F416209
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 154 | 345 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300002067|JGI24735J21928_10031808|JGI24735J21928_100318082 |
| Length | 144 |
| Sequence | MILKNEDXTAELGARLARVAEPGDVISLSGPLGVGKTALARGFIGALGHQGDVPSPSFAIVQPYEELDPPVWHVDLYRIEQASEIDELGLDSAADAVLIVEWPERAGDNKWPEALALSLDFASEGQRILTAKVPPSWEGRWPPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 122 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 123 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 128 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 135 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 141 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.61 |
| Rhizosphere | 97.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10031808 | 3300002067 | Bacteria | 1563 |
| 2 | Ga0070658_10002158 | 3300005327 | Bacteria | 16504 |
| 3 | Ga0070658_10009061 | 3300005327 | Bacteria | 8006 |
| 4 | Ga0070658_10087315 | 3300005327 | Bacteria | 2567 |
| 5 | Ga0070658_10352440 | 3300005327 | Bacteria | 1260 |
| 6 | Ga0070658_10363744 | 3300005327 | Bacteria | 1239 |
| 7 | Ga0070676_10000204 | 3300005328 | Bacteria | 25189 |
| 8 | Ga0070683_100228097 | 3300005329 | Bacteria | 1770 |
| 9 | Ga0070670_100057131 | 3300005331 | Bacteria | 3350 |
| 10 | Ga0070670_100472360 | 3300005331 | Unclassified | 1113 |
| 11 | Ga0070666_10209931 | 3300005335 | Bacteria | 1371 |
| 12 | Ga0070680_100000070 | 3300005336 | Bacteria | 54377 |
| 13 | Ga0068868_101286588 | 3300005338 | Bacteria | 679 |
| 14 | Ga0070660_100000370 | 3300005339 | Bacteria | 30017 |
| 15 | Ga0070660_100054944 | 3300005339 | Bacteria | 3076 |
| 16 | Ga0070660_100081353 | 3300005339 | Bacteria | 2543 |
| 17 | Ga0070660_100089359 | 3300005339 | Bacteria | 2427 |
| 18 | Ga0070660_100163813 | 3300005339 | Bacteria | 1793 |
| 19 | Ga0070660_100182800 | 3300005339 | Bacteria | 1697 |
| 20 | Ga0070660_100542296 | 3300005339 | Bacteria | 970 |
| 21 | Ga0070691_10018197 | 3300005341 | Bacteria | 3238 |
| 22 | Ga0070687_100061417 | 3300005343 | Bacteria | 1986 |
| 23 | Ga0070661_100232020 | 3300005344 | Bacteria | 1419 |
| 24 | Ga0070661_100308985 | 3300005344 | Bacteria | 1232 |
| 25 | Ga0070661_100507878 | 3300005344 | Bacteria | 965 |
| 26 | Ga0070692_10007977 | 3300005345 | Bacteria | 4697 |
| 27 | Ga0070692_10017657 | 3300005345 | Bacteria | 3417 |
| 28 | Ga0070692_10106505 | 3300005345 | Bacteria | 1545 |
| 29 | Ga0070668_100001063 | 3300005347 | Bacteria | 19329 |
| 30 | Ga0070669_100202486 | 3300005353 | Bacteria | 1562 |
| 31 | Ga0070675_100044296 | 3300005354 | Bacteria | 3639 |
| 32 | Ga0070671_100273633 | 3300005355 | Bacteria | 1435 |
| 33 | Ga0070674_100019620 | 3300005356 | Bacteria | 4298 |
| 34 | Ga0070673_100021335 | 3300005364 | Bacteria | 4694 |
| 35 | Ga0070673_100050553 | 3300005364 | Bacteria | 3251 |
| 36 | Ga0070673_101328775 | 3300005364 | Unclassified | 675 |
| 37 | Ga0070659_100037242 | 3300005366 | Bacteria | 3792 |
| 38 | Ga0070659_100092775 | 3300005366 | Bacteria | 2422 |
| 39 | Ga0070659_100171408 | 3300005366 | Bacteria | 1778 |
| 40 | Ga0070659_101583659 | 3300005366 | Bacteria | 585 |
| 41 | Ga0070667_100002310 | 3300005367 | Bacteria | 16727 |
| 42 | Ga0070667_100132767 | 3300005367 | Bacteria | 2174 |
| 43 | Ga0070667_100766189 | 3300005367 | Bacteria | 895 |
| 44 | Ga0070714_100038061 | 3300005435 | Bacteria | 4044 |
| 45 | Ga0070700_100230936 | 3300005441 | Bacteria | 1317 |
| 46 | Ga0070663_100052085 | 3300005455 | Bacteria | 2918 |
| 47 | Ga0070663_100898029 | 3300005455 | Bacteria | 765 |
| 48 | Ga0070678_100037598 | 3300005456 | Bacteria | 3401 |
| 49 | Ga0070662_100068720 | 3300005457 | Bacteria | 2605 |
| 50 | Ga0070662_100699276 | 3300005457 | Bacteria | 858 |
| 51 | Ga0070662_101236827 | 3300005457 | Bacteria | 642 |
| 52 | Ga0070681_10122274 | 3300005458 | Bacteria | 2536 |
| 53 | Ga0070681_10317459 | 3300005458 | Bacteria | 1467 |
| 54 | Ga0070681_10358729 | 3300005458 | Bacteria | 1368 |
| 55 | Ga0070681_10594485 | 3300005458 | Bacteria | 1021 |
| 56 | Ga0068867_100025830 | 3300005459 | Bacteria | 4213 |
| 57 | Ga0068867_100334382 | 3300005459 | Bacteria | 1259 |
| 58 | Ga0070679_100011214 | 3300005530 | Bacteria | 8545 |
| 59 | Ga0070679_100129285 | 3300005530 | Bacteria | 2507 |
| 60 | Ga0070679_100239873 | 3300005530 | Bacteria | 1770 |
| 61 | Ga0070684_100046273 | 3300005535 | Bacteria | 3770 |
| 62 | Ga0070684_100212987 | 3300005535 | Bacteria | 1761 |
| 63 | Ga0070684_100725886 | 3300005535 | Bacteria | 927 |
| 64 | Ga0068853_100011023 | 3300005539 | Bacteria | 7331 |
| 65 | Ga0068853_100256874 | 3300005539 | Bacteria | 1605 |
| 66 | Ga0070672_100183229 | 3300005543 | Bacteria | 1746 |
| 67 | Ga0070672_100324292 | 3300005543 | Bacteria | 1309 |
| 68 | Ga0070696_100008542 | 3300005546 | Bacteria | 6855 |
| 69 | Ga0068855_100000480 | 3300005563 | Bacteria | 49187 |
| 70 | Ga0068855_100030068 | 3300005563 | Bacteria | 6496 |
| 71 | Ga0068855_100241763 | 3300005563 | Bacteria | 2017 |
| 72 | Ga0068855_100492897 | 3300005563 | Bacteria | 1332 |
| 73 | Ga0068855_100561900 | 3300005563 | Bacteria | 1234 |
| 74 | Ga0068855_100710193 | 3300005563 | Bacteria | 1075 |
| 75 | Ga0070664_100002402 | 3300005564 | Bacteria | 15042 |
| 76 | Ga0070664_100006951 | 3300005564 | Bacteria | 9120 |
| 77 | Ga0070664_100205217 | 3300005564 | Bacteria | 1760 |
| 78 | Ga0070664_100421737 | 3300005564 | Bacteria | 1222 |
| 79 | Ga0068857_100047913 | 3300005577 | Bacteria | 3795 |
| 80 | Ga0068857_100127133 | 3300005577 | Bacteria | 2297 |
| 81 | Ga0068857_100145388 | 3300005577 | Bacteria | 2145 |
| 82 | Ga0068854_100012079 | 3300005578 | Bacteria | 5647 |
| 83 | Ga0068856_100259482 | 3300005614 | Bacteria | 1753 |
| 84 | Ga0068856_100795996 | 3300005614 | Bacteria | 965 |
| 85 | Ga0070702_100478858 | 3300005615 | Bacteria | 909 |
| 86 | Ga0068852_100003350 | 3300005616 | Bacteria | 11184 |
| 87 | Ga0068852_101678578 | 3300005616 | Bacteria | 658 |
| 88 | Ga0068859_100017730 | 3300005617 | Bacteria | 7158 |
| 89 | Ga0068859_100045724 | 3300005617 | Bacteria | 4398 |
| 90 | Ga0068859_100585165 | 3300005617 | Bacteria | 1210 |
| 91 | Ga0068864_100008590 | 3300005618 | Bacteria | 8429 |
| 92 | Ga0068864_100017483 | 3300005618 | Bacteria | 5979 |
| 93 | Ga0068861_100083815 | 3300005719 | Bacteria | 2501 |
| 94 | Ga0068861_100375203 | 3300005719 | Bacteria | 1255 |
| 95 | Ga0068851_10128363 | 3300005834 | Bacteria | 1369 |
| 96 | Ga0068863_100030014 | 3300005841 | Bacteria | 5193 |
| 97 | Ga0068858_100012128 | 3300005842 | Bacteria | 8124 |
| 98 | Ga0068858_100055951 | 3300005842 | Bacteria | 3646 |
| 99 | Ga0068860_100056420 | 3300005843 | Bacteria | 3734 |
| 100 | Ga0068860_100484119 | 3300005843 | Bacteria | 1233 |
| 101 | Ga0068862_100007655 | 3300005844 | Bacteria | 8944 |
| 102 | Ga0068862_100017592 | 3300005844 | Bacteria | 5952 |
| 103 | Ga0068862_100117395 | 3300005844 | Bacteria | 2342 |
| 104 | Ga0068862_100132518 | 3300005844 | Bacteria | 2206 |
| 105 | Ga0068865_100015652 | 3300006881 | Bacteria | 4839 |
| 106 | Ga0068865_100530059 | 3300006881 | Bacteria | 986 |
| 107 | Ga0097620_100017729 | 3300006931 | Bacteria | 7158 |
| 108 | Ga0097620_100045718 | 3300006931 | Bacteria | 4398 |
| 109 | Ga0097620_100585199 | 3300006931 | Bacteria | 1210 |
| 110 | Ga0105251_10315096 | 3300009011 | Bacteria | 710 |
| 111 | Ga0105250_10152447 | 3300009092 | Bacteria | 962 |
| 112 | Ga0105240_10067574 | 3300009093 | Bacteria | 4430 |
| 113 | Ga0105243_11270096 | 3300009148 | Bacteria | 752 |
| 114 | Ga0105241_10158119 | 3300009174 | Bacteria | 1860 |
| 115 | Ga0105248_10003809 | 3300009177 | Bacteria | 16725 |
| 116 | Ga0105248_10077606 | 3300009177 | Bacteria | 3734 |
| 117 | Ga0105248_11406118 | 3300009177 | Bacteria | 789 |
| 118 | Ga0105237_10158849 | 3300009545 | Bacteria | 2258 |
| 119 | Ga0105238_10679638 | 3300009551 | Bacteria | 1041 |
| 120 | Ga0105249_10051483 | 3300009553 | Bacteria | 3757 |
| 121 | Ga0105249_10295180 | 3300009553 | Bacteria | 1624 |
| 122 | Ga0105032_117650 | 3300009979 | Bacteria | 561 |
| 123 | Ga0105246_10013856 | 3300011119 | Bacteria | 5060 |
| 124 | Ga0157373_10016146 | 3300013100 | Bacteria | 5450 |
| 125 | Ga0157373_10021334 | 3300013100 | Bacteria | 4705 |
| 126 | Ga0157373_10228098 | 3300013100 | Bacteria | 1315 |
| 127 | Ga0157373_10423534 | 3300013100 | Bacteria | 956 |
| 128 | Ga0157371_10001045 | 3300013102 | Bacteria | 30368 |
| 129 | Ga0157371_10024452 | 3300013102 | Bacteria | 4411 |
| 130 | Ga0157371_10026857 | 3300013102 | Bacteria | 4181 |
| 131 | Ga0157371_10036698 | 3300013102 | Bacteria | 3510 |
| 132 | Ga0157371_10082658 | 3300013102 | Bacteria | 2274 |
| 133 | Ga0157371_10185798 | 3300013102 | Bacteria | 1487 |
| 134 | Ga0157371_10686961 | 3300013102 | Bacteria | 766 |
| 135 | Ga0157370_10030555 | 3300013104 | Bacteria | 5278 |
| 136 | Ga0157370_10034449 | 3300013104 | Bacteria | 4931 |
| 137 | Ga0157370_10039932 | 3300013104 | Bacteria | 4533 |
| 138 | Ga0157369_10004227 | 3300013105 | Bacteria | 17007 |
| 139 | Ga0157369_10019984 | 3300013105 | Bacteria | 7489 |
| 140 | Ga0157369_10270550 | 3300013105 | Bacteria | 1770 |
| 141 | Ga0157369_10480639 | 3300013105 | Bacteria | 1286 |
| 142 | Ga0163162_10091789 | 3300013306 | Bacteria | 3120 |
| 143 | Ga0157372_10003858 | 3300013307 | Bacteria | 16114 |
| 144 | Ga0157375_11143530 | 3300013308 | Bacteria | 912 |
| 145 | Ga0163163_10555355 | 3300014325 | Bacteria | 1211 |
| 146 | Ga0182008_10132711 | 3300014497 | Bacteria | 1242 |
| 147 | Ga0182008_10578026 | 3300014497 | Bacteria | 628 |
| 148 | Ga0157379_10009158 | 3300014968 | Bacteria | 8623 |
| 149 | Ga0157379_10258247 | 3300014968 | Bacteria | 1583 |
| 150 | Ga0206354_11680540 | 3300020081 | Bacteria | 1252 |
| 151 | Ga0206353_10128923 | 3300020082 | Bacteria | 3105 |
| 152 | Ga0206353_11024584 | 3300020082 | Bacteria | 1764 |
| 153 | Ga0207697_10021397 | 3300025315 | Bacteria | 2647 |
| 154 | Ga0207656_10055983 | 3300025321 | Bacteria | 1718 |
| 155 | Ga0207696_1035735 | 3300025711 | Bacteria | 1477 |
| 156 | Ga0207682_10052946 | 3300025893 | Bacteria | 1682 |
| 157 | Ga0207688_10172711 | 3300025901 | Unclassified | 1286 |
| 158 | Ga0207680_10157830 | 3300025903 | Bacteria | 1518 |
| 159 | Ga0207647_10085131 | 3300025904 | Bacteria | 1891 |
| 160 | Ga0207647_10243494 | 3300025904 | Bacteria | 1032 |
| 161 | Ga0207645_10019335 | 3300025907 | Bacteria | 4466 |
| 162 | Ga0207705_10000396 | 3300025909 | Bacteria | 38250 |
| 163 | Ga0207705_10007258 | 3300025909 | Bacteria | 8155 |
| 164 | Ga0207705_10009310 | 3300025909 | Bacteria | 7143 |
| 165 | Ga0207705_10028503 | 3300025909 | Bacteria | 3981 |
| 166 | Ga0207705_10102632 | 3300025909 | Bacteria | 2106 |
| 167 | Ga0207705_11199525 | 3300025909 | Bacteria | 582 |
| 168 | Ga0207654_10596935 | 3300025911 | Bacteria | 787 |
| 169 | Ga0207695_10195262 | 3300025913 | Bacteria | 1940 |
| 170 | Ga0207671_10116987 | 3300025914 | Bacteria | 2034 |
| 171 | Ga0207660_10000062 | 3300025917 | Bacteria | 56397 |
| 172 | Ga0207662_10020066 | 3300025918 | Bacteria | 3812 |
| 173 | Ga0207657_10000439 | 3300025919 | Bacteria | 44057 |
| 174 | Ga0207657_10001011 | 3300025919 | Bacteria | 29944 |
| 175 | Ga0207657_10023257 | 3300025919 | Bacteria | 5774 |
| 176 | Ga0207657_10079920 | 3300025919 | Bacteria | 2750 |
| 177 | Ga0207657_10148500 | 3300025919 | Bacteria | 1910 |
| 178 | Ga0207657_10328713 | 3300025919 | Bacteria | 1208 |
| 179 | Ga0207649_10188661 | 3300025920 | Bacteria | 1448 |
| 180 | Ga0207649_10312080 | 3300025920 | Bacteria | 1153 |
| 181 | Ga0207649_10999954 | 3300025920 | Unclassified | 658 |
| 182 | Ga0207652_10031908 | 3300025921 | Bacteria | 4424 |
| 183 | Ga0207652_10139662 | 3300025921 | Bacteria | 2166 |
| 184 | Ga0207681_10008534 | 3300025923 | Bacteria | 6256 |
| 185 | Ga0207694_10003268 | 3300025924 | Bacteria | 12913 |
| 186 | Ga0207650_10019012 | 3300025925 | Bacteria | 4829 |
| 187 | Ga0207650_10058125 | 3300025925 | Bacteria | 2878 |
| 188 | Ga0207650_10365945 | 3300025925 | Unclassified | 1189 |
| 189 | Ga0207659_10021393 | 3300025926 | Bacteria | 4292 |
| 190 | Ga0207659_10177548 | 3300025926 | Bacteria | 1684 |
| 191 | Ga0207659_10188656 | 3300025926 | Bacteria | 1639 |
| 192 | Ga0207644_10393661 | 3300025931 | Bacteria | 1131 |
| 193 | Ga0207690_10019183 | 3300025932 | Bacteria | 4205 |
| 194 | Ga0207690_10070026 | 3300025932 | Bacteria | 2415 |
| 195 | Ga0207690_10088856 | 3300025932 | Bacteria | 2177 |
| 196 | Ga0207690_10126246 | 3300025932 | Bacteria | 1866 |
| 197 | Ga0207690_10156540 | 3300025932 | Bacteria | 1694 |
| 198 | Ga0207706_10033862 | 3300025933 | Bacteria | 4547 |
| 199 | Ga0207706_10812134 | 3300025933 | Bacteria | 794 |
| 200 | Ga0207706_10878671 | 3300025933 | Unclassified | 758 |
| 201 | Ga0207669_11157626 | 3300025937 | Bacteria | 654 |
| 202 | Ga0207691_10131358 | 3300025940 | Bacteria | 2212 |
| 203 | Ga0207691_10439152 | 3300025940 | Bacteria | 1111 |
| 204 | Ga0207711_10000281 | 3300025941 | Bacteria | 54787 |
| 205 | Ga0207711_10002810 | 3300025941 | Bacteria | 15304 |
| 206 | Ga0207711_10229358 | 3300025941 | Bacteria | 1700 |
| 207 | Ga0207689_10093385 | 3300025942 | Bacteria | 2471 |
| 208 | Ga0207689_10433363 | 3300025942 | Bacteria | 1098 |
| 209 | Ga0207661_10091203 | 3300025944 | Bacteria | 2539 |
| 210 | Ga0207661_10128454 | 3300025944 | Bacteria | 2167 |
| 211 | Ga0207661_11014512 | 3300025944 | Bacteria | 764 |
| 212 | Ga0207679_10000961 | 3300025945 | Bacteria | 18512 |
| 213 | Ga0207679_10205190 | 3300025945 | Bacteria | 1649 |
| 214 | Ga0207679_10351286 | 3300025945 | Bacteria | 1285 |
| 215 | Ga0207679_10666436 | 3300025945 | Bacteria | 942 |
| 216 | Ga0207667_10000237 | 3300025949 | Bacteria | 77017 |
| 217 | Ga0207667_10031414 | 3300025949 | Bacteria | 5733 |
| 218 | Ga0207667_10232344 | 3300025949 | Bacteria | 1888 |
| 219 | Ga0207667_10243124 | 3300025949 | Bacteria | 1842 |
| 220 | Ga0207667_10251271 | 3300025949 | Bacteria | 1809 |
| 221 | Ga0207667_10745386 | 3300025949 | Bacteria | 979 |
| 222 | Ga0207667_10763385 | 3300025949 | Bacteria | 965 |
| 223 | Ga0207651_10120218 | 3300025960 | Bacteria | 1991 |
| 224 | Ga0207651_10406553 | 3300025960 | Unclassified | 1159 |
| 225 | Ga0207712_10027673 | 3300025961 | Bacteria | 3787 |
| 226 | Ga0207640_10082722 | 3300025981 | Bacteria | 2199 |
| 227 | Ga0207658_10000603 | 3300025986 | Bacteria | 32015 |
| 228 | Ga0207658_10021644 | 3300025986 | Bacteria | 4466 |
| 229 | Ga0207658_10353219 | 3300025986 | Bacteria | 1281 |
| 230 | Ga0207677_10563380 | 3300026023 | Bacteria | 995 |
| 231 | Ga0207639_10000144 | 3300026041 | Bacteria | 53312 |
| 232 | Ga0207639_10206296 | 3300026041 | Bacteria | 1689 |
| 233 | Ga0207639_10353512 | 3300026041 | Bacteria | 1313 |
| 234 | Ga0207678_10001397 | 3300026067 | Bacteria | 22209 |
| 235 | Ga0207708_10294422 | 3300026075 | Bacteria | 1318 |
| 236 | Ga0207702_10110405 | 3300026078 | Bacteria | 2444 |
| 237 | Ga0207702_10113232 | 3300026078 | Bacteria | 2416 |
| 238 | Ga0207641_10002635 | 3300026088 | Bacteria | 16432 |
| 239 | Ga0207676_10021643 | 3300026095 | Bacteria | 4720 |
| 240 | Ga0207674_10004058 | 3300026116 | Bacteria | 17751 |
| 241 | Ga0207674_10011199 | 3300026116 | Bacteria | 10082 |
| 242 | Ga0207674_10059044 | 3300026116 | Bacteria | 3884 |
| 243 | Ga0207675_100158309 | 3300026118 | Bacteria | 2159 |
| 244 | Ga0207698_10003057 | 3300026142 | Bacteria | 10027 |
| 245 | Ga0207698_10045763 | 3300026142 | Bacteria | 3299 |
| 246 | Ga0268265_10022275 | 3300028380 | Bacteria | 4449 |
| 247 | Ga0268265_10022483 | 3300028380 | Bacteria | 4431 |
| 248 | Ga0268265_10087148 | 3300028380 | Bacteria | 2483 |
| 249 | Ga0268265_10102636 | 3300028380 | Bacteria | 2314 |
| 250 | Ga0268264_10046453 | 3300028381 | Bacteria | 3606 |
| 251 | Ga0268264_10047216 | 3300028381 | Bacteria | 3579 |
| 252 | Ga0316176_1193895 | 3300030732 | Bacteria | 707 |
| 253 | Ga0316180_1023441 | 3300030736 | Bacteria | 1898 |
| 254 | Ga0316182_1135087 | 3300030745 | Bacteria | 2349 |
| 255 | Ga0307405_10071028 | 3300031731 | Bacteria | 2239 |
| 256 | Ga0307410_10834170 | 3300031852 | Bacteria | 786 |
| 257 | Ga0307416_101113293 | 3300032002 | Bacteria | 894 |
| 258 | Ga0307415_100346065 | 3300032126 | Bacteria | 1249 |
| 259 | Ga0373948_0077357 | 3300034817 | Bacteria | 755 |
| 260 | Ga0395899_0000261 | 3300037312 | Bacteria | 69173 |
| 261 | Ga0395899_0009749 | 3300037312 | Bacteria | 7370 |
| 262 | Ga0395899_0041192 | 3300037312 | Bacteria | 3451 |
| 263 | Ga0395899_0155154 | 3300037312 | Bacteria | 1620 |
| 264 | Ga0395899_0230970 | 3300037312 | Bacteria | 1277 |
| 265 | Ga0395899_0483996 | 3300037312 | Bacteria | 805 |
| 266 | Ga0395899_0787848 | 3300037312 | Bacteria | 588 |
| 267 | Ga0395899_0911118 | 3300037312 | Bacteria | 535 |
| 268 | Ga0395900_0000036 | 3300037418 | Bacteria | 250619 |
| 269 | Ga0395900_0006519 | 3300037418 | Bacteria | 12163 |
| 270 | Ga0395900_0024798 | 3300037418 | Bacteria | 6139 |
| 271 | Ga0395900_0091250 | 3300037418 | Bacteria | 3130 |
| 272 | Ga0395900_0104119 | 3300037418 | Bacteria | 2915 |
| 273 | Ga0395900_0185693 | 3300037418 | Bacteria | 2110 |
| 274 | Ga0395900_0256838 | 3300037418 | Bacteria | 1746 |
| 275 | Ga0395900_0268902 | 3300037418 | Bacteria | 1700 |
| 276 | Ga0395900_0329800 | 3300037418 | Bacteria | 1504 |
| 277 | Ga0395900_0830745 | 3300037418 | Bacteria | 850 |
| 278 | Ga0395900_1402835 | 3300037418 | Bacteria | 611 |
| 279 | Ga0395898_0049321 | 3300037466 | Bacteria | 4125 |
| 280 | Ga0395898_0050842 | 3300037466 | Bacteria | 4054 |
| 281 | Ga0395898_0443807 | 3300037466 | Bacteria | 1236 |
| 282 | Ga0395898_0731855 | 3300037466 | Bacteria | 931 |
| 283 | Ga0395898_0834111 | 3300037466 | Bacteria | 861 |
| 284 | Ga0395898_1529644 | 3300037466 | Unclassified | 593 |
| 285 | Ga0395905_0040358 | 3300037471 | Bacteria | 4378 |
| 286 | Ga0395905_0063450 | 3300037471 | Bacteria | 3456 |
| 287 | Ga0395905_0110255 | 3300037471 | Bacteria | 2584 |
| 288 | Ga0395905_0113672 | 3300037471 | Bacteria | 2544 |
| 289 | Ga0395905_0144094 | 3300037471 | Bacteria | 2241 |
| 290 | Ga0395905_0231626 | 3300037471 | Bacteria | 1727 |
| 291 | Ga0395905_0321664 | 3300037471 | Bacteria | 1437 |
| 292 | Ga0395905_0407829 | 3300037471 | Bacteria | 1254 |
| 293 | Ga0395905_0488156 | 3300037471 | Bacteria | 1131 |
| 294 | Ga0395905_1397799 | 3300037471 | Bacteria | 604 |
| 295 | Ga0395901_0000036 | 3300038443 | Bacteria | 214274 |
| 296 | Ga0395901_0002156 | 3300038443 | Bacteria | 20101 |
| 297 | Ga0395901_0031928 | 3300038443 | Bacteria | 5431 |
| 298 | Ga0395901_0088491 | 3300038443 | Bacteria | 3239 |
| 299 | Ga0395901_0241060 | 3300038443 | Bacteria | 1886 |
| 300 | Ga0395901_0370721 | 3300038443 | Bacteria | 1475 |
| 301 | Ga0395901_0478960 | 3300038443 | Bacteria | 1270 |
| 302 | Ga0395901_0626304 | 3300038443 | Bacteria | 1082 |
| 303 | Ga0395901_0994444 | 3300038443 | Unclassified | 815 |
| 304 | Ga0439464_0000410 | 3300042439 | Bacteria | 8448 |
| 305 | Ga0439460_0150426 | 3300042461 | Bacteria | 776 |
| 306 | Ga0466966_0372390 | 3300044684 | Bacteria | 858 |
| 307 | Ga0466961_0314134 | 3300044693 | Bacteria | 956 |
| 308 | Ga0466961_0559058 | 3300044693 | Bacteria | 689 |
| 309 | Ga0466963_0001288 | 3300044694 | Bacteria | 13315 |
| 310 | Ga0466963_0007248 | 3300044694 | Bacteria | 6614 |
| 311 | Ga0466963_0014722 | 3300044694 | Bacteria | 4826 |
| 312 | Ga0466963_0024537 | 3300044694 | Bacteria | 3839 |
| 313 | Ga0466963_0183944 | 3300044694 | Bacteria | 1459 |
| 314 | Ga0466964_0097687 | 3300044706 | Bacteria | 1289 |
| 315 | Ga0466964_0466693 | 3300044706 | Bacteria | 672 |
| 316 | Ga0466964_0567510 | 3300044706 | Unclassified | 618 |
| 317 | Ga0466971_0087910 | 3300044719 | Bacteria | 1421 |
| 318 | Ga0466971_0579350 | 3300044719 | Bacteria | 558 |
| 319 | Ga0466960_0304543 | 3300044901 | Bacteria | 899 |
| 320 | Ga0466958_1179099 | 3300045836 | Bacteria | 500 |
| 321 | Ga0466967_0000376 | 3300045976 | Bacteria | 20722 |
| 322 | Ga0466967_0015249 | 3300045976 | Bacteria | 6020 |
| 323 | Ga0466967_0093291 | 3300045976 | Bacteria | 2739 |
| 324 | Ga0466967_0149576 | 3300045976 | Bacteria | 2181 |
| 325 | Ga0466967_0158709 | 3300045976 | Bacteria | 2121 |
| 326 | Ga0466967_0185181 | 3300045976 | Bacteria | 1966 |
| 327 | Ga0466967_0265048 | 3300045976 | Bacteria | 1644 |
| 328 | Ga0466967_0404014 | 3300045976 | Bacteria | 1329 |
| 329 | Ga0466967_0538330 | 3300045976 | Bacteria | 1149 |
| 330 | Ga0466967_1716079 | 3300045976 | Bacteria | 625 |
| 331 | Ga0495642_0471491 | 3300046528 | Bacteria | 555 |
| 332 | Ga0495669_0013238 | 3300046684 | Bacteria | 3513 |
| 333 | Ga0495669_0028566 | 3300046684 | Bacteria | 2443 |
| 334 | Ga0495669_0088624 | 3300046684 | Bacteria | 1427 |
| 335 | Ga0495669_0211144 | 3300046684 | Bacteria | 929 |
| 336 | Ga0496101_0405882 | 3300048904 | Bacteria | 1073 |
| 337 | Ga0496106_0133474 | 3300048909 | Bacteria | 1948 |
| 338 | Ga0496107_0009551 | 3300048910 | Bacteria | 6729 |
| 339 | Ga0496107_0181254 | 3300048910 | Bacteria | 1564 |
| 340 | Ga0496108_0041659 | 3300048911 | Bacteria | 3834 |
| 341 | Ga0496109_0752961 | 3300048912 | Bacteria | 912 |
| 342 | Ga0496110_0195819 | 3300048913 | Bacteria | 1835 |
| 343 | Ga0496111_0002239 | 3300048914 | Bacteria | 11617 |
| 344 | Ga0496112_0002228 | 3300048915 | Bacteria | 15476 |
| 345 | Ga0495655_0028784 | 3300053083 | Bacteria | 1330 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013102 | Ga0157371_10001045 | Ga0157371_100010453 | 119 |
| 2 | 3300013104 | Ga0157370_10034449 | Ga0157370_100344492 | 119 |
| 3 | 3300037418 | Ga0395900_0830745 | Ga0395900_0830745_428_817 | 129 |
| 4 | 3300044684 | Ga0466966_0372390 | Ga0466966_0372390_443_832 | 129 |
| 5 | 3300045836 | Ga0466958_1179099 | Ga0466958_1179099_11_400 | 129 |
| 6 | 3300046528 | Ga0495642_0471491 | Ga0495642_0471491_11_400 | 129 |
| 7 | 3300005327 | Ga0070658_10363744 | Ga0070658_103637442 | 139 |
| 8 | 3300005339 | Ga0070660_100163813 | Ga0070660_1001638132 | 139 |
| 9 | 3300005535 | Ga0070684_100046273 | Ga0070684_1000462733 | 139 |
| 10 | 3300013102 | Ga0157371_10036698 | Ga0157371_100366982 | 139 |
| 11 | 3300013105 | Ga0157369_10004227 | Ga0157369_1000422715 | 139 |
| 12 | 3300025904 | Ga0207647_10243494 | Ga0207647_102434942 | 139 |
| 13 | 3300025909 | Ga0207705_10028503 | Ga0207705_100285033 | 139 |
| 14 | 3300025919 | Ga0207657_10079920 | Ga0207657_100799202 | 139 |
| 15 | 3300025920 | Ga0207649_10312080 | Ga0207649_103120801 | 139 |
| 16 | 3300025944 | Ga0207661_10128454 | Ga0207661_101284542 | 139 |
| 17 | 3300037418 | Ga0395900_0006519 | Ga0395900_0006519_10682_11116 | 139 |
| 18 | 3300038443 | Ga0395901_0002156 | Ga0395901_0002156_1950_2384 | 139 |
| 19 | 3300005328 | Ga0070676_10000204 | Ga0070676_100002047 | 142 |
| 20 | 3300005338 | Ga0068868_101286588 | Ga0068868_1012865881 | 142 |
| 21 | 3300005347 | Ga0070668_100001063 | Ga0070668_1000010636 | 142 |
| 22 | 3300005356 | Ga0070674_100019620 | Ga0070674_1000196202 | 142 |
| 23 | 3300005364 | Ga0070673_100021335 | Ga0070673_1000213354 | 142 |
| 24 | 3300005367 | Ga0070667_100132767 | Ga0070667_1001327672 | 142 |
| 25 | 3300005455 | Ga0070663_100898029 | Ga0070663_1008980291 | 142 |
| 26 | 3300005456 | Ga0070678_100037598 | Ga0070678_1000375984 | 142 |
| 27 | 3300005457 | Ga0070662_101236827 | Ga0070662_1012368271 | 142 |
| 28 | 3300005459 | Ga0068867_100025830 | Ga0068867_1000258304 | 142 |
| 29 | 3300005459 | Ga0068867_100334382 | Ga0068867_1003343822 | 142 |
| 30 | 3300005543 | Ga0070672_100183229 | Ga0070672_1001832292 | 142 |
| 31 | 3300005617 | Ga0068859_100585165 | Ga0068859_1005851652 | 142 |
| 32 | 3300005719 | Ga0068861_100375203 | Ga0068861_1003752032 | 142 |
| 33 | 3300006881 | Ga0068865_100015652 | Ga0068865_1000156523 | 142 |
| 34 | 3300006931 | Ga0097620_100585199 | Ga0097620_1005851992 | 142 |
| 35 | 3300009148 | Ga0105243_11270096 | Ga0105243_112700961 | 142 |
| 36 | 3300013308 | Ga0157375_11143530 | Ga0157375_111435301 | 142 |
| 37 | 3300025926 | Ga0207659_10177548 | Ga0207659_101775483 | 142 |
| 38 | 3300025986 | Ga0207658_10021644 | Ga0207658_100216444 | 142 |
| 39 | 3300026023 | Ga0207677_10563380 | Ga0207677_105633802 | 142 |
| 40 | 3300005335 | Ga0070666_10209931 | Ga0070666_102099311 | 143 |
| 41 | 3300005344 | Ga0070661_100507878 | Ga0070661_1005078782 | 143 |
| 42 | 3300013100 | Ga0157373_10423534 | Ga0157373_104235342 | 143 |
| 43 | 3300025919 | Ga0207657_10148500 | Ga0207657_101485002 | 143 |
| 44 | 3300025937 | Ga0207669_11157626 | Ga0207669_111576262 | 143 |
| 45 | 3300002067 | JGI24735J21928_10031808 | JGI24735J21928_100318082 | 144 |
| 46 | 3300005327 | Ga0070658_10002158 | Ga0070658_1000215811 | 144 |
| 47 | 3300005327 | Ga0070658_10009061 | Ga0070658_100090612 | 144 |
| 48 | 3300005327 | Ga0070658_10087315 | Ga0070658_100873152 | 144 |
| 49 | 3300005327 | Ga0070658_10352440 | Ga0070658_103524401 | 144 |
| 50 | 3300005329 | Ga0070683_100228097 | Ga0070683_1002280972 | 144 |
| 51 | 3300005331 | Ga0070670_100057131 | Ga0070670_1000571313 | 144 |
| 52 | 3300005331 | Ga0070670_100472360 | Ga0070670_1004723602 | 144 |
| 53 | 3300005336 | Ga0070680_100000070 | Ga0070680_10000007046 | 144 |
| 54 | 3300005339 | Ga0070660_100000370 | Ga0070660_1000003703 | 144 |
| 55 | 3300005339 | Ga0070660_100054944 | Ga0070660_1000549442 | 144 |
| 56 | 3300005339 | Ga0070660_100081353 | Ga0070660_1000813532 | 144 |
| 57 | 3300005339 | Ga0070660_100089359 | Ga0070660_1000893592 | 144 |
| 58 | 3300005339 | Ga0070660_100182800 | Ga0070660_1001828002 | 144 |
| 59 | 3300005339 | Ga0070660_100542296 | Ga0070660_1005422962 | 144 |
| 60 | 3300005341 | Ga0070691_10018197 | Ga0070691_100181972 | 144 |
| 61 | 3300005343 | Ga0070687_100061417 | Ga0070687_1000614172 | 144 |
| 62 | 3300005344 | Ga0070661_100232020 | Ga0070661_1002320202 | 144 |
| 63 | 3300005344 | Ga0070661_100308985 | Ga0070661_1003089852 | 144 |
| 64 | 3300005345 | Ga0070692_10007977 | Ga0070692_100079773 | 144 |
| 65 | 3300005345 | Ga0070692_10017657 | Ga0070692_100176573 | 144 |
| 66 | 3300005345 | Ga0070692_10106505 | Ga0070692_101065052 | 144 |
| 67 | 3300005353 | Ga0070669_100202486 | Ga0070669_1002024862 | 144 |
| 68 | 3300005354 | Ga0070675_100044296 | Ga0070675_1000442963 | 144 |
| 69 | 3300005355 | Ga0070671_100273633 | Ga0070671_1002736332 | 144 |
| 70 | 3300005364 | Ga0070673_100050553 | Ga0070673_1000505534 | 144 |
| 71 | 3300005364 | Ga0070673_101328775 | Ga0070673_1013287752 | 144 |
| 72 | 3300005366 | Ga0070659_100037242 | Ga0070659_1000372422 | 144 |
| 73 | 3300005366 | Ga0070659_100092775 | Ga0070659_1000927752 | 144 |
| 74 | 3300005366 | Ga0070659_100171408 | Ga0070659_1001714082 | 144 |
| 75 | 3300005366 | Ga0070659_101583659 | Ga0070659_1015836591 | 144 |
| 76 | 3300005367 | Ga0070667_100002310 | Ga0070667_1000023102 | 144 |
| 77 | 3300005367 | Ga0070667_100766189 | Ga0070667_1007661892 | 144 |
| 78 | 3300005435 | Ga0070714_100038061 | Ga0070714_1000380613 | 144 |
| 79 | 3300005441 | Ga0070700_100230936 | Ga0070700_1002309362 | 144 |
| 80 | 3300005455 | Ga0070663_100052085 | Ga0070663_1000520854 | 144 |
| 81 | 3300005457 | Ga0070662_100068720 | Ga0070662_1000687202 | 144 |
| 82 | 3300005457 | Ga0070662_100699276 | Ga0070662_1006992762 | 144 |
| 83 | 3300005458 | Ga0070681_10122274 | Ga0070681_101222741 | 144 |
| 84 | 3300005458 | Ga0070681_10317459 | Ga0070681_103174591 | 144 |
| 85 | 3300005458 | Ga0070681_10358729 | Ga0070681_103587292 | 144 |
| 86 | 3300005458 | Ga0070681_10594485 | Ga0070681_105944852 | 144 |
| 87 | 3300005530 | Ga0070679_100011214 | Ga0070679_1000112144 | 144 |
| 88 | 3300005530 | Ga0070679_100129285 | Ga0070679_1001292853 | 144 |
| 89 | 3300005530 | Ga0070679_100239873 | Ga0070679_1002398732 | 144 |
| 90 | 3300005535 | Ga0070684_100212987 | Ga0070684_1002129872 | 144 |
| 91 | 3300005535 | Ga0070684_100725886 | Ga0070684_1007258862 | 144 |
| 92 | 3300005539 | Ga0068853_100011023 | Ga0068853_1000110234 | 144 |
| 93 | 3300005539 | Ga0068853_100256874 | Ga0068853_1002568742 | 144 |
| 94 | 3300005543 | Ga0070672_100324292 | Ga0070672_1003242922 | 144 |
| 95 | 3300005546 | Ga0070696_100008542 | Ga0070696_1000085422 | 144 |
| 96 | 3300005563 | Ga0068855_100000480 | Ga0068855_10000048052 | 144 |
| 97 | 3300005563 | Ga0068855_100030068 | Ga0068855_1000300683 | 144 |
| 98 | 3300005563 | Ga0068855_100241763 | Ga0068855_1002417632 | 144 |
| 99 | 3300005563 | Ga0068855_100492897 | Ga0068855_1004928972 | 144 |
| 100 | 3300005563 | Ga0068855_100561900 | Ga0068855_1005619002 | 144 |
| 101 | 3300005563 | Ga0068855_100710193 | Ga0068855_1007101932 | 144 |
| 102 | 3300005564 | Ga0070664_100002402 | Ga0070664_1000024026 | 144 |
| 103 | 3300005564 | Ga0070664_100006951 | Ga0070664_1000069513 | 144 |
| 104 | 3300005564 | Ga0070664_100205217 | Ga0070664_1002052172 | 144 |
| 105 | 3300005564 | Ga0070664_100421737 | Ga0070664_1004217372 | 144 |
| 106 | 3300005577 | Ga0068857_100047913 | Ga0068857_1000479134 | 144 |
| 107 | 3300005577 | Ga0068857_100127133 | Ga0068857_1001271332 | 144 |
| 108 | 3300005577 | Ga0068857_100145388 | Ga0068857_1001453882 | 144 |
| 109 | 3300005578 | Ga0068854_100012079 | Ga0068854_1000120793 | 144 |
| 110 | 3300005614 | Ga0068856_100259482 | Ga0068856_1002594822 | 144 |
| 111 | 3300005614 | Ga0068856_100795996 | Ga0068856_1007959962 | 144 |
| 112 | 3300005615 | Ga0070702_100478858 | Ga0070702_1004788582 | 144 |
| 113 | 3300005616 | Ga0068852_100003350 | Ga0068852_1000033504 | 144 |
| 114 | 3300005616 | Ga0068852_101678578 | Ga0068852_1016785782 | 144 |
| 115 | 3300005617 | Ga0068859_100017730 | Ga0068859_1000177304 | 144 |
| 116 | 3300005617 | Ga0068859_100045724 | Ga0068859_1000457242 | 144 |
| 117 | 3300005618 | Ga0068864_100008590 | Ga0068864_1000085903 | 144 |
| 118 | 3300005618 | Ga0068864_100017483 | Ga0068864_1000174833 | 144 |
| 119 | 3300005719 | Ga0068861_100083815 | Ga0068861_1000838152 | 144 |
| 120 | 3300005834 | Ga0068851_10128363 | Ga0068851_101283632 | 144 |
| 121 | 3300005841 | Ga0068863_100030014 | Ga0068863_1000300143 | 144 |
| 122 | 3300005842 | Ga0068858_100012128 | Ga0068858_1000121282 | 144 |
| 123 | 3300005842 | Ga0068858_100055951 | Ga0068858_1000559512 | 144 |
| 124 | 3300005843 | Ga0068860_100056420 | Ga0068860_1000564204 | 144 |
| 125 | 3300005843 | Ga0068860_100484119 | Ga0068860_1004841192 | 144 |
| 126 | 3300005844 | Ga0068862_100007655 | Ga0068862_1000076554 | 144 |
| 127 | 3300005844 | Ga0068862_100017592 | Ga0068862_1000175923 | 144 |
| 128 | 3300005844 | Ga0068862_100117395 | Ga0068862_1001173953 | 144 |
| 129 | 3300005844 | Ga0068862_100132518 | Ga0068862_1001325182 | 144 |
| 130 | 3300006881 | Ga0068865_100530059 | Ga0068865_1005300592 | 144 |
| 131 | 3300006931 | Ga0097620_100017729 | Ga0097620_1000177292 | 144 |
| 132 | 3300006931 | Ga0097620_100045718 | Ga0097620_1000457182 | 144 |
| 133 | 3300009011 | Ga0105251_10315096 | Ga0105251_103150962 | 144 |
| 134 | 3300009092 | Ga0105250_10152447 | Ga0105250_101524472 | 144 |
| 135 | 3300009093 | Ga0105240_10067574 | Ga0105240_100675743 | 144 |
| 136 | 3300009174 | Ga0105241_10158119 | Ga0105241_101581192 | 144 |
| 137 | 3300009177 | Ga0105248_10003809 | Ga0105248_100038099 | 144 |
| 138 | 3300009177 | Ga0105248_10077606 | Ga0105248_100776064 | 144 |
| 139 | 3300009177 | Ga0105248_11406118 | Ga0105248_114061181 | 144 |
| 140 | 3300009545 | Ga0105237_10158849 | Ga0105237_101588492 | 144 |
| 141 | 3300009551 | Ga0105238_10679638 | Ga0105238_106796382 | 144 |
| 142 | 3300009553 | Ga0105249_10051483 | Ga0105249_100514832 | 144 |
| 143 | 3300009553 | Ga0105249_10295180 | Ga0105249_102951802 | 144 |
| 144 | 3300009979 | Ga0105032_117650 | Ga0105032_1176502 | 144 |
| 145 | 3300011119 | Ga0105246_10013856 | Ga0105246_100138563 | 144 |
| 146 | 3300013100 | Ga0157373_10016146 | Ga0157373_100161462 | 144 |
| 147 | 3300013100 | Ga0157373_10021334 | Ga0157373_100213343 | 144 |
| 148 | 3300013100 | Ga0157373_10228098 | Ga0157373_102280982 | 144 |
| 149 | 3300013102 | Ga0157371_10024452 | Ga0157371_100244524 | 144 |
| 150 | 3300013102 | Ga0157371_10026857 | Ga0157371_100268573 | 144 |
| 151 | 3300013102 | Ga0157371_10082658 | Ga0157371_100826582 | 144 |
| 152 | 3300013102 | Ga0157371_10185798 | Ga0157371_101857982 | 144 |
| 153 | 3300013102 | Ga0157371_10686961 | Ga0157371_106869612 | 144 |
| 154 | 3300013104 | Ga0157370_10030555 | Ga0157370_100305554 | 144 |
| 155 | 3300013104 | Ga0157370_10039932 | Ga0157370_100399322 | 144 |
| 156 | 3300013105 | Ga0157369_10019984 | Ga0157369_100199845 | 144 |
| 157 | 3300013105 | Ga0157369_10270550 | Ga0157369_102705502 | 144 |
| 158 | 3300013105 | Ga0157369_10480639 | Ga0157369_104806392 | 144 |
| 159 | 3300013306 | Ga0163162_10091789 | Ga0163162_100917892 | 144 |
| 160 | 3300013307 | Ga0157372_10003858 | Ga0157372_100038583 | 144 |
| 161 | 3300014325 | Ga0163163_10555355 | Ga0163163_105553552 | 144 |
| 162 | 3300014497 | Ga0182008_10132711 | Ga0182008_101327112 | 144 |
| 163 | 3300014497 | Ga0182008_10578026 | Ga0182008_105780262 | 144 |
| 164 | 3300014968 | Ga0157379_10009158 | Ga0157379_100091582 | 144 |
| 165 | 3300014968 | Ga0157379_10258247 | Ga0157379_102582472 | 144 |
| 166 | 3300020081 | Ga0206354_11680540 | Ga0206354_116805402 | 144 |
| 167 | 3300020082 | Ga0206353_10128923 | Ga0206353_101289232 | 144 |
| 168 | 3300020082 | Ga0206353_11024584 | Ga0206353_110245842 | 144 |
| 169 | 3300025315 | Ga0207697_10021397 | Ga0207697_100213972 | 144 |
| 170 | 3300025321 | Ga0207656_10055983 | Ga0207656_100559832 | 144 |
| 171 | 3300025711 | Ga0207696_1035735 | Ga0207696_10357352 | 144 |
| 172 | 3300025893 | Ga0207682_10052946 | Ga0207682_100529462 | 144 |
| 173 | 3300025901 | Ga0207688_10172711 | Ga0207688_101727112 | 144 |
| 174 | 3300025903 | Ga0207680_10157830 | Ga0207680_101578302 | 144 |
| 175 | 3300025904 | Ga0207647_10085131 | Ga0207647_100851312 | 144 |
| 176 | 3300025907 | Ga0207645_10019335 | Ga0207645_100193353 | 144 |
| 177 | 3300025909 | Ga0207705_10000396 | Ga0207705_1000039620 | 144 |
| 178 | 3300025909 | Ga0207705_10007258 | Ga0207705_100072583 | 144 |
| 179 | 3300025909 | Ga0207705_10009310 | Ga0207705_100093106 | 144 |
| 180 | 3300025909 | Ga0207705_10102632 | Ga0207705_101026322 | 144 |
| 181 | 3300025909 | Ga0207705_11199525 | Ga0207705_111995252 | 144 |
| 182 | 3300025911 | Ga0207654_10596935 | Ga0207654_105969352 | 144 |
| 183 | 3300025913 | Ga0207695_10195262 | Ga0207695_101952623 | 144 |
| 184 | 3300025914 | Ga0207671_10116987 | Ga0207671_101169872 | 144 |
| 185 | 3300025917 | Ga0207660_10000062 | Ga0207660_1000006244 | 144 |
| 186 | 3300025918 | Ga0207662_10020066 | Ga0207662_100200662 | 144 |
| 187 | 3300025919 | Ga0207657_10000439 | Ga0207657_1000043919 | 144 |
| 188 | 3300025919 | Ga0207657_10001011 | Ga0207657_100010113 | 144 |
| 189 | 3300025919 | Ga0207657_10023257 | Ga0207657_100232573 | 144 |
| 190 | 3300025919 | Ga0207657_10328713 | Ga0207657_103287132 | 144 |
| 191 | 3300025920 | Ga0207649_10188661 | Ga0207649_101886612 | 144 |
| 192 | 3300025920 | Ga0207649_10999954 | Ga0207649_109999542 | 144 |
| 193 | 3300025921 | Ga0207652_10031908 | Ga0207652_100319083 | 144 |
| 194 | 3300025921 | Ga0207652_10139662 | Ga0207652_101396622 | 144 |
| 195 | 3300025923 | Ga0207681_10008534 | Ga0207681_100085344 | 144 |
| 196 | 3300025924 | Ga0207694_10003268 | Ga0207694_100032686 | 144 |
| 197 | 3300025925 | Ga0207650_10019012 | Ga0207650_100190123 | 144 |
| 198 | 3300025925 | Ga0207650_10058125 | Ga0207650_100581252 | 144 |
| 199 | 3300025925 | Ga0207650_10365945 | Ga0207650_103659452 | 144 |
| 200 | 3300025926 | Ga0207659_10021393 | Ga0207659_100213933 | 144 |
| 201 | 3300025926 | Ga0207659_10188656 | Ga0207659_101886562 | 144 |
| 202 | 3300025931 | Ga0207644_10393661 | Ga0207644_103936611 | 144 |
| 203 | 3300025932 | Ga0207690_10019183 | Ga0207690_100191834 | 144 |
| 204 | 3300025932 | Ga0207690_10070026 | Ga0207690_100700262 | 144 |
| 205 | 3300025932 | Ga0207690_10088856 | Ga0207690_100888562 | 144 |
| 206 | 3300025932 | Ga0207690_10126246 | Ga0207690_101262463 | 144 |
| 207 | 3300025932 | Ga0207690_10156540 | Ga0207690_101565402 | 144 |
| 208 | 3300025933 | Ga0207706_10033862 | Ga0207706_100338622 | 144 |
| 209 | 3300025933 | Ga0207706_10812134 | Ga0207706_108121342 | 144 |
| 210 | 3300025933 | Ga0207706_10878671 | Ga0207706_108786712 | 144 |
| 211 | 3300025940 | Ga0207691_10131358 | Ga0207691_101313582 | 144 |
| 212 | 3300025940 | Ga0207691_10439152 | Ga0207691_104391522 | 144 |
| 213 | 3300025941 | Ga0207711_10000281 | Ga0207711_1000028151 | 144 |
| 214 | 3300025941 | Ga0207711_10002810 | Ga0207711_1000281010 | 144 |
| 215 | 3300025941 | Ga0207711_10229358 | Ga0207711_102293581 | 144 |
| 216 | 3300025942 | Ga0207689_10093385 | Ga0207689_100933852 | 144 |
| 217 | 3300025942 | Ga0207689_10433363 | Ga0207689_104333632 | 144 |
| 218 | 3300025944 | Ga0207661_10091203 | Ga0207661_100912033 | 144 |
| 219 | 3300025944 | Ga0207661_11014512 | Ga0207661_110145122 | 144 |
| 220 | 3300025945 | Ga0207679_10000961 | Ga0207679_1000096110 | 144 |
| 221 | 3300025945 | Ga0207679_10205190 | Ga0207679_102051903 | 144 |
| 222 | 3300025945 | Ga0207679_10351286 | Ga0207679_103512862 | 144 |
| 223 | 3300025945 | Ga0207679_10666436 | Ga0207679_106664362 | 144 |
| 224 | 3300025949 | Ga0207667_10000237 | Ga0207667_100002375 | 144 |
| 225 | 3300025949 | Ga0207667_10031414 | Ga0207667_100314142 | 144 |
| 226 | 3300025949 | Ga0207667_10232344 | Ga0207667_102323442 | 144 |
| 227 | 3300025949 | Ga0207667_10243124 | Ga0207667_102431242 | 144 |
| 228 | 3300025949 | Ga0207667_10251271 | Ga0207667_102512712 | 144 |
| 229 | 3300025949 | Ga0207667_10745386 | Ga0207667_107453862 | 144 |
| 230 | 3300025949 | Ga0207667_10763385 | Ga0207667_107633852 | 144 |
| 231 | 3300025960 | Ga0207651_10120218 | Ga0207651_101202182 | 144 |
| 232 | 3300025960 | Ga0207651_10406553 | Ga0207651_104065532 | 144 |
| 233 | 3300025961 | Ga0207712_10027673 | Ga0207712_100276732 | 144 |
| 234 | 3300025981 | Ga0207640_10082722 | Ga0207640_100827222 | 144 |
| 235 | 3300025986 | Ga0207658_10000603 | Ga0207658_1000060312 | 144 |
| 236 | 3300025986 | Ga0207658_10353219 | Ga0207658_103532192 | 144 |
| 237 | 3300026041 | Ga0207639_10000144 | Ga0207639_1000014448 | 144 |
| 238 | 3300026041 | Ga0207639_10206296 | Ga0207639_102062962 | 144 |
| 239 | 3300026041 | Ga0207639_10353512 | Ga0207639_103535122 | 144 |
| 240 | 3300026067 | Ga0207678_10001397 | Ga0207678_100013974 | 144 |
| 241 | 3300026075 | Ga0207708_10294422 | Ga0207708_102944222 | 144 |
| 242 | 3300026078 | Ga0207702_10110405 | Ga0207702_101104053 | 144 |
| 243 | 3300026078 | Ga0207702_10113232 | Ga0207702_101132324 | 144 |
| 244 | 3300026088 | Ga0207641_10002635 | Ga0207641_100026356 | 144 |
| 245 | 3300026095 | Ga0207676_10021643 | Ga0207676_100216432 | 144 |
| 246 | 3300026116 | Ga0207674_10004058 | Ga0207674_100040582 | 144 |
| 247 | 3300026116 | Ga0207674_10011199 | Ga0207674_100111994 | 144 |
| 248 | 3300026116 | Ga0207674_10059044 | Ga0207674_100590443 | 144 |
| 249 | 3300026118 | Ga0207675_100158309 | Ga0207675_1001583092 | 144 |
| 250 | 3300026142 | Ga0207698_10003057 | Ga0207698_100030574 | 144 |
| 251 | 3300026142 | Ga0207698_10045763 | Ga0207698_100457632 | 144 |
| 252 | 3300028380 | Ga0268265_10022275 | Ga0268265_100222754 | 144 |
| 253 | 3300028380 | Ga0268265_10022483 | Ga0268265_100224833 | 144 |
| 254 | 3300028380 | Ga0268265_10087148 | Ga0268265_100871482 | 144 |
| 255 | 3300028380 | Ga0268265_10102636 | Ga0268265_101026362 | 144 |
| 256 | 3300028381 | Ga0268264_10046453 | Ga0268264_100464532 | 144 |
| 257 | 3300028381 | Ga0268264_10047216 | Ga0268264_100472163 | 144 |
| 258 | 3300030732 | Ga0316176_1193895 | Ga0316176_11938952 | 144 |
| 259 | 3300030736 | Ga0316180_1023441 | Ga0316180_10234412 | 144 |
| 260 | 3300030745 | Ga0316182_1135087 | Ga0316182_11350872 | 144 |
| 261 | 3300031731 | Ga0307405_10071028 | Ga0307405_100710283 | 144 |
| 262 | 3300031852 | Ga0307410_10834170 | Ga0307410_108341702 | 144 |
| 263 | 3300032002 | Ga0307416_101113293 | Ga0307416_1011132932 | 144 |
| 264 | 3300032126 | Ga0307415_100346065 | Ga0307415_1003460652 | 144 |
| 265 | 3300034817 | Ga0373948_0077357 | Ga0373948_0077357_255_689 | 144 |
| 266 | 3300037312 | Ga0395899_0000261 | Ga0395899_0000261_29820_30254 | 144 |
| 267 | 3300037312 | Ga0395899_0009749 | Ga0395899_0009749_5197_5631 | 144 |
| 268 | 3300037312 | Ga0395899_0041192 | Ga0395899_0041192_329_763 | 144 |
| 269 | 3300037312 | Ga0395899_0155154 | Ga0395899_0155154_844_1278 | 144 |
| 270 | 3300037312 | Ga0395899_0230970 | Ga0395899_0230970_770_1204 | 144 |
| 271 | 3300037312 | Ga0395899_0483996 | Ga0395899_0483996_337_771 | 144 |
| 272 | 3300037312 | Ga0395899_0787848 | Ga0395899_0787848_62_496 | 144 |
| 273 | 3300037312 | Ga0395899_0911118 | Ga0395899_0911118_74_508 | 144 |
| 274 | 3300037418 | Ga0395900_0000036 | Ga0395900_0000036_58559_58993 | 144 |
| 275 | 3300037418 | Ga0395900_0024798 | Ga0395900_0024798_4551_4985 | 144 |
| 276 | 3300037418 | Ga0395900_0091250 | Ga0395900_0091250_1632_2066 | 144 |
| 277 | 3300037418 | Ga0395900_0104119 | Ga0395900_0104119_2315_2749 | 144 |
| 278 | 3300037418 | Ga0395900_0185693 | Ga0395900_0185693_1334_1768 | 144 |
| 279 | 3300037418 | Ga0395900_0256838 | Ga0395900_0256838_1097_1531 | 144 |
| 280 | 3300037418 | Ga0395900_0268902 | Ga0395900_0268902_421_855 | 144 |
| 281 | 3300037418 | Ga0395900_0329800 | Ga0395900_0329800_69_503 | 144 |
| 282 | 3300037418 | Ga0395900_1402835 | Ga0395900_1402835_91_525 | 144 |
| 283 | 3300037466 | Ga0395898_0049321 | Ga0395898_0049321_3565_3999 | 144 |
| 284 | 3300037466 | Ga0395898_0050842 | Ga0395898_0050842_1002_1436 | 144 |
| 285 | 3300037466 | Ga0395898_0443807 | Ga0395898_0443807_355_789 | 144 |
| 286 | 3300037466 | Ga0395898_0731855 | Ga0395898_0731855_276_710 | 144 |
| 287 | 3300037466 | Ga0395898_0834111 | Ga0395898_0834111_411_845 | 144 |
| 288 | 3300037466 | Ga0395898_1529644 | Ga0395898_1529644_84_518 | 144 |
| 289 | 3300037471 | Ga0395905_0040358 | Ga0395905_0040358_2177_2611 | 144 |
| 290 | 3300037471 | Ga0395905_0063450 | Ga0395905_0063450_1250_1684 | 144 |
| 291 | 3300037471 | Ga0395905_0110255 | Ga0395905_0110255_1574_2008 | 144 |
| 292 | 3300037471 | Ga0395905_0113672 | Ga0395905_0113672_1295_1729 | 144 |
| 293 | 3300037471 | Ga0395905_0144094 | Ga0395905_0144094_984_1418 | 144 |
| 294 | 3300037471 | Ga0395905_0231626 | Ga0395905_0231626_559_993 | 144 |
| 295 | 3300037471 | Ga0395905_0321664 | Ga0395905_0321664_342_776 | 144 |
| 296 | 3300037471 | Ga0395905_0407829 | Ga0395905_0407829_516_950 | 144 |
| 297 | 3300037471 | Ga0395905_0488156 | Ga0395905_0488156_366_800 | 144 |
| 298 | 3300037471 | Ga0395905_1397799 | Ga0395905_1397799_31_465 | 144 |
| 299 | 3300038443 | Ga0395901_0000036 | Ga0395901_0000036_160905_161339 | 144 |
| 300 | 3300038443 | Ga0395901_0031928 | Ga0395901_0031928_1808_2242 | 144 |
| 301 | 3300038443 | Ga0395901_0088491 | Ga0395901_0088491_459_893 | 144 |
| 302 | 3300038443 | Ga0395901_0241060 | Ga0395901_0241060_1027_1461 | 144 |
| 303 | 3300038443 | Ga0395901_0370721 | Ga0395901_0370721_309_743 | 144 |
| 304 | 3300038443 | Ga0395901_0478960 | Ga0395901_0478960_477_911 | 144 |
| 305 | 3300038443 | Ga0395901_0626304 | Ga0395901_0626304_221_655 | 144 |
| 306 | 3300038443 | Ga0395901_0994444 | Ga0395901_0994444_74_508 | 144 |
| 307 | 3300042439 | Ga0439464_0000410 | Ga0439464_0000410_3913_4347 | 144 |
| 308 | 3300042461 | Ga0439460_0150426 | Ga0439460_0150426_312_746 | 144 |
| 309 | 3300044693 | Ga0466961_0314134 | Ga0466961_0314134_383_817 | 144 |
| 310 | 3300044693 | Ga0466961_0559058 | Ga0466961_0559058_70_504 | 144 |
| 311 | 3300044694 | Ga0466963_0001288 | Ga0466963_0001288_6739_7173 | 144 |
| 312 | 3300044694 | Ga0466963_0007248 | Ga0466963_0007248_5874_6308 | 144 |
| 313 | 3300044694 | Ga0466963_0014722 | Ga0466963_0014722_3185_3619 | 144 |
| 314 | 3300044694 | Ga0466963_0024537 | Ga0466963_0024537_1259_1693 | 144 |
| 315 | 3300044694 | Ga0466963_0183944 | Ga0466963_0183944_723_1157 | 144 |
| 316 | 3300044706 | Ga0466964_0097687 | Ga0466964_0097687_484_918 | 144 |
| 317 | 3300044706 | Ga0466964_0466693 | Ga0466964_0466693_114_548 | 144 |
| 318 | 3300044706 | Ga0466964_0567510 | Ga0466964_0567510_51_485 | 144 |
| 319 | 3300044719 | Ga0466971_0087910 | Ga0466971_0087910_453_887 | 144 |
| 320 | 3300044719 | Ga0466971_0579350 | Ga0466971_0579350_72_506 | 144 |
| 321 | 3300044901 | Ga0466960_0304543 | Ga0466960_0304543_175_609 | 144 |
| 322 | 3300045976 | Ga0466967_0000376 | Ga0466967_0000376_6083_6517 | 144 |
| 323 | 3300045976 | Ga0466967_0015249 | Ga0466967_0015249_3348_3782 | 144 |
| 324 | 3300045976 | Ga0466967_0093291 | Ga0466967_0093291_1305_1739 | 144 |
| 325 | 3300045976 | Ga0466967_0149576 | Ga0466967_0149576_128_562 | 144 |
| 326 | 3300045976 | Ga0466967_0158709 | Ga0466967_0158709_1671_2105 | 144 |
| 327 | 3300045976 | Ga0466967_0185181 | Ga0466967_0185181_120_554 | 144 |
| 328 | 3300045976 | Ga0466967_0265048 | Ga0466967_0265048_386_820 | 144 |
| 329 | 3300045976 | Ga0466967_0404014 | Ga0466967_0404014_660_1094 | 144 |
| 330 | 3300045976 | Ga0466967_0538330 | Ga0466967_0538330_41_475 | 144 |
| 331 | 3300045976 | Ga0466967_1716079 | Ga0466967_1716079_10_444 | 144 |
| 332 | 3300046684 | Ga0495669_0013238 | Ga0495669_0013238_90_524 | 144 |
| 333 | 3300046684 | Ga0495669_0028566 | Ga0495669_0028566_1589_2023 | 144 |
| 334 | 3300046684 | Ga0495669_0088624 | Ga0495669_0088624_35_469 | 144 |
| 335 | 3300046684 | Ga0495669_0211144 | Ga0495669_0211144_483_917 | 144 |
| 336 | 3300048904 | Ga0496101_0405882 | Ga0496101_0405882_578_1012 | 144 |
| 337 | 3300048909 | Ga0496106_0133474 | Ga0496106_0133474_772_1206 | 144 |
| 338 | 3300048910 | Ga0496107_0009551 | Ga0496107_0009551_2244_2678 | 144 |
| 339 | 3300048910 | Ga0496107_0181254 | Ga0496107_0181254_589_1023 | 144 |
| 340 | 3300048911 | Ga0496108_0041659 | Ga0496108_0041659_3385_3819 | 144 |
| 341 | 3300048912 | Ga0496109_0752961 | Ga0496109_0752961_149_583 | 144 |
| 342 | 3300048913 | Ga0496110_0195819 | Ga0496110_0195819_1038_1472 | 144 |
| 343 | 3300048914 | Ga0496111_0002239 | Ga0496111_0002239_1222_1656 | 144 |
| 344 | 3300048915 | Ga0496112_0002228 | Ga0496112_0002228_13312_13746 | 144 |
| 345 | 3300053083 | Ga0495655_0028784 | Ga0495655_0028784_415_849 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5np9-assembly1.cif.gz_A | crystal structure of bacillus subtilis ydib in complex with adp | 0.8741 | 1 | 140 |
| 5mvr-assembly1.cif.gz_A | crystal structure of bacillus subtilus ydib | 0.8719 | 1 | 135 |
| 6n9a-assembly1.cif.gz_E-2 | crystal structure of thermotoga maritima threonylcarbamoyladenosine biosynthesis complex tsab2d2e2 bound to atp and carboxy-amp | 0.866 | 1 | 135 |
| 6s84-assembly1.cif.gz_E | tsabde complex from thermotoga maritima | 0.8577 | 1 | 134 |
| 1fl9-assembly3.cif.gz_C | the yjee protein | 0.8492 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWK9_1_139_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.854 | 9 | 133 | 3.40.50.300 |
| af_P9WFS7_20_166_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8499 | 1 | 131 | 3.40.50.300 |
| af_P0AF67_2_153_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8491 | 1 | 131 | 3.40.50.300 |
| af_P9WFS7_20_166_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7793 | 1 | 131 | 3.40.50.300 |
| af_P0AF67_2_153_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7791 | 1 | 131 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P6FSB6-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9577 | 1 | 143 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A537MGH8-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9523 | 1 | 143 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A4P6FSB6-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9512 | 1 | 143 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A537MGH8-F1-model_v4 | tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) | 0.9458 | 1 | 143 |
GO:0002949
GO:0005524 GO:0005737 GO:0016740 |
| AF-A0A2A2KJI1-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9456 | 7 | 141 |
GO:0000155
GO:0002949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar