bacteria 1666
37 Ga0209759_1000226 3300025256 Bacteria 84383
38 Ga0209233_1000010 3300025261 Bacteria 1194329
39 Ga0209455_1000127 3300025272 Bacteria 162518
40 Ga0209758_1009435 3300025297 Bacteria 6068
41 Ga0207647_10069682 3300025904 Bacteria 2126
42 Ga0207654_10081450 3300025911 Bacteria 1949
43 Ga0207695_10354599 3300025913 Bacteria 1354
44 Ga0207671_10047482 3300025914 Bacteria 3178
45 Ga0207657_10061403 3300025919 Bacteria 3223
46 Ga0207649_10112224 3300025920 Bacteria 1823
47 Ga0207694_10009950 3300025924 Bacteria 7174
48 Ga0207694_10119330 3300025924 Bacteria 2105
49 Ga0207694_10439967 3300025924 Bacteria 1088
50 Ga0207640_10491217 3300025981 Bacteria 1020
51 Ga0207639_10013061 3300026041 Bacteria 5798
52 Ga0207678_10458644 3300026067 Bacteria 1108
53 Ga0207702_10420561 3300026078 Bacteria 1292
54 Ga0207674_10194163 3300026116 Bacteria 1980
55 Ga0209813_10008770 3300027866 Bacteria 2564
56 Ga0268266_10013435 3300028379 Bacteria 7050
57 Ga0268266_10346733 3300028379 Bacteria 1395
58 Ga0307408_100415800 3300031548 Bacteria 1158
59 Ga0307412_10173885 3300031911 Bacteria 1613
60 Ga0307416_101048758 3300032002 Bacteria 919
61 Ga0395900_0328298 3300037418 Bacteria 1508
62 Ga0395900_0439797 3300037418 Bacteria 1262
63 Ga0395900_0527462 3300037418 Bacteria 1128
64 Ga0395898_0451483 3300037466 Bacteria 1224
65 Ga0395905_0062447 3300037471 Bacteria 3485
66 Ga0395905_0153064 3300037471 Bacteria 2169
67 Ga0395905_0258103 3300037471 Bacteria 1627
68 Ga0439465_0029938 3300041413 Bacteria 1731
69 Ga0466972_0076675 3300044658 Bacteria 1592
70 Ga0495643_0050871 3300046522 Bacteria 2230
71 Ga0495668_0111696 3300046616 Bacteria 1495
72 Ga0495668_0136170 3300046616 Bacteria 1344
73 Ga0495625_0009140 3300046660 Bacteria 8339
74 Ga0495686_0094321 3300047472 Bacteria 1814
75 Ga0496109_0712805 3300048912 Bacteria 941
76 Ga0496110_0559504 3300048913 Bacteria 1039
77 Ga0496112_0012529 3300048915 Bacteria 7790
78 Ga0496120_0004296 3300048923 Bacteria 12080
79 Ga0496120_0078429 3300048923 Bacteria 1795
80 Ga0496125_0095447 3300048928 Bacteria 2212
81 Ga0501032_0025190 3300049569 Bacteria 4101
82 Ga0501033_0042586 3300049570 Bacteria 3385
83 Ga0501033_0049140 3300049570 Bacteria 3131
84 Ga0501034_0052644 3300049571 Bacteria 4101
85 Ga0501037_0013496 3300049573 Bacteria 6016
86 Ga0501038_0090306 3300049574 Bacteria 2567
87 Ga0501038_0186462 3300049574 Bacteria 1671
88 Ga0501038_0229682 3300049574 Bacteria 1477
89 Ga0501043_0009321 3300049579 Bacteria 7712
90 Ga0501043_0155006 3300049579 Bacteria 1791
91 Ga0501046_0129492 3300049580 Bacteria 1914
92 Ga0501047_0009607 3300049581 Bacteria 9145
93 Ga0501047_0049133 3300049581 Bacteria 4073
94 Ga0501069_0181337 3300049585 Bacteria 1217
95 Ga0501070_0022688 3300049586 Bacteria 5256
96 Ga0501073_0116323 3300049589 Bacteria 1853
97 Ga0501074_0061464 3300049590 Bacteria 2706
98 Ga0501035_0064331 3300049822 Bacteria 3260
99 Ga0501035_0086470 3300049822 Bacteria 2762
100 Ga0501044_0036648 3300049823 Bacteria 5130
101 Ga0501044_0109277 3300049823 Bacteria 2774
102 Ga0501045_0507500 3300049824 Bacteria 895
103 nmdc:mga03683_63083_c1 3300050489 Bacteria 1570
104 nmdc:mga03n38_73860_c1 3300050490 Bacteria 1585
105 nmdc:mga00v17_147678_c1 3300050491 Bacteria 1509
106 nmdc:mga0yw44_25908_c1 3300050492 Bacteria 3342
107 nmdc:mga0yw44_40690_c1 3300050492 Bacteria 2763
108 nmdc:mga0yw44_43417_c1 3300050492 Bacteria 2684
109 nmdc:mga0yw44_90031_c1 3300050492 Bacteria 1937
110 nmdc:mga04h51_10310_c1 3300050495 Bacteria 2563
111 nmdc:mga04h51_131302_c1 3300050495 Bacteria 942
112 nmdc:mga0sz30_163559_c1 3300050516 Bacteria 986
113 nmdc:mga0sz30_8727_c1 3300050516 Bacteria 3836
114 Ga0500610_0003387 3300053079 Bacteria 6104
115 Ga0495655_0054102 3300053083 Bacteria 1073
116 Ga0500643_007627 3300053087 Bacteria 4336
117 Ga0500604_0055246 3300053151 Bacteria 1234
118 Ga0500604_0075767 3300053151 Bacteria 1080
119 Ga0500620_004356 3300053155 Bacteria 3154
120 Ga0500627_0051665 3300053158 Bacteria 1793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2958137437 2958141629 225
2 3300049570 Ga0501033_0042586 Ga0501033_0042586_2095_2889 228
3 iso_pu_bacteria 3004239961 3004248085 230
4 3300048912 Ga0496109_0712805 Ga0496109_0712805_25_726 233
5 iso_pu_bacteria 2906427513 2906430349 235
6 iso_pu_bacteria 2876369609 2876375030 237
7 3300003762 Ga0055542_1000406 Ga0055542_100040630 245
8 3300003763 Ga0055529_1001789 Ga0055529_10017894 245
9 3300025254 Ga0209148_1000181 Ga0209148_100018123 245
10 3300025272 Ga0209455_1000127 Ga0209455_100012723 245
11 iso_pu_bacteria 2922178524 2922181607 250
12 iso_pu_bacteria 8004312739 8004317418 252
13 iso_pu_bacteria 2996336353 2996337458 257
14 iso_pu_bacteria 2906401398 2906403802 258
15 3300027866 Ga0209813_10008770 Ga0209813_100087703 259
16 3300050495 nmdc:mga04h51_10310_c1 nmdc:mga04h51_10310_c1_496_1290 259
17 iso_pu_bacteria 2503198000 2503201459 260
18 iso_pu_bacteria 2508501127 2509143965 260
19 iso_pu_bacteria 2509276018 2509367901 260
20 iso_pu_bacteria 2509276022 2509396236 260
21 iso_pu_bacteria 2510065059 2510315583 260
22 iso_pu_bacteria 2512875016 2512931571 260
23 iso_pu_bacteria 2512875024 2512959405 260
24 iso_pu_bacteria 2513237090 2513611360 260
25 iso_pu_bacteria 2513237164 2514033539 260
26 iso_pu_bacteria 2513237305 2514419674 260
27 iso_pu_bacteria 2588253730 2588517410 260
28 iso_pu_bacteria 2599185301 2599936823 260
29 iso_pu_bacteria 2643221595 2643986871 260
30 iso_pu_bacteria 2643221627 2644156286 260
31 iso_pu_bacteria 2687453392 2688598370 260
32 iso_pu_bacteria 2693429783 2694631008 260
33 iso_pu_bacteria 2693429784 2694636494 260
34 iso_pu_bacteria 2721755686 2723575306 260
35 iso_pu_bacteria 2756170246 2756672526 260
36 iso_pu_bacteria 2791355123 2792752718 260
37 iso_pu_bacteria 2841734538 2841739121 260
38 iso_pu_bacteria 2844002411 2844007512 260
39 iso_pu_bacteria 2844009547 2844013623 260
40 iso_pu_bacteria 2856320880 2856327554 260
41 iso_pu_bacteria 2856328259 2856334488 260
42 iso_pu_bacteria 2856334872 2856338904 260
43 iso_pu_bacteria 2856356410 2856361971 260
44 iso_pu_bacteria 2856364286 2856369391 260
45 iso_pu_bacteria 2857349434 2857351218 260
46 iso_pu_bacteria 2857367948 2857372710 260
47 iso_pu_bacteria 2869162929 2869167418 260
48 iso_pu_bacteria 2869169390 2869171639 260
49 iso_pu_bacteria 2869249662 2869253290 260
50 iso_pu_bacteria 2869256925 2869260826 260
51 iso_pu_bacteria 2869264136 2869268053 260
52 iso_pu_bacteria 2869271264 2869276455 260
53 iso_pu_bacteria 2869278585 2869280443 260
54 iso_pu_bacteria 2869285874 2869286536 260
55 iso_pu_bacteria 2871429161 2871434689 260
56 iso_pu_bacteria 2871435913 2871439795 260
57 iso_pu_bacteria 2871451962 2871459501 260
58 iso_pu_bacteria 2871459585 2871466791 260
59 iso_pu_bacteria 2871474448 2871475475 260
60 iso_pu_bacteria 2871488783 2871494611 260
61 iso_pu_bacteria 2871495908 2871501468 260
62 iso_pu_bacteria 2874109183 2874112554 260
63 iso_pu_bacteria 2874116593 2874116903 260
64 iso_pu_bacteria 2874123672 2874130533 260
65 iso_pu_bacteria 2874139085 2874144145 260
66 iso_pu_bacteria 2874146452 2874149894 260
67 iso_pu_bacteria 2874155637 2874158152 260
68 iso_pu_bacteria 2874162495 2874164501 260
69 iso_pu_bacteria 2874168670 2874169779 260
70 iso_pu_bacteria 2876363079 2876368553 260
71 iso_pu_bacteria 2876377896 2876382148 260
72 iso_pu_bacteria 2876386047 2876390859 260
73 iso_pu_bacteria 2876392853 2876398369 260
74 iso_pu_bacteria 2876399893 2876403652 260
75 iso_pu_bacteria 2876413966 2876416356 260
76 iso_pu_bacteria 2876420981 2876426914 260
77 iso_pu_bacteria 2878730984 2878738816 260
78 iso_pu_bacteria 2878738818 2878745140 260
79 iso_pu_bacteria 2878745973 2878751822 260
80 iso_pu_bacteria 2878753008 2878758807 260
81 iso_pu_bacteria 2878760144 2878765448 260
82 iso_pu_bacteria 2878767105 2878773156 260
83 iso_pu_bacteria 2878774303 2878774695 260
84 iso_pu_bacteria 2878781027 2878788688 260
85 iso_pu_bacteria 2881147464 2881151259 260
86 iso_pu_bacteria 2881155292 2881161734 260
87 iso_pu_bacteria 2881161766 2881167459 260
88 iso_pu_bacteria 2881845957 2881846198 260
89 iso_pu_bacteria 2881861095 2881861733 260
90 iso_pu_bacteria 2882632389 2882636201 260
91 iso_pu_bacteria 2882912400 2882914619 260
92 iso_pu_bacteria 2885305155 2885309356 260
93 iso_pu_bacteria 2885312484 2885318053 260
94 iso_pu_bacteria 2885326080 2885327710 260
95 iso_pu_bacteria 2885342637 2885342654 260
96 iso_pu_bacteria 2885350715 2885357469 260
97 iso_pu_bacteria 2888337043 2888339351 260
98 iso_pu_bacteria 2888350351 2888355691 260
99 iso_pu_bacteria 2889010040 2889010627 260
100 iso_pu_bacteria 2889016732 2889017672 260
101 iso_pu_bacteria 2903448605 2903451241 260
102 iso_pu_bacteria 2903492973 2903503954 260
103 iso_pu_bacteria 2903492973 2903504768 260
104 iso_pu_bacteria 2903513507 2903517497 260
105 iso_pu_bacteria 2903521522 2903527552 260
106 iso_pu_bacteria 2903528002 2903534006 260
107 iso_pu_bacteria 2903540706 2903546279 260
108 iso_pu_bacteria 2904659560 2904664924 260
109 iso_pu_bacteria 2906308376 2906314220 260
110 iso_pu_bacteria 2906321335 2906327386 260
111 iso_pu_bacteria 2906354277 2906360084 260
112 iso_pu_bacteria 2906363423 2906365639 260
113 iso_pu_bacteria 2906370794 2906374188 260
114 iso_pu_bacteria 2906408224 2906408827 260
115 iso_pu_bacteria 2922130491 2922135128 260
116 iso_pu_bacteria 2922151315 2922155351 260
117 iso_pu_bacteria 2922172374 2922175311 260
118 iso_pu_bacteria 2924718760 2924719820 260
119 iso_pu_bacteria 2924733363 2924735862 260
120 iso_pu_bacteria 2924741084 2924747368 260
121 iso_pu_bacteria 2924748358 2924749358 260
122 iso_pu_bacteria 2924762789 2924765039 260
123 iso_pu_bacteria 2924776078 2924783277 260
124 iso_pu_bacteria 2924784321 2924789009 260
125 iso_pu_bacteria 2937813078 2937815670 260
126 iso_pu_bacteria 2937822353 2937824371 260
127 iso_pu_bacteria 2937836603 2937842089 260
128 iso_pu_bacteria 2937848649 2937854462 260
129 iso_pu_bacteria 2937861824 2937868405 260
130 iso_pu_bacteria 2937868953 2937870323 260
131 iso_pu_bacteria 2937877337 2937882196 260
132 iso_pu_bacteria 2937972304 2937978657 260
133 iso_pu_bacteria 2937980651 2937986406 260
134 iso_pu_bacteria 2937994558 2938000137 260
135 iso_pu_bacteria 2938014810 2938019383 260
136 iso_pu_bacteria 2958034702 2958036313 260
137 iso_pu_bacteria 2958041894 2958045677 260
138 iso_pu_bacteria 2958041894 2958056456 260
139 iso_pu_bacteria 2958071322 2958072045 260
140 iso_pu_bacteria 2958084443 2958089318 260
141 iso_pu_bacteria 2958092219 2958093930 260
142 iso_pu_bacteria 2958100919 2958101811 260
143 iso_pu_bacteria 2958108152 2958113349 260
144 iso_pu_bacteria 2958122699 2958124387 260
145 iso_pu_bacteria 2958130278 2958130939 260
146 iso_pu_bacteria 2958144490 2958146690 260
147 iso_pu_bacteria 2958158011 2958164599 260
148 iso_pu_bacteria 2958165035 2958170601 260
149 iso_pu_bacteria 2958172287 2958174588 260
150 iso_pu_bacteria 2958179912 2958184860 260
151 iso_pu_bacteria 2961077736 2961083027 260
152 iso_pu_bacteria 2961114664 2961119923 260
153 iso_pu_bacteria 2961127735 2961131719 260
154 iso_pu_bacteria 2961136820 2961137388 260
155 iso_pu_bacteria 2961163497 2961169056 260
156 iso_pu_bacteria 2961170736 2961176115 260
157 iso_pu_bacteria 2961183825 2961184350 260
158 iso_pu_bacteria 2963644680 2963647640 260
159 iso_pu_bacteria 2965018300 2965024343 260
160 iso_pu_bacteria 2965025482 2965031831 260
161 iso_pu_bacteria 2965047637 2965054712 260
162 iso_pu_bacteria 2965089291 2965096010 260
163 iso_pu_bacteria 2965110997 2965115702 260
164 iso_pu_bacteria 2965119406 2965120559 260
165 iso_pu_bacteria 2967996073 2968002002 260
166 iso_pu_bacteria 2968003550 2968008974 260
167 iso_pu_bacteria 2968016561 2968018524 260
168 iso_pu_bacteria 2968083720 2968090271 260
169 iso_pu_bacteria 2968110612 2968116280 260
170 iso_pu_bacteria 2968117919 2968119884 260
171 iso_pu_bacteria 2968138860 2968145351 260
172 iso_pu_bacteria 2968171901 2968177450 260
173 iso_pu_bacteria 2970469710 2970471303 260
174 iso_pu_bacteria 2970489779 2970492958 260
175 iso_pu_bacteria 2970503327 2970508781 260
176 iso_pu_bacteria 2970510686 2970517394 260
177 iso_pu_bacteria 2970532167 2970534602 260
178 iso_pu_bacteria 2970547951 2970548929 260
179 iso_pu_bacteria 2970554993 2970560296 260
180 iso_pu_bacteria 2970593180 2970595040 260
181 iso_pu_bacteria 2970619444 2970623015 260
182 iso_pu_bacteria 2970627176 2970627524 260
183 iso_pu_bacteria 2977821940 2977827347 260
184 iso_pu_bacteria 2977843712 2977845906 260
185 iso_pu_bacteria 2977851361 2977855840 260
186 iso_pu_bacteria 2977864932 2977867152 260
187 iso_pu_bacteria 2977872689 2977876881 260
188 iso_pu_bacteria 2977907340 2977914401 260
189 iso_pu_bacteria 2977915119 2977915478 260
190 iso_pu_bacteria 2977922695 2977924149 260
191 iso_pu_bacteria 2977935797 2977936092 260
192 iso_pu_bacteria 2977942078 2977942684 260
193 iso_pu_bacteria 2977950692 2977954849 260
194 iso_pu_bacteria 2977957713 2977964068 260
195 iso_pu_bacteria 2977971508 2977974888 260
196 iso_pu_bacteria 2977986579 2977990433 260
197 iso_pu_bacteria 2979772303 2979777988 260
198 iso_pu_bacteria 2979793036 2979795822 260
199 iso_pu_bacteria 2979808191 2979811571 260
200 iso_pu_bacteria 2987636660 2987638402 260
201 iso_pu_bacteria 2987652177 2987657264 260
202 iso_pu_bacteria 2987659509 2987665087 260
203 iso_pu_bacteria 2987666974 2987667945 260
204 iso_pu_bacteria 2987673487 2987680836 260
205 iso_pu_bacteria 2996348954 2996350094 260
206 iso_pu_bacteria 2996386984 2996392271 260
207 iso_pu_bacteria 3000135777 3000140746 260
208 iso_pu_bacteria 3004188549 3004194144 260
209 iso_pu_bacteria 3004195979 3004201251 260
210 iso_pu_bacteria 3004203850 3004205354 260
211 iso_pu_bacteria 3004211236 3004215884 260
212 iso_pu_bacteria 3004218560 3004221950 260
213 iso_pu_bacteria 3004232784 3004237090 260
214 iso_pu_bacteria 3004248173 3004252570 260
215 iso_pu_bacteria 3004268573 3004274860 260
216 iso_pu_bacteria 3004275668 3004276793 260
217 iso_pu_bacteria 3004289098 3004295789 260
218 iso_pu_bacteria 3004334049 3004334436 260
219 iso_pu_bacteria 637000159 637074670 260
220 iso_pu_bacteria 649633066 649872898 260
221 iso_pu_bacteria 8004300914 8004303844 260
222 iso_pu_bacteria 8004361976 8004362210 260
223 iso_pu_bacteria 8004374579 8004380328 260
224 iso_pu_bacteria 8004387939 8004393710 260
225 iso_pu_bacteria 8004633249 8004637821 260
226 iso_pu_bacteria 8004640170 8004640893 260
227 iso_pu_bacteria 8004695233 8004698440 260
228 iso_pu_bacteria 8004714634 8004720478 260
229 iso_pu_bacteria 8004727605 8004729816 260
230 iso_pu_bacteria 8055617313 8055620701 260
231 3300041413 Ga0439465_0029938 Ga0439465_0029938_611_1396 261
232 3300049569 Ga0501032_0025190 Ga0501032_0025190_61_852 263
233 3300049570 Ga0501033_0049140 Ga0501033_0049140_2280_3071 263
234 3300049571 Ga0501034_0052644 Ga0501034_0052644_61_852 263
235 3300049573 Ga0501037_0013496 Ga0501037_0013496_4780_5571 263
236 3300049574 Ga0501038_0090306 Ga0501038_0090306_462_1253 263
237 3300049574 Ga0501038_0186462 Ga0501038_0186462_462_1253 263
238 3300049579 Ga0501043_0009321 Ga0501043_0009321_5857_6648 263
239 3300049579 Ga0501043_0155006 Ga0501043_0155006_639_1430 263
240 3300049580 Ga0501046_0129492 Ga0501046_0129492_772_1563 263
241 3300049581 Ga0501047_0009607 Ga0501047_0009607_4425_5216 263
242 3300049585 Ga0501069_0181337 Ga0501069_0181337_240_1031 263
243 3300049586 Ga0501070_0022688 Ga0501070_0022688_754_1545 263
244 3300049589 Ga0501073_0116323 Ga0501073_0116323_259_1050 263
245 3300049590 Ga0501074_0061464 Ga0501074_0061464_1853_2644 263
246 3300049822 Ga0501035_0086470 Ga0501035_0086470_1456_2247 263
247 3300049823 Ga0501044_0109277 Ga0501044_0109277_61_852 263
248 3300049824 Ga0501045_0507500 Ga0501045_0507500_28_819 263
249 3300053087 Ga0500643_007627 Ga0500643_007627_1242_2033 263
250 iso_pu_bacteria 2965032056 2965038798 263
251 3300001989 JGI24739J22299_10007237 JGI24739J22299_100072372 264
252 3300002705 JGI25156J39149_1003722 JGI25156J39149_10037224 264
253 3300002741 JGI25157J39369_1001276 JGI25157J39369_10012765 264
254 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015247 264
255 3300005344 Ga0070661_100116685 Ga0070661_1001166852 264
256 3300005356 Ga0070674_100341061 Ga0070674_1003410611 264
257 3300005455 Ga0070663_100225369 Ga0070663_1002253693 264
258 3300005539 Ga0068853_100023657 Ga0068853_1000236574 264
259 3300005539 Ga0068853_100268750 Ga0068853_1002687501 264
260 3300005544 Ga0070686_100369004 Ga0070686_1003690041 264
261 3300005548 Ga0070665_100061404 Ga0070665_1000614042 264
262 3300005548 Ga0070665_100063098 Ga0070665_1000630983 264
263 3300006038 Ga0075365_10085830 Ga0075365_100858302 264
264 3300006038 Ga0075365_10102111 Ga0075365_101021113 264
265 3300006038 Ga0075365_10109825 Ga0075365_101098253 264
266 3300006038 Ga0075365_10109881 Ga0075365_101098813 264
267 3300006177 Ga0075362_10047043 Ga0075362_100470432 264
268 3300006178 Ga0075367_10134578 Ga0075367_101345782 264
269 3300006186 Ga0075369_10000668 Ga0075369_1000066810 264
270 3300009093 Ga0105240_10030702 Ga0105240_100307025 264
271 3300009093 Ga0105240_10460680 Ga0105240_104606801 264
272 3300009093 Ga0105240_10555291 Ga0105240_105552911 264
273 3300009148 Ga0105243_10059786 Ga0105243_100597864 264
274 3300009545 Ga0105237_10037546 Ga0105237_100375464 264
275 3300009545 Ga0105237_10181531 Ga0105237_101815312 264
276 3300009551 Ga0105238_10177512 Ga0105238_101775122 264
277 3300009551 Ga0105238_10844121 Ga0105238_108441211 264
278 3300010375 Ga0105239_10809841 Ga0105239_108098412 264
279 3300010375 Ga0105239_11040688 Ga0105239_110406882 264
280 3300013104 Ga0157370_10118827 Ga0157370_101188274 264
281 3300013105 Ga0157369_10286532 Ga0157369_102865322 264
282 3300025250 Ga0209026_1000025 Ga0209026_100002565 264
283 3300025254 Ga0209148_1011276 Ga0209148_10112763 264
284 3300025256 Ga0209759_1000226 Ga0209759_100022637 264
285 3300025261 Ga0209233_1000010 Ga0209233_1000010345 264
286 3300025297 Ga0209758_1009435 Ga0209758_10094357 264
287 3300025904 Ga0207647_10069682 Ga0207647_100696823 264
288 3300025911 Ga0207654_10081450 Ga0207654_100814502 264
289 3300025913 Ga0207695_10354599 Ga0207695_103545992 264
290 3300025914 Ga0207671_10047482 Ga0207671_100474822 264
291 3300025919 Ga0207657_10061403 Ga0207657_100614033 264
292 3300025920 Ga0207649_10112224 Ga0207649_101122243 264
293 3300025924 Ga0207694_10009950 Ga0207694_100099505 264
294 3300025924 Ga0207694_10119330 Ga0207694_101193302 264
295 3300025924 Ga0207694_10439967 Ga0207694_104399672 264
296 3300025981 Ga0207640_10491217 Ga0207640_104912171 264
297 3300026041 Ga0207639_10013061 Ga0207639_100130615 264
298 3300026067 Ga0207678_10458644 Ga0207678_104586441 264
299 3300026078 Ga0207702_10420561 Ga0207702_104205612 264
300 3300026116 Ga0207674_10194163 Ga0207674_101941632 264
301 3300028379 Ga0268266_10013435 Ga0268266_100134353 264
302 3300028379 Ga0268266_10346733 Ga0268266_103467332 264
303 3300031548 Ga0307408_100415800 Ga0307408_1004158001 264
304 3300031911 Ga0307412_10173885 Ga0307412_101738852 264
305 3300032002 Ga0307416_101048758 Ga0307416_1010487581 264
306 3300037418 Ga0395900_0328298 Ga0395900_0328298_404_1198 264
307 3300037418 Ga0395900_0439797 Ga0395900_0439797_32_826 264
308 3300037418 Ga0395900_0527462 Ga0395900_0527462_51_845 264
309 3300037466 Ga0395898_0451483 Ga0395898_0451483_102_896 264
310 3300037471 Ga0395905_0062447 Ga0395905_0062447_1411_2205 264
311 3300037471 Ga0395905_0153064 Ga0395905_0153064_378_1172 264
312 3300037471 Ga0395905_0258103 Ga0395905_0258103_728_1522 264
313 3300044658 Ga0466972_0076675 Ga0466972_0076675_439_1233 264
314 3300046522 Ga0495643_0050871 Ga0495643_0050871_950_1744 264
315 3300046616 Ga0495668_0111696 Ga0495668_0111696_173_967 264
316 3300046616 Ga0495668_0136170 Ga0495668_0136170_449_1243 264
317 3300046660 Ga0495625_0009140 Ga0495625_0009140_3553_4347 264
318 3300047472 Ga0495686_0094321 Ga0495686_0094321_843_1637 264
319 3300048913 Ga0496110_0559504 Ga0496110_0559504_41_835 264
320 3300048915 Ga0496112_0012529 Ga0496112_0012529_1255_2064 264
321 3300048923 Ga0496120_0004296 Ga0496120_0004296_6645_7439 264
322 3300048923 Ga0496120_0078429 Ga0496120_0078429_876_1670 264
323 3300048928 Ga0496125_0095447 Ga0496125_0095447_733_1527 264
324 3300049574 Ga0501038_0229682 Ga0501038_0229682_528_1325 264
325 3300049581 Ga0501047_0049133 Ga0501047_0049133_1549_2346 264
326 3300049822 Ga0501035_0064331 Ga0501035_0064331_450_1247 264
327 3300049823 Ga0501044_0036648 Ga0501044_0036648_1640_2437 264
328 3300050489 nmdc:mga03683_63083_c1 nmdc:mga03683_63083_c1_523_1317 264
329 3300050490 nmdc:mga03n38_73860_c1 nmdc:mga03n38_73860_c1_47_841 264
330 3300050491 nmdc:mga00v17_147678_c1 nmdc:mga00v17_147678_c1_586_1380 264
331 3300050492 nmdc:mga0yw44_25908_c1 nmdc:mga0yw44_25908_c1_867_1661 264
332 3300050492 nmdc:mga0yw44_40690_c1 nmdc:mga0yw44_40690_c1_1942_2736 264
333 3300050492 nmdc:mga0yw44_43417_c1 nmdc:mga0yw44_43417_c1_110_904 264
334 3300050492 nmdc:mga0yw44_90031_c1 nmdc:mga0yw44_90031_c1_674_1468 264
335 3300050495 nmdc:mga04h51_131302_c1 nmdc:mga04h51_131302_c1_28_822 264
336 3300050516 nmdc:mga0sz30_163559_c1 nmdc:mga0sz30_163559_c1_14_808 264
337 3300050516 nmdc:mga0sz30_8727_c1 nmdc:mga0sz30_8727_c1_2952_3746 264
338 3300053079 Ga0500610_0003387 Ga0500610_0003387_3901_4695 264
339 3300053083 Ga0495655_0054102 Ga0495655_0054102_64_858 264
340 3300053151 Ga0500604_0055246 Ga0500604_0055246_83_877 264
341 3300053151 Ga0500604_0075767 Ga0500604_0075767_93_887 264
342 3300053155 Ga0500620_004356 Ga0500620_004356_1940_2734 264
343 3300053158 Ga0500627_0051665 Ga0500627_0051665_345_1139 264
344 iso_pu_bacteria 2965040258 2965044548 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

163

263

0.95

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

6

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.856 3 260
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8483 3 260
7dqx-assembly1.cif.gz_E crystal structure of xanthine dehydrogenase family protein 0.8433 1 260
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.8414 1 261
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.841 3 260
ID Description Score Start End Superfamily
af_P64557_52_156_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8883 52 152 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8563 51 155 3.30.465.10
af_P64557_52_156_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8489 52 152 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8419 52 152 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8221 59 152 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A439KBW2-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9585 67 155 GO:0016491
GO:0071949
AF-A0A659YHZ7-F1-model_v4 deleted 0.9307 42 220
AF-A0A531LN11-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9306 74 183 GO:0016491
GO:0071949
AF-A0A3S1TPA6-F1-model_v4 deleted 0.9239 94 228
AF-A0A5R2NJX0-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9217 68 262 GO:0016491
GO:0071949

Feature Viewer

pLDDT pTM Quality
87.05 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map