F416190

General Info

Members Datasets Scaffolds Average Seq Length
344 232 262 366

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946072368|2946077737
Length 388
Sequence STPEPGTPGEAGTTSGAADRSGPDGRGGQEGWRGPRHRKQRAGRRKGLLIAAWSAAGVLVLGGTGAGYLYFELNGNIKSVDIDQALGTARPTKVDNGSENILVLGSDTRSGTNKKLGGGADDGSARSDTAMVVHVYEGHKRASVVSIPRDTLVDRPACTDTKGVTHDAASDVMFNSAYSTGGAACAVKTVEAISGIRMDHYLEVDFAGFEKLIDELGGVEITTTKAIDDPDSHLKLDAGTHTLTGDQALGLVRTRHGVGDGSDLGRIQLQQAFVKALVDQVKHVGLLTGGTRLYDLADTATKAVTTDSDLGSLNSLMSFASGLQGIGAADMTMVTMPVQYDPSNLNRVLVSEAKAEQVWTALRNDRPVPKAATEGNASGEAAGVVASS

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
20 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
21 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
22 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
23 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
24 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
25 2808606448 Streptomyces sp. 193411 Isolate Unclassified
26 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
27 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
28 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
29 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
30 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
31 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
32 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
33 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
34 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
35 2862574272 Streptomyces sp. AcE210 Isolate Nodule
36 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
37 2867428634 Streptomyces sp. RP5T Isolate Unclassified
38 2867475112 Streptomyces sp. TM32 Isolate Unclassified
39 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
40 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
41 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
42 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
43 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
44 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
45 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
46 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
47 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
48 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
49 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
50 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
51 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
52 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
53 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
54 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
55 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
56 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
57 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
58 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
59 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
60 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
61 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
62 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
63 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
64 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
65 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
66 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
67 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
68 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
69 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
70 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
71 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
72 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
73 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
74 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
75 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
76 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
77 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
78 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
79 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
104 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
118 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
119 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
120 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
121 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
122 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
226 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
227 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
228 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
229 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
230 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
231 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
232 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.87
Metatranscriptomes 0.29
Isolates 23.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 2.03
Rhizoplane 0.29
Rhizosphere 77.62
Stem 0
Stem Tuber 0
Unclassified 17.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005583 3300001989 Bacteria 4770
2 JGI24737J22298_10005506 3300001990 Bacteria 4369
3 rootH1_10030130 3300003316 Bacteria 2006
4 rootH1_10030131 3300003316 Bacteria 2166
5 rootH2_10153437 3300003320 Bacteria 1822
6 rootL2_10023807 3300003322 Bacteria 2298
7 rootH1_10135036 3300003323 Bacteria 1876
8 JGI25160J50197_1012892 3300003354 Bacteria 2876
9 Ga0006562J51391_1054525 3300003578 Bacteria 2460
10 Ga0068853_100348003 3300005539 Bacteria 1378
11 Ga0081455_10009187 3300005937 Bacteria 10189
12 Ga0075367_10000321 3300006178 Bacteria 16931
13 Ga0099826_10028878 3300006948 Bacteria 4049
14 Ga0105239_10472470 3300010375 Bacteria 1424
15 Ga0105246_10019425 3300011119 Bacteria 4342
16 Ga0157369_10183441 3300013105 Bacteria 2201
17 Ga0182008_10000936 3300014497 Bacteria 20326
18 Ga0182006_1015910 3300015261 Bacteria 3216
19 Ga0182007_10002331 3300015262 Bacteria 9530
20 Ga0183367_1002 3300015688 Bacteria 1101531
21 Ga0209758_1001875 3300025297 Bacteria 23033
22 Ga0207426_1003290 3300025302 Bacteria 8998
23 Ga0207426_1018164 3300025302 Bacteria 2482
24 Ga0207647_10001930 3300025904 Bacteria 15848
25 Ga0207639_10274612 3300026041 Bacteria 1480
26 Ga0209282_1050186 3300027666 Bacteria 2401
27 Ga0307517_10003529 3300028786 Bacteria 24302
28 Ga0307515_10014631 3300028794 Bacteria 14524
29 Ga0268256_1020697 3300030500 Bacteria 1768
30 Ga0307511_10028636 3300030521 Bacteria 5050
31 Ga0307511_10042316 3300030521 Bacteria 3828
32 Ga0307511_10074482 3300030521 Bacteria 2446
33 Ga0307512_10002661 3300030522 Bacteria 22042
34 Ga0307512_10122584 3300030522 Bacteria 1663
35 Ga0307513_10019853 3300031456 Bacteria 7986
36 Ga0307508_10043883 3300031616 Bacteria 4003
37 Ga0307508_10104993 3300031616 Bacteria 2422
38 Ga0307508_10106496 3300031616 Bacteria 2402
39 Ga0307514_10053006 3300031649 Bacteria 3132
40 Ga0307514_10109878 3300031649 Bacteria 1956
41 Ga0307514_10169498 3300031649 Bacteria 1429
42 Ga0307518_10034689 3300031838 Bacteria 3663
43 Ga0307507_10044409 3300033179 Bacteria 4393
44 Ga0307510_10030925 3300033180 Bacteria 6060
45 Ga0307510_10072490 3300033180 Bacteria 3421
46 Ga0395900_0035086 3300037418 Bacteria 5167
47 Ga0395898_0003850 3300037466 Bacteria 16607
48 Ga0395898_0008215 3300037466 Bacteria 11037
49 Ga0395898_0044623 3300037466 Bacteria 4361
50 Ga0395905_0077895 3300037471 Bacteria 3106
51 Ga0395901_0347495 3300038443 Bacteria 1531
52 Ga0439436_0000487 3300041404 Bacteria 10315
53 Ga0439436_0002264 3300041404 Bacteria 5763
54 Ga0451833_0299565 3300041491 Bacteria 1887
55 Ga0451853_0150950 3300041512 Bacteria 10492
56 Ga0439433_0007107 3300041999 Bacteria 2416
57 Ga0439442_001427 3300042002 Bacteria 4710
58 Ga0439455_0003006 3300042012 Bacteria 3166
59 Ga0439457_000883 3300042014 Bacteria 9046
60 Ga0439462_0001217 3300042015 Bacteria 5634
61 Ga0450894_000941 3300042131 Bacteria 4592
62 Ga0450898_000551 3300042134 Bacteria 4413
63 Ga0450903_000144 3300042138 Bacteria 15642
64 Ga0450906_000509 3300042145 Bacteria 8207
65 Ga0439458_0001018 3300042157 Bacteria 7154
66 Ga0450908_001151 3300042184 Bacteria 5127
67 Ga0466972_0005212 3300044658 Bacteria 6506
68 Ga0466972_0007341 3300044658 Bacteria 5536
69 Ga0466972_0030299 3300044658 Bacteria 2663
70 Ga0466972_0044571 3300044658 Bacteria 2151
71 Ga0466965_0014220 3300044683 Bacteria 3765
72 Ga0466966_0005431 3300044684 Bacteria 8378
73 Ga0466966_0049053 3300044684 Bacteria 2689
74 Ga0466961_0000308 3300044693 Bacteria 32406
75 Ga0466961_0041766 3300044693 Bacteria 2940
76 Ga0466963_0001216 3300044694 Bacteria 13564
77 Ga0466964_0045038 3300044706 Bacteria 1794
78 Ga0466971_0002002 3300044719 Bacteria 8632
79 Ga0466971_0092354 3300044719 Bacteria 1386
80 Ga0466970_0006047 3300044765 Bacteria 6035
81 Ga0466970_0036100 3300044765 Bacteria 2617
82 Ga0466957_0000605 3300044842 Bacteria 18193
83 Ga0466960_0047878 3300044901 Bacteria 2052
84 Ga0466959_0000486 3300045049 Bacteria 23165
85 Ga0466958_0000413 3300045836 Bacteria 17607
86 Ga0466967_0003786 3300045976 Bacteria 9991
87 Ga0495603_0004525 3300046455 Bacteria 8299
88 Ga0495603_0024520 3300046455 Bacteria 3648
89 Ga0495603_0035684 3300046455 Bacteria 2986
90 Ga0495603_0038721 3300046455 Bacteria 2858
91 Ga0495603_0166480 3300046455 Bacteria 1277
92 Ga0495629_0017969 3300046459 Bacteria 5069
93 Ga0495629_0021516 3300046459 Bacteria 4602
94 Ga0495629_0027015 3300046459 Bacteria 4076
95 Ga0495629_0039014 3300046459 Bacteria 3344
96 Ga0495629_0116891 3300046459 Bacteria 1858
97 Ga0495638_0175420 3300046460 Bacteria 1227
98 Ga0495651_0007778 3300046462 Bacteria 8199
99 Ga0495651_0157700 3300046462 Bacteria 1629
100 Ga0495580_0193732 3300046472 Bacteria 1401
101 Ga0495582_0011716 3300046473 Bacteria 4833
102 Ga0495582_0019161 3300046473 Bacteria 3744
103 Ga0495605_0001651 3300046474 Bacteria 14340
104 Ga0495639_0034014 3300046475 Bacteria 2278
105 Ga0495662_0012109 3300046476 Bacteria 4214
106 Ga0495662_0021110 3300046476 Bacteria 3149
107 Ga0495594_0009077 3300046499 Bacteria 5132
108 Ga0495594_0077682 3300046499 Bacteria 1852
109 Ga0495594_0091135 3300046499 Bacteria 1708
110 Ga0495594_0151288 3300046499 Bacteria 1317
111 Ga0495607_0046130 3300046501 Bacteria 2561
112 Ga0495583_0019689 3300046506 Bacteria 3515
113 Ga0495583_0062369 3300046506 Bacteria 1660
114 Ga0495608_0015100 3300046511 Bacteria 5358
115 Ga0495616_0014079 3300046513 Bacteria 4490
116 Ga0495620_0007475 3300046515 Bacteria 5925
117 Ga0495628_0027308 3300046516 Bacteria 4646
118 Ga0495631_0004578 3300046518 Bacteria 7339
119 Ga0495632_0098639 3300046519 Bacteria 1378
120 Ga0495642_0027051 3300046528 Bacteria 2281
121 Ga0495652_0069736 3300046529 Bacteria 2941
122 Ga0495640_0032941 3300046533 Bacteria 3686
123 Ga0495640_0038448 3300046533 Bacteria 3366
124 Ga0495587_0004186 3300046536 Bacteria 9551
125 Ga0495622_0021632 3300046557 Bacteria 2994
126 Ga0495622_0023271 3300046557 Bacteria 2887
127 Ga0495634_0002467 3300046642 Bacteria 15369
128 Ga0495634_0002771 3300046642 Bacteria 14392
129 Ga0495634_0099756 3300046642 Bacteria 1877
130 Ga0495625_0002557 3300046660 Bacteria 19548
131 Ga0495625_0206999 3300046660 Bacteria 1291
132 Ga0495635_0001012 3300046663 Bacteria 18564
133 Ga0495635_0004862 3300046663 Bacteria 9349
134 Ga0495635_0032268 3300046663 Bacteria 3634
135 Ga0495588_0001725 3300046674 Bacteria 9308
136 Ga0495588_0008618 3300046674 Bacteria 4685
137 Ga0495657_0000997 3300046675 Bacteria 24940
138 Ga0495657_0022146 3300046675 Bacteria 4555
139 Ga0495646_0005312 3300046680 Bacteria 8132
140 Ga0495613_0000571 3300046689 Bacteria 30034
141 Ga0495613_0109018 3300046689 Bacteria 1996
142 Ga0495613_0111831 3300046689 Bacteria 1967
143 Ga0495613_0232693 3300046689 Bacteria 1290
144 Ga0495670_0092481 3300046691 Bacteria 1549
145 Ga0495671_0017411 3300046692 Bacteria 3826
146 Ga0495671_0046863 3300046692 Bacteria 2161
147 Ga0495649_0084817 3300046694 Bacteria 1691
148 Ga0495589_0016963 3300046794 Bacteria 3738
149 Ga0495589_0020871 3300046794 Bacteria 3348
150 Ga0495600_0019253 3300046809 Bacteria 4357
151 Ga0495600_0061255 3300046809 Bacteria 2458
152 Ga0495581_0015484 3300047315 Bacteria 4427
153 Ga0495581_0049588 3300047315 Bacteria 2424
154 Ga0495604_0000623 3300047317 Bacteria 30451
155 Ga0495604_0069754 3300047317 Bacteria 2663
156 Ga0495604_0282988 3300047317 Bacteria 1120
157 Ga0495636_0051961 3300047318 Bacteria 1718
158 Ga0495636_0053077 3300047318 Bacteria 1701
159 Ga0495674_0211685 3300047319 Bacteria 1605
160 Ga0495676_0013591 3300047321 Bacteria 7309
161 Ga0495676_0041632 3300047321 Bacteria 3778
162 Ga0495676_0082828 3300047321 Bacteria 2426
163 Ga0495676_0084399 3300047321 Bacteria 2396
164 Ga0495676_0100176 3300047321 Bacteria 2145
165 Ga0495676_0113242 3300047321 Bacteria 1986
166 Ga0495676_0209944 3300047321 Bacteria 1347
167 Ga0495687_022709 3300047443 Bacteria 3007
168 Ga0495687_032470 3300047443 Bacteria 2381
169 Ga0495675_0053720 3300047444 Bacteria 2557
170 Ga0495685_006836 3300047447 Bacteria 3753
171 Ga0495685_007532 3300047447 Bacteria 3596
172 Ga0495685_009070 3300047447 Bacteria 3315
173 Ga0495685_009113 3300047447 Bacteria 3309
174 Ga0495681_0000926 3300047470 Bacteria 22637
175 Ga0495681_0085138 3300047470 Bacteria 1404
176 Ga0495684_0181796 3300047471 Bacteria 1558
177 Ga0495593_0006464 3300047673 Bacteria 6866
178 Ga0495602_0036652 3300048088 Bacteria 4562
179 Ga0495614_0002764 3300048089 Bacteria 7797
180 Ga0495626_0025356 3300048091 Bacteria 2901
181 Ga0496109_0044727 3300048912 Bacteria 4017
182 Ga0501031_0003389 3300049568 Bacteria 10229
183 Ga0501031_0187858 3300049568 Bacteria 1349
184 Ga0501032_0012955 3300049569 Bacteria 5940
185 Ga0501033_0005722 3300049570 Bacteria 9802
186 Ga0501033_0010056 3300049570 Bacteria 7263
187 Ga0501033_0015813 3300049570 Bacteria 5718
188 Ga0501033_0027732 3300049570 Bacteria 4257
189 Ga0501033_0194225 3300049570 Bacteria 1452
190 Ga0501034_0003253 3300049571 Bacteria 18575
191 Ga0501034_0031253 3300049571 Bacteria 5409
192 Ga0501034_0052466 3300049571 Bacteria 4108
193 Ga0501034_0100962 3300049571 Bacteria 2879
194 Ga0501034_0174163 3300049571 Bacteria 2118
195 Ga0501034_0262770 3300049571 Bacteria 1669
196 Ga0501034_0269809 3300049571 Bacteria 1643
197 Ga0501036_0055929 3300049572 Bacteria 3342
198 Ga0501036_0067784 3300049572 Bacteria 3019
199 Ga0501036_0083301 3300049572 Bacteria 2703
200 Ga0501036_0138116 3300049572 Bacteria 2057
201 Ga0501036_0146258 3300049572 Bacteria 1993
202 Ga0501036_0181199 3300049572 Bacteria 1773
203 Ga0501037_0001515 3300049573 Bacteria 16967
204 Ga0501037_0115229 3300049573 Bacteria 1934
205 Ga0501037_0136179 3300049573 Bacteria 1759
206 Ga0501038_0006047 3300049574 Bacteria 11201
207 Ga0501038_0023161 3300049574 Bacteria 5556
208 Ga0501039_0029109 3300049575 Bacteria 4253
209 Ga0501039_0188542 3300049575 Bacteria 1622
210 Ga0501039_0259827 3300049575 Bacteria 1365
211 Ga0501040_0032561 3300049576 Bacteria 3527
212 Ga0501042_0078593 3300049578 Bacteria 2363
213 Ga0501042_0103546 3300049578 Bacteria 2048
214 Ga0501043_0001919 3300049579 Bacteria 17802
215 Ga0501043_0099706 3300049579 Bacteria 2283
216 Ga0501043_0152600 3300049579 Bacteria 1807
217 Ga0501043_0176868 3300049579 Bacteria 1663
218 Ga0501046_0038225 3300049580 Bacteria 3854
219 Ga0501046_0091787 3300049580 Bacteria 2335
220 Ga0501046_0191680 3300049580 Bacteria 1524
221 Ga0501047_0002638 3300049581 Bacteria 17064
222 Ga0501047_0011176 3300049581 Bacteria 8495
223 Ga0501047_0098562 3300049581 Bacteria 2801
224 Ga0501047_0162680 3300049581 Bacteria 2103
225 Ga0501047_0245354 3300049581 Bacteria 1640
226 Ga0501047_0304632 3300049581 Bacteria 1435
227 Ga0501048_0196797 3300049582 Bacteria 1429
228 Ga0501067_0006408 3300049583 Bacteria 6519
229 Ga0501068_0001150 3300049584 Bacteria 14024
230 Ga0501069_0138254 3300049585 Bacteria 1397
231 Ga0501070_0000119 3300049586 Bacteria 70355
232 Ga0501071_0001359 3300049587 Bacteria 14008
233 Ga0501072_0020393 3300049588 Bacteria 5135
234 Ga0501073_0017216 3300049589 Bacteria 5235
235 Ga0501074_0001283 3300049590 Bacteria 16635
236 Ga0501074_0005339 3300049590 Bacteria 9237
237 Ga0501077_0122403 3300049593 Bacteria 1649
238 Ga0501079_0001004 3300049741 Bacteria 19523
239 Ga0501080_0020347 3300049742 Bacteria 6141
240 Ga0501083_0002036 3300049744 Bacteria 13915
241 Ga0501035_0007390 3300049822 Bacteria 10270
242 Ga0501035_0011307 3300049822 Bacteria 8272
243 Ga0501035_0027159 3300049822 Bacteria 5233
244 Ga0501035_0032714 3300049822 Bacteria 4730
245 Ga0501035_0136819 3300049822 Bacteria 2132
246 Ga0501044_0009949 3300049823 Bacteria 10331
247 Ga0501044_0027468 3300049823 Bacteria 6014
248 Ga0501044_0039748 3300049823 Bacteria 4905
249 Ga0501044_0155708 3300049823 Bacteria 2265
250 Ga0501044_0165054 3300049823 Bacteria 2189
251 Ga0501044_0187400 3300049823 Bacteria 2033
252 Ga0501044_0213605 3300049823 Bacteria 1882
253 nmdc:mga06z11_2838_c1 3300050494 Bacteria 6647
254 nmdc:mga04h51_26220_c1 3300050495 Bacteria 1800
255 Ga0500610_0016110 3300053079 Bacteria 3556
256 Ga0500640_038855 3300053095 Bacteria 2091
257 Ga0500573_0057556 3300053140 Bacteria 2230
258 Ga0501084_0025772 3300054114 Bacteria 4903
259 Ga0501082_0151489 3300060353 Bacteria 2014
260 Ga0466962_0000418 3300061719 Bacteria 18353
261 Ga0466962_0029506 3300061719 Bacteria 2626
262 Ga0530510_0053229 3300061734 Bacteria 2925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0282988 Ga0495604_0282988_184_1101 289
2 3300030521 Ga0307511_10042316 Ga0307511_100423163 311
3 3300047321 Ga0495676_0209944 Ga0495676_0209944_194_1330 315
4 3300049578 Ga0501042_0078593 Ga0501042_0078593_802_1932 317
5 3300049581 Ga0501047_0011176 Ga0501047_0011176_681_1811 317
6 3300046455 Ga0495603_0038721 Ga0495603_0038721_1344_2447 324
7 3300046499 Ga0495594_0077682 Ga0495594_0077682_411_1514 324
8 3300046689 Ga0495613_0000571 Ga0495613_0000571_9901_11004 324
9 3300047321 Ga0495676_0100176 Ga0495676_0100176_403_1506 324
10 3300048089 Ga0495614_0002764 Ga0495614_0002764_5639_6742 324
11 3300046459 Ga0495629_0027015 Ga0495629_0027015_641_1744 325
12 3300046516 Ga0495628_0027308 Ga0495628_0027308_2027_3214 327
13 3300046642 Ga0495634_0002771 Ga0495634_0002771_5579_6766 327
14 3300047321 Ga0495676_0084399 Ga0495676_0084399_220_1350 327
15 3300046459 Ga0495629_0116891 Ga0495629_0116891_133_1236 328
16 3300046501 Ga0495607_0046130 Ga0495607_0046130_132_1262 328
17 3300047447 Ga0495685_007532 Ga0495685_007532_1839_2969 328
18 3300044693 Ga0466961_0041766 Ga0466961_0041766_94_1083 329
19 3300046455 Ga0495603_0035684 Ga0495603_0035684_1598_2728 329
20 3300046460 Ga0495638_0175420 Ga0495638_0175420_100_1203 329
21 3300047321 Ga0495676_0082828 Ga0495676_0082828_315_1445 329
22 3300046557 Ga0495622_0021632 Ga0495622_0021632_1932_2933 330
23 3300047321 Ga0495676_0041632 Ga0495676_0041632_386_1387 330
24 3300049823 Ga0501044_0039748 Ga0501044_0039748_984_1976 330
25 3300046794 Ga0495589_0020871 Ga0495589_0020871_139_1269 331
26 3300046499 Ga0495594_0091135 Ga0495594_0091135_199_1329 333
27 3300049823 Ga0501044_0187400 Ga0501044_0187400_610_1629 333
28 3300049823 Ga0501044_0213605 Ga0501044_0213605_501_1514 337
29 3300041512 Ga0451853_0150950 Ga0451853_0150950_2551_3699 338
30 3300049571 Ga0501034_0174163 Ga0501034_0174163_697_1722 339
31 3300049586 Ga0501070_0000119 Ga0501070_0000119_57201_58226 339
32 3300003316 rootH1_10030130 rootH1_100301302 340
33 3300046689 Ga0495613_0232693 Ga0495613_0232693_203_1225 340
34 3300048912 Ga0496109_0044727 Ga0496109_0044727_302_1324 340
35 iso_pu_bacteria 3006425503 3006429918 340
36 iso_pu_bacteria 2935390628 2935395049 341
37 3300047321 Ga0495676_0113242 Ga0495676_0113242_161_1297 342
38 iso_pu_bacteria 2582581312 2585296587 342
39 iso_pu_bacteria 2616644941 2616899937 342
40 iso_pu_bacteria 2643221548 2643763995 342
41 iso_pu_bacteria 2643221578 2643902287 342
42 iso_pu_bacteria 2643221587 2643943883 342
43 iso_pu_bacteria 2643221670 2644386870 342
44 iso_pu_bacteria 2643221673 2644403857 342
45 iso_pu_bacteria 2643221677 2644434620 342
46 iso_pu_bacteria 2643221682 2644461572 342
47 iso_pu_bacteria 2875391855 2875396669 342
48 iso_pu_bacteria 2918501144 2918506479 342
49 iso_pu_bacteria 2946045630 2946047886 342
50 iso_pu_bacteria 3006486233 3006491292 342
51 iso_pu_bacteria 8025530807 8025531343 343
52 3300025302 Ga0207426_1018164 Ga0207426_10181642 344
53 iso_pu_bacteria 2808606982 2811844437 344
54 iso_pu_bacteria 2862178590 2862186385 344
55 iso_pu_bacteria 2997451912 2997452838 344
56 iso_pu_bacteria 8054160619 8054163332 344
57 3300030522 Ga0307512_10122584 Ga0307512_101225842 345
58 3300046529 Ga0495652_0069736 Ga0495652_0069736_182_1318 345
59 3300046533 Ga0495640_0032941 Ga0495640_0032941_2146_3282 345
60 3300046660 Ga0495625_0206999 Ga0495625_0206999_61_1194 345
61 iso_pu_bacteria 2643221647 2644265833 345
62 iso_pu_bacteria 2867475112 2867481135 345
63 iso_pu_bacteria 2912757875 2912762722 345
64 iso_pu_bacteria 2954380949 2954384033 345
65 iso_pu_bacteria 2954691527 2954694832 345
66 iso_pu_bacteria 2954701450 2954710034 345
67 iso_pu_bacteria 2873151551 2873154081 346
68 iso_pu_bacteria 2990088156 2990092817 346
69 iso_pu_bacteria 2862574272 2862577536 347
70 3300003354 JGI25160J50197_1012892 JGI25160J50197_10128921 348
71 3300025302 Ga0207426_1003290 Ga0207426_10032908 348
72 3300049571 Ga0501034_0031253 Ga0501034_0031253_992_2137 348
73 3300006948 Ga0099826_10028878 Ga0099826_100288783 349
74 3300027666 Ga0209282_1050186 Ga0209282_10501862 349
75 3300031456 Ga0307513_10019853 Ga0307513_100198533 349
76 3300047447 Ga0495685_009070 Ga0495685_009070_2004_3089 349
77 iso_pu_bacteria 2554235005 2554256252 349
78 iso_pu_bacteria 2811994917 2812478780 349
79 3300031649 Ga0307514_10053006 Ga0307514_100530062 350
80 3300042131 Ga0450894_000941 Ga0450894_000941_2135_3280 350
81 3300042134 Ga0450898_000551 Ga0450898_000551_252_1397 350
82 3300042145 Ga0450906_000509 Ga0450906_000509_5054_6199 350
83 3300042184 Ga0450908_001151 Ga0450908_001151_1899_3044 350
84 iso_pu_bacteria 2862290372 2862291085 350
85 iso_pu_bacteria 2802429296 2804847877 351
86 iso_pu_bacteria 2808606375 2808913596 351
87 iso_pu_bacteria 2954002825 2954005445 351
88 iso_pu_bacteria 8025413630 8025413938 351
89 iso_pu_bacteria 8056829672 8056832173 351
90 3300003320 rootH2_10153437 rootH2_101534371 352
91 3300006178 Ga0075367_10000321 Ga0075367_100003212 352
92 3300044658 Ga0466972_0007341 Ga0466972_0007341_750_1883 352
93 3300046459 Ga0495629_0017969 Ga0495629_0017969_2917_4053 352
94 3300046473 Ga0495582_0019161 Ga0495582_0019161_732_1868 352
95 3300046476 Ga0495662_0021110 Ga0495662_0021110_1042_2178 352
96 3300049568 Ga0501031_0187858 Ga0501031_0187858_70_1200 352
97 3300049569 Ga0501032_0012955 Ga0501032_0012955_215_1366 352
98 3300049570 Ga0501033_0010056 Ga0501033_0010056_4262_5392 352
99 3300049570 Ga0501033_0027732 Ga0501033_0027732_3052_4197 352
100 3300049571 Ga0501034_0100962 Ga0501034_0100962_1401_2531 352
101 3300049571 Ga0501034_0262770 Ga0501034_0262770_221_1372 352
102 3300049572 Ga0501036_0067784 Ga0501036_0067784_850_1995 352
103 3300049572 Ga0501036_0083301 Ga0501036_0083301_134_1264 352
104 3300049572 Ga0501036_0181199 Ga0501036_0181199_108_1259 352
105 3300049574 Ga0501038_0023161 Ga0501038_0023161_399_1529 352
106 3300049575 Ga0501039_0029109 Ga0501039_0029109_934_2079 352
107 3300049575 Ga0501039_0188542 Ga0501039_0188542_226_1377 352
108 3300049579 Ga0501043_0099706 Ga0501043_0099706_191_1321 352
109 3300049579 Ga0501043_0176868 Ga0501043_0176868_504_1649 352
110 3300049581 Ga0501047_0098562 Ga0501047_0098562_258_1409 352
111 3300049590 Ga0501074_0001283 Ga0501074_0001283_1025_2170 352
112 3300049822 Ga0501035_0011307 Ga0501035_0011307_5254_6396 352
113 3300049822 Ga0501035_0027159 Ga0501035_0027159_882_2027 352
114 3300049822 Ga0501035_0032714 Ga0501035_0032714_1510_2661 352
115 3300050494 nmdc:mga06z11_2838_c1 nmdc:mga06z11_2838_c1_3807_4946 352
116 3300050495 nmdc:mga04h51_26220_c1 nmdc:mga04h51_26220_c1_330_1469 352
117 iso_pu_bacteria 2582581313 2585309028 352
118 iso_pu_bacteria 2784746768 2785371474 352
119 iso_pu_bacteria 2786546132 2786672633 352
120 iso_pu_bacteria 2862382967 2862388111 352
121 iso_pu_bacteria 2867428634 2867430543 352
122 iso_pu_bacteria 2877676314 2877679129 352
123 iso_pu_bacteria 2912715099 2912717641 352
124 iso_pu_bacteria 2912723979 2912730194 352
125 iso_pu_bacteria 2954673503 2954678925 352
126 iso_pu_bacteria 2954682443 2954685226 352
127 iso_pu_bacteria 2954711539 2954714344 352
128 iso_pu_bacteria 2954721474 2954724293 352
129 iso_pu_bacteria 2954731030 2954737546 352
130 iso_pu_bacteria 2954740390 2954743190 352
131 iso_pu_bacteria 2954749733 2954756380 352
132 iso_pu_bacteria 2954759201 2954762148 352
133 iso_pu_bacteria 3006321560 3006322567 352
134 iso_pu_bacteria 8008558824 8008562759 352
135 3300030522 Ga0307512_10002661 Ga0307512_1000266122 353
136 3300031616 Ga0307508_10104993 Ga0307508_101049932 353
137 3300044658 Ga0466972_0005212 Ga0466972_0005212_4198_5331 353
138 3300044901 Ga0466960_0047878 Ga0466960_0047878_663_1796 353
139 3300049823 Ga0501044_0027468 Ga0501044_0027468_2073_3212 353
140 iso_pu_bacteria 2582581314 2585319218 353
141 iso_pu_bacteria 2616644814 2616697272 353
142 iso_pu_bacteria 2643221678 2644440027 353
143 iso_pu_bacteria 2643221714 2644632649 353
144 iso_pu_bacteria 2808606359 2808844005 353
145 iso_pu_bacteria 2811994879 2812355971 353
146 iso_pu_bacteria 2852635781 2852640996 353
147 iso_pu_bacteria 2862281513 2862284775 353
148 iso_pu_bacteria 2862507626 2862512704 353
149 iso_pu_bacteria 2919468124 2919471710 353
150 iso_pu_bacteria 2946064051 2946069816 353
151 iso_pu_bacteria 2946072368 2946077737 353
152 iso_pu_bacteria 2947224130 2947226984 353
153 iso_pu_bacteria 3006393351 3006393565 353
154 iso_pu_bacteria 3006493962 3006500094 353
155 iso_pu_bacteria 8008574985 8008577194 353
156 3300005937 Ga0081455_10009187 Ga0081455_100091871 354
157 3300030521 Ga0307511_10028636 Ga0307511_100286362 354
158 3300044658 Ga0466972_0044571 Ga0466972_0044571_170_1306 354
159 3300044719 Ga0466971_0092354 Ga0466971_0092354_39_1175 354
160 3300044765 Ga0466970_0036100 Ga0466970_0036100_74_1210 354
161 3300046455 Ga0495603_0004525 Ga0495603_0004525_5065_6201 354
162 3300046455 Ga0495603_0024520 Ga0495603_0024520_235_1362 354
163 3300046475 Ga0495639_0034014 Ga0495639_0034014_575_1702 354
164 3300046499 Ga0495594_0009077 Ga0495594_0009077_903_2039 354
165 3300046506 Ga0495583_0062369 Ga0495583_0062369_282_1421 354
166 3300046528 Ga0495642_0027051 Ga0495642_0027051_733_1869 354
167 3300046663 Ga0495635_0032268 Ga0495635_0032268_650_1786 354
168 3300046674 Ga0495588_0008618 Ga0495588_0008618_2556_3692 354
169 3300046675 Ga0495657_0022146 Ga0495657_0022146_2224_3360 354
170 3300046689 Ga0495613_0111831 Ga0495613_0111831_174_1310 354
171 3300046794 Ga0495589_0016963 Ga0495589_0016963_277_1413 354
172 3300046809 Ga0495600_0061255 Ga0495600_0061255_1024_2160 354
173 3300047318 Ga0495636_0051961 Ga0495636_0051961_274_1413 354
174 3300047318 Ga0495636_0053077 Ga0495636_0053077_255_1394 354
175 3300047443 Ga0495687_032470 Ga0495687_032470_961_2100 354
176 3300047444 Ga0495675_0053720 Ga0495675_0053720_1262_2398 354
177 3300047447 Ga0495685_006836 Ga0495685_006836_262_1401 354
178 3300047447 Ga0495685_009113 Ga0495685_009113_405_1541 354
179 3300049570 Ga0501033_0194225 Ga0501033_0194225_107_1264 354
180 3300049571 Ga0501034_0052466 Ga0501034_0052466_807_1946 354
181 3300049572 Ga0501036_0138116 Ga0501036_0138116_299_1438 354
182 3300049573 Ga0501037_0115229 Ga0501037_0115229_52_1209 354
183 3300049574 Ga0501038_0006047 Ga0501038_0006047_5099_6238 354
184 3300049575 Ga0501039_0259827 Ga0501039_0259827_159_1316 354
185 3300049578 Ga0501042_0103546 Ga0501042_0103546_743_1900 354
186 3300049580 Ga0501046_0091787 Ga0501046_0091787_137_1294 354
187 3300049581 Ga0501047_0162680 Ga0501047_0162680_147_1286 354
188 3300049582 Ga0501048_0196797 Ga0501048_0196797_149_1306 354
189 3300049585 Ga0501069_0138254 Ga0501069_0138254_89_1228 354
190 3300049823 Ga0501044_0155708 Ga0501044_0155708_909_2066 354
191 3300061719 Ga0466962_0029506 Ga0466962_0029506_156_1292 354
192 iso_pu_bacteria 2547132111 2547408421 354
193 iso_pu_bacteria 2784132148 2784590385 354
194 iso_pu_bacteria 2784746763 2785341230 354
195 iso_pu_bacteria 2808606448 2809234059 354
196 iso_pu_bacteria 2863404153 2863408584 354
197 iso_pu_bacteria 2873151551 2873158373 354
198 iso_pu_bacteria 8023623736 8023627164 354
199 iso_pu_bacteria 8048406513 8048411952 354
200 3300013105 Ga0157369_10183441 Ga0157369_101834412 355
201 3300025904 Ga0207647_10001930 Ga0207647_100019308 355
202 3300031616 Ga0307508_10106496 Ga0307508_101064962 355
203 3300037418 Ga0395900_0035086 Ga0395900_0035086_1360_2472 355
204 3300037466 Ga0395898_0044623 Ga0395898_0044623_236_1348 355
205 3300037471 Ga0395905_0077895 Ga0395905_0077895_289_1401 355
206 3300041491 Ga0451833_0299565 Ga0451833_0299565_369_1466 355
207 3300044683 Ga0466965_0014220 Ga0466965_0014220_540_1673 355
208 3300044684 Ga0466966_0005431 Ga0466966_0005431_6394_7527 355
209 3300044693 Ga0466961_0000308 Ga0466961_0000308_789_1922 355
210 3300044694 Ga0466963_0001216 Ga0466963_0001216_801_1934 355
211 3300044706 Ga0466964_0045038 Ga0466964_0045038_575_1708 355
212 3300044719 Ga0466971_0002002 Ga0466971_0002002_1234_2367 355
213 3300044765 Ga0466970_0006047 Ga0466970_0006047_480_1613 355
214 3300044842 Ga0466957_0000605 Ga0466957_0000605_12580_13713 355
215 3300045049 Ga0466959_0000486 Ga0466959_0000486_15848_16981 355
216 3300045836 Ga0466958_0000413 Ga0466958_0000413_11733_12866 355
217 3300045976 Ga0466967_0003786 Ga0466967_0003786_1303_2436 355
218 3300046459 Ga0495629_0021516 Ga0495629_0021516_357_1523 355
219 3300046474 Ga0495605_0001651 Ga0495605_0001651_12607_13746 355
220 3300046515 Ga0495620_0007475 Ga0495620_0007475_329_1468 355
221 3300049570 Ga0501033_0005722 Ga0501033_0005722_5828_6964 355
222 3300049572 Ga0501036_0146258 Ga0501036_0146258_483_1634 355
223 3300061719 Ga0466962_0000418 Ga0466962_0000418_4768_5901 355
224 iso_pu_bacteria 2862574272 2862575697 355
225 iso_pu_bacteria 2862574272 2862580539 355
226 3300003316 rootH1_10030131 rootH1_100301312 356
227 3300003323 rootH1_10135036 rootH1_101350362 356
228 3300030500 Ga0268256_1020697 Ga0268256_10206972 356
229 3300042012 Ga0439455_0003006 Ga0439455_0003006_1166_2272 356
230 3300042138 Ga0450903_000144 Ga0450903_000144_11162_12268 356
231 3300042157 Ga0439458_0001018 Ga0439458_0001018_3229_4335 356
232 3300046506 Ga0495583_0019689 Ga0495583_0019689_2167_3303 356
233 3300046533 Ga0495640_0038448 Ga0495640_0038448_2122_3249 356
234 3300046694 Ga0495649_0084817 Ga0495649_0084817_287_1420 356
235 3300047317 Ga0495604_0069754 Ga0495604_0069754_58_1185 356
236 3300049568 Ga0501031_0003389 Ga0501031_0003389_3293_4408 356
237 3300049570 Ga0501033_0015813 Ga0501033_0015813_467_1582 356
238 3300049571 Ga0501034_0003253 Ga0501034_0003253_7243_8358 356
239 3300049572 Ga0501036_0055929 Ga0501036_0055929_17_1132 356
240 3300049573 Ga0501037_0001515 Ga0501037_0001515_2211_3326 356
241 3300049576 Ga0501040_0032561 Ga0501040_0032561_741_1856 356
242 3300049579 Ga0501043_0001919 Ga0501043_0001919_16396_17511 356
243 3300049580 Ga0501046_0038225 Ga0501046_0038225_191_1306 356
244 3300049581 Ga0501047_0002638 Ga0501047_0002638_10183_11298 356
245 3300049581 Ga0501047_0304632 Ga0501047_0304632_62_1177 356
246 3300049583 Ga0501067_0006408 Ga0501067_0006408_4165_5280 356
247 3300049584 Ga0501068_0001150 Ga0501068_0001150_149_1264 356
248 3300049587 Ga0501071_0001359 Ga0501071_0001359_10251_11366 356
249 3300049588 Ga0501072_0020393 Ga0501072_0020393_728_1843 356
250 3300049589 Ga0501073_0017216 Ga0501073_0017216_3983_5098 356
251 3300049590 Ga0501074_0005339 Ga0501074_0005339_4165_5280 356
252 3300049593 Ga0501077_0122403 Ga0501077_0122403_511_1626 356
253 3300049741 Ga0501079_0001004 Ga0501079_0001004_18245_19360 356
254 3300049742 Ga0501080_0020347 Ga0501080_0020347_161_1276 356
255 3300049744 Ga0501083_0002036 Ga0501083_0002036_12657_13772 356
256 3300049822 Ga0501035_0007390 Ga0501035_0007390_2150_3265 356
257 3300049823 Ga0501044_0009949 Ga0501044_0009949_7006_8121 356
258 3300054114 Ga0501084_0025772 Ga0501084_0025772_2261_3376 356
259 3300060353 Ga0501082_0151489 Ga0501082_0151489_120_1235 356
260 3300061734 Ga0530510_0053229 Ga0530510_0053229_370_1485 356
261 3300003322 rootL2_10023807 rootL2_100238071 357
262 3300003578 Ga0006562J51391_1054525 Ga0006562J51391_10545251 357
263 3300005539 Ga0068853_100348003 Ga0068853_1003480031 357
264 3300014497 Ga0182008_10000936 Ga0182008_1000093619 357
265 3300015261 Ga0182006_1015910 Ga0182006_10159102 357
266 3300015262 Ga0182007_10002331 Ga0182007_100023313 357
267 3300015688 Ga0183367_1002 Ga0183367_100293 357
268 3300025297 Ga0209758_1001875 Ga0209758_100187524 357
269 3300026041 Ga0207639_10274612 Ga0207639_102746122 357
270 3300028786 Ga0307517_10003529 Ga0307517_100035297 357
271 3300028794 Ga0307515_10014631 Ga0307515_100146313 357
272 3300030521 Ga0307511_10074482 Ga0307511_100744822 357
273 3300031616 Ga0307508_10043883 Ga0307508_100438832 357
274 3300031649 Ga0307514_10109878 Ga0307514_101098782 357
275 3300031649 Ga0307514_10169498 Ga0307514_101694981 357
276 3300033179 Ga0307507_10044409 Ga0307507_100444093 357
277 3300033180 Ga0307510_10030925 Ga0307510_100309252 357
278 3300033180 Ga0307510_10072490 Ga0307510_100724905 357
279 3300037466 Ga0395898_0003850 Ga0395898_0003850_2556_3692 357
280 3300037466 Ga0395898_0008215 Ga0395898_0008215_9495_10625 357
281 3300038443 Ga0395901_0347495 Ga0395901_0347495_256_1392 357
282 3300041404 Ga0439436_0000487 Ga0439436_0000487_6253_7389 357
283 3300041999 Ga0439433_0007107 Ga0439433_0007107_1133_2269 357
284 3300042002 Ga0439442_001427 Ga0439442_001427_627_1763 357
285 3300042015 Ga0439462_0001217 Ga0439462_0001217_644_1780 357
286 3300044658 Ga0466972_0030299 Ga0466972_0030299_952_2091 357
287 3300044684 Ga0466966_0049053 Ga0466966_0049053_619_1758 357
288 3300046455 Ga0495603_0166480 Ga0495603_0166480_109_1248 357
289 3300046459 Ga0495629_0039014 Ga0495629_0039014_430_1566 357
290 3300046462 Ga0495651_0007778 Ga0495651_0007778_4031_5167 357
291 3300046462 Ga0495651_0157700 Ga0495651_0157700_320_1459 357
292 3300046472 Ga0495580_0193732 Ga0495580_0193732_96_1235 357
293 3300046473 Ga0495582_0011716 Ga0495582_0011716_3497_4633 357
294 3300046476 Ga0495662_0012109 Ga0495662_0012109_926_2062 357
295 3300046499 Ga0495594_0151288 Ga0495594_0151288_149_1288 357
296 3300046511 Ga0495608_0015100 Ga0495608_0015100_3776_4915 357
297 3300046513 Ga0495616_0014079 Ga0495616_0014079_1350_2489 357
298 3300046518 Ga0495631_0004578 Ga0495631_0004578_3804_4943 357
299 3300046519 Ga0495632_0098639 Ga0495632_0098639_172_1311 357
300 3300046536 Ga0495587_0004186 Ga0495587_0004186_3421_4557 357
301 3300046557 Ga0495622_0023271 Ga0495622_0023271_628_1767 357
302 3300046642 Ga0495634_0002467 Ga0495634_0002467_2891_4027 357
303 3300046642 Ga0495634_0099756 Ga0495634_0099756_270_1409 357
304 3300046660 Ga0495625_0002557 Ga0495625_0002557_13774_14910 357
305 3300046663 Ga0495635_0001012 Ga0495635_0001012_8689_9825 357
306 3300046663 Ga0495635_0004862 Ga0495635_0004862_1435_2574 357
307 3300046674 Ga0495588_0001725 Ga0495588_0001725_8158_9294 357
308 3300046675 Ga0495657_0000997 Ga0495657_0000997_20595_21731 357
309 3300046680 Ga0495646_0005312 Ga0495646_0005312_3102_4238 357
310 3300046689 Ga0495613_0109018 Ga0495613_0109018_189_1328 357
311 3300046691 Ga0495670_0092481 Ga0495670_0092481_378_1517 357
312 3300046692 Ga0495671_0017411 Ga0495671_0017411_70_1206 357
313 3300046692 Ga0495671_0046863 Ga0495671_0046863_98_1237 357
314 3300046809 Ga0495600_0019253 Ga0495600_0019253_1619_2755 357
315 3300047315 Ga0495581_0015484 Ga0495581_0015484_205_1341 357
316 3300047315 Ga0495581_0049588 Ga0495581_0049588_299_1438 357
317 3300047317 Ga0495604_0000623 Ga0495604_0000623_24043_25179 357
318 3300047319 Ga0495674_0211685 Ga0495674_0211685_424_1563 357
319 3300047321 Ga0495676_0013591 Ga0495676_0013591_2284_3420 357
320 3300047443 Ga0495687_022709 Ga0495687_022709_1352_2491 357
321 3300047470 Ga0495681_0000926 Ga0495681_0000926_9375_10511 357
322 3300047470 Ga0495681_0085138 Ga0495681_0085138_168_1307 357
323 3300047471 Ga0495684_0181796 Ga0495684_0181796_52_1188 357
324 3300047673 Ga0495593_0006464 Ga0495593_0006464_3564_4700 357
325 3300048088 Ga0495602_0036652 Ga0495602_0036652_2128_3264 357
326 3300048091 Ga0495626_0025356 Ga0495626_0025356_1175_2314 357
327 3300049579 Ga0501043_0152600 Ga0501043_0152600_194_1354 357
328 3300053079 Ga0500610_0016110 Ga0500610_0016110_2273_3409 357
329 3300053095 Ga0500640_038855 Ga0500640_038855_901_2037 357
330 3300053140 Ga0500573_0057556 Ga0500573_0057556_907_2043 357
331 3300001989 JGI24739J22299_10005583 JGI24739J22299_100055832 358
332 3300001990 JGI24737J22298_10005506 JGI24737J22298_100055063 358
333 3300010375 Ga0105239_10472470 Ga0105239_104724701 358
334 3300011119 Ga0105246_10019425 Ga0105246_100194253 358
335 3300031838 Ga0307518_10034689 Ga0307518_100346892 358
336 3300041404 Ga0439436_0002264 Ga0439436_0002264_3040_4182 358
337 3300042014 Ga0439457_000883 Ga0439457_000883_5564_6706 358
338 3300049571 Ga0501034_0269809 Ga0501034_0269809_136_1299 358
339 3300049573 Ga0501037_0136179 Ga0501037_0136179_371_1534 358
340 3300049580 Ga0501046_0191680 Ga0501046_0191680_190_1353 358
341 3300049581 Ga0501047_0245354 Ga0501047_0245354_106_1269 358
342 3300049822 Ga0501035_0136819 Ga0501035_0136819_138_1301 358
343 3300049823 Ga0501044_0165054 Ga0501044_0165054_854_2017 358
344 iso_pu_bacteria 2990059506 2990062916 358

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03816

LytR_cpsA_psr

LytR_cpsA_psr family

126

283

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mpt-assembly1.cif.gz_A tagt bound to li-wta 0.814 57 334
3nxh-assembly1.cif.gz_A crystal structure of the transcriptional regulator yvhj from bacillus subtilis. northeast structural genomics consortium target sr735. 0.8073 63 334
4de9-assembly1.cif.gz_A lytr-cps2a-psr family protein ywtf (tagt) with bound octaprenyl pyrophosphate lipid 0.8048 57 334
6uf3-assembly1.cif.gz_A crystal structure of b. subtilis tagv 0.8022 63 334
3mej-assembly1.cif.gz_A crystal structure of putative transcriptional regulator ywtf from bacillus subtilis, northeast structural genomics consortium target sr736 0.7979 57 338
ID Description Score Start End Superfamily
af_I6WZI4_217_505_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.8098 66 330 3.40.630.190
4de9A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8015 57 334 3.30.420.590
af_Q7BHL7_76_327_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.7919 64 333 3.40.630.190
af_P96872_54_354_3.40.630.190 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.789 63 335 3.40.630.190
3nxhA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;LCP protein 0.7853 64 334 3.40.630.190
ID Description Score Start End GO Terms
AF-A0A563EQR6-F1-model_v4 LytR family transcriptional regulator 0.9345 33 331 GO:0016020
AF-A0A6G3AFL7-F1-model_v4 LytR family transcriptional regulator 0.9263 33 348
AF-A0A4D4LU13-F1-model_v4 Transcriptional regulator 0.9258 100 318
AF-A0A846RW41-F1-model_v4 LCP family protein required for cell wall assembly 0.9204 33 343 GO:0016020
AF-A0A100JH17-F1-model_v4 deleted 0.9166 32 335

Feature Viewer

pLDDT pTM Quality
78.8 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map