F416286

General Info

Members Datasets Scaffolds Average Seq Length
345 208 690 329

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100084638|Ga0070697_1000846381
Length 358
Sequence MPKVFAFLSVTRLLCLSSLAGATLLAGAQQLPTLAGQDQPSSSQSQSRDDAMSTLKVNVDVVQLFFNVKDKKGGLIPNLTKNDFQIFEDGKPQTIKYYAAESNLPLTLGILIDSSGSQERVLPMEKEVGGAFLSEILREKDLAFVLSFDVNVDLLQDFTNSVSRLKTALNQAKINTGGSVASVIPGMGGGPVPTAGNQRGTLLYDAIYLASHDELAHEVGRKAMVILTDGEDFGSQLTVKDAIEAAQKADSICYVLLIADRGFYGFGGYSGDREMKKLAEETGGRVINVGNKFDKLKEAFDQIALELRSQYNVGYTPTNSARDGTFRKVDIRAKKDYKIQARTGYYALGTRKRSETTH

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
204 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.8
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 21.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100084638 3300005536 Unclassified 2615
2 MBSR1b_contig_9211755 2162886012 Bacteria 1565
3 JGI24034J26672_10011554 3300002239 Bacteria 1325
4 JGI24751J29686_10001372 3300002459 Bacteria 5123
5 Ga0058862_11714472 3300004803 Unclassified 1154
6 Ga0065715_10022507 3300005293 Unclassified 1972
7 Ga0065715_10102599 3300005293 Bacteria 3098
8 Ga0070676_10001539 3300005328 Bacteria 11671
9 Ga0070683_100003068 3300005329 Bacteria 13443
10 Ga0070683_100042539 3300005329 Unclassified 4183
11 Ga0070670_100010978 3300005331 Bacteria 7737
12 Ga0070670_100043040 3300005331 Unclassified 3883
13 Ga0070670_100142317 3300005331 Unclassified 2074
14 Ga0070677_10005728 3300005333 Bacteria 4107
15 Ga0068869_100113480 3300005334 Bacteria 2064
16 Ga0070680_100247067 3300005336 Bacteria 1508
17 Ga0068868_100002828 3300005338 Bacteria 12021
18 Ga0068868_100036578 3300005338 Unclassified 3801
19 Ga0070660_100021423 3300005339 Unclassified 4767
20 Ga0070660_100203999 3300005339 Bacteria 1604
21 Ga0070661_100000564 3300005344 Bacteria 28146
22 Ga0070661_100145059 3300005344 Unclassified 1791
23 Ga0070668_100010468 3300005347 Bacteria 6894
24 Ga0070669_100104915 3300005353 Unclassified 2137
25 Ga0070675_100011704 3300005354 Bacteria 6877
26 Ga0070675_100106852 3300005354 Unclassified 2363
27 Ga0070673_100011141 3300005364 Bacteria 6131
28 Ga0070673_100130566 3300005364 Bacteria 2107
29 Ga0070688_100000761 3300005365 Bacteria 15904
30 Ga0070659_100003196 3300005366 Bacteria 11663
31 Ga0070659_100092743 3300005366 Unclassified 2422
32 Ga0070667_100048424 3300005367 Bacteria 3577
33 Ga0070709_10004888 3300005434 Bacteria 7242
34 Ga0070709_10078710 3300005434 Unclassified 2145
35 Ga0070709_10082590 3300005434 Bacteria 2099
36 Ga0070714_100000040 3300005435 Bacteria 119253
37 Ga0070714_100063060 3300005435 Bacteria 3186
38 Ga0070714_100229923 3300005435 Bacteria 1708
39 Ga0070713_100000634 3300005436 Bacteria 22440
40 Ga0070713_100001648 3300005436 Bacteria 14346
41 Ga0070713_100354308 3300005436 Bacteria 1362
42 Ga0070710_10089800 3300005437 Unclassified 1810
43 Ga0070711_100001709 3300005439 Bacteria 12163
44 Ga0070711_100006344 3300005439 Bacteria 7124
45 Ga0070711_100142996 3300005439 Unclassified 1796
46 Ga0070708_100000770 3300005445 Bacteria 24102
47 Ga0070708_100001110 3300005445 Bacteria 20552
48 Ga0070708_100018478 3300005445 Bacteria 5834
49 Ga0070708_100224515 3300005445 Unclassified 1762
50 Ga0070663_100005971 3300005455 Bacteria 7289
51 Ga0070681_10014888 3300005458 Bacteria 7733
52 Ga0070681_10131417 3300005458 Unclassified 2436
53 Ga0068867_100001635 3300005459 Bacteria 15592
54 Ga0070685_10003192 3300005466 Bacteria 8344
55 Ga0070706_100001381 3300005467 Bacteria 25765
56 Ga0070706_100046590 3300005467 Bacteria 4002
57 Ga0070706_100055949 3300005467 Bacteria 3641
58 Ga0070706_100316637 3300005467 Bacteria 1455
59 Ga0070707_100069530 3300005468 Bacteria 3390
60 Ga0070707_100121152 3300005468 Bacteria 2540
61 Ga0070698_100000336 3300005471 Bacteria 48369
62 Ga0070698_100014191 3300005471 Bacteria 8421
63 Ga0070698_100105357 3300005471 Bacteria 2790
64 Ga0070699_100000648 3300005518 Bacteria 32606
65 Ga0070699_100333501 3300005518 Bacteria 1365
66 Ga0070679_100297197 3300005530 Unclassified 1566
67 Ga0070684_100001979 3300005535 Bacteria 15067
68 Ga0070684_100028825 3300005535 Bacteria 4699
69 Ga0070684_100177731 3300005535 Unclassified 1935
70 Ga0070697_100001964 3300005536 Bacteria 15740
71 Ga0070697_100002439 3300005536 Bacteria 14310
72 Ga0070697_100007086 3300005536 Bacteria 8721
73 Ga0070697_100022280 3300005536 Bacteria 5027
74 Ga0068853_100034605 3300005539 Bacteria 4288
75 Ga0070686_100005119 3300005544 Bacteria 7235
76 Ga0070696_100057526 3300005546 Bacteria 2714
77 Ga0068855_100274077 3300005563 Unclassified 1875
78 Ga0070664_100017332 3300005564 Bacteria 5913
79 Ga0068854_100168936 3300005578 Unclassified 1700
80 Ga0068856_100003015 3300005614 Bacteria 17242
81 Ga0068856_100035164 3300005614 Bacteria 4909
82 Ga0068856_100054988 3300005614 Bacteria 3928
83 Ga0068856_100220773 3300005614 Unclassified 1910
84 Ga0068852_100006298 3300005616 Bacteria 8568
85 Ga0068852_100157998 3300005616 Unclassified 2114
86 Ga0068864_100026522 3300005618 Bacteria 4886
87 Ga0068866_10005966 3300005718 Bacteria 5067
88 Ga0068861_100139985 3300005719 Bacteria 1974
89 Ga0068851_10003451 3300005834 Bacteria 7032
90 Ga0068851_10044034 3300005834 Unclassified 2252
91 Ga0068858_100012401 3300005842 Bacteria 8037
92 Ga0068860_100068076 3300005843 Bacteria 3383
93 Ga0068862_100003832 3300005844 Bacteria 12810
94 Ga0070717_10002200 3300006028 Bacteria 13706
95 Ga0070717_10003006 3300006028 Bacteria 12007
96 Ga0070717_10005322 3300006028 Bacteria 9380
97 Ga0070717_10027909 3300006028 Bacteria 4513
98 Ga0070717_10062241 3300006028 Bacteria 3094
99 Ga0070717_10094833 3300006028 Unclassified 2525
100 Ga0070717_10156559 3300006028 Bacteria 1974
101 Ga0070717_10161491 3300006028 Unclassified 1944
102 Ga0070716_100239706 3300006173 Bacteria 1229
103 Ga0070712_100001404 3300006175 Bacteria 14643
104 Ga0070712_100003230 3300006175 Bacteria 10046
105 Ga0097621_100281004 3300006237 Unclassified 1465
106 Ga0075431_100307333 3300006847 Bacteria 1601
107 Ga0068865_100016958 3300006881 Bacteria 4674
108 Ga0075436_100003071 3300006914 Bacteria 11438
109 Ga0099795_10015577 3300007788 Bacteria 2385
110 Ga0099795_10038390 3300007788 Viruses 1690
111 Ga0105250_10016650 3300009092 Bacteria 2993
112 Ga0105240_10025067 3300009093 Bacteria 7850
113 Ga0105240_10032204 3300009093 Bacteria 6789
114 Ga0105240_10046717 3300009093 Bacteria 5484
115 Ga0105240_10257169 3300009093 Unclassified 2016
116 Ga0105245_10006534 3300009098 Bacteria 10236
117 Ga0105247_10001438 3300009101 Bacteria 17255
118 Ga0114129_10125206 3300009147 Bacteria 3534
119 Ga0105241_10013724 3300009174 Bacteria 5934
120 Ga0105241_10021251 3300009174 Bacteria 4796
121 Ga0105241_10099387 3300009174 Bacteria 2311
122 Ga0105242_10001741 3300009176 Bacteria 17197
123 Ga0105248_10080828 3300009177 Bacteria 3654
124 Ga0105237_10007944 3300009545 Bacteria 11560
125 Ga0105237_10035956 3300009545 Bacteria 5010
126 Ga0105237_10087930 3300009545 Unclassified 3097
127 Ga0105238_10062827 3300009551 Bacteria 3714
128 Ga0105249_10029432 3300009553 Bacteria 4960
129 Ga0105239_10011180 3300010375 Bacteria 10017
130 Ga0105239_10055366 3300010375 Bacteria 4350
131 Ga0105239_10267052 3300010375 Bacteria 1924
132 Ga0105246_10000398 3300011119 Bacteria 23279
133 Ga0157373_10007420 3300013100 Bacteria 8155
134 Ga0157373_10041853 3300013100 Bacteria 3276
135 Ga0157371_10020562 3300013102 Bacteria 4857
136 Ga0157370_10295776 3300013104 Unclassified 1495
137 Ga0157369_10000972 3300013105 Bacteria 36347
138 Ga0157369_10038911 3300013105 Bacteria 5199
139 Ga0157369_10073254 3300013105 Unclassified 3675
140 Ga0157369_10207925 3300013105 Bacteria 2052
141 Ga0157374_10002566 3300013296 Bacteria 15326
142 Ga0157374_10040983 3300013296 Bacteria 4265
143 Ga0157374_10049886 3300013296 Unclassified 3888
144 Ga0157378_10055104 3300013297 Bacteria 3541
145 Ga0163162_10093699 3300013306 Bacteria 3089
146 Ga0157372_10006719 3300013307 Bacteria 12232
147 Ga0157372_10009135 3300013307 Bacteria 10530
148 Ga0157372_10080023 3300013307 Bacteria 3696
149 Ga0157372_10152947 3300013307 Unclassified 2663
150 Ga0163163_10005253 3300014325 Bacteria 11166
151 Ga0163163_10012732 3300014325 Bacteria 7673
152 Ga0163163_10073141 3300014325 Bacteria 3418
153 Ga0182008_10004202 3300014497 Bacteria 8464
154 Ga0182008_10031987 3300014497 Unclassified 2645
155 Ga0157377_10001486 3300014745 Bacteria 10148
156 Ga0157379_10008207 3300014968 Bacteria 9068
157 Ga0182006_1035216 3300015261 Unclassified 1998
158 Ga0182007_10002598 3300015262 Bacteria 8891
159 Ga0182007_10006582 3300015262 Unclassified 4978
160 Ga0163161_10004168 3300017792 Bacteria 10108
161 Ga0213875_10059832 3300021388 Bacteria 1783
162 Ga0207697_10003029 3300025315 Bacteria 8448
163 Ga0207656_10001918 3300025321 Bacteria 6917
164 Ga0207682_10006955 3300025893 Bacteria 4536
165 Ga0207688_10001958 3300025901 Bacteria 11042
166 Ga0207647_10003556 3300025904 Bacteria 11698
167 Ga0207685_10028381 3300025905 Bacteria 1970
168 Ga0207699_10001094 3300025906 Bacteria 12788
169 Ga0207699_10035848 3300025906 Bacteria 2825
170 Ga0207699_10072891 3300025906 Unclassified 2105
171 Ga0207645_10000772 3300025907 Bacteria 26702
172 Ga0207643_10000412 3300025908 Bacteria 28337
173 Ga0207684_10000203 3300025910 Bacteria 91833
174 Ga0207684_10005498 3300025910 Bacteria 11670
175 Ga0207684_10024604 3300025910 Bacteria 5134
176 Ga0207684_10028393 3300025910 Bacteria 4767
177 Ga0207684_10068628 3300025910 Bacteria 3013
178 Ga0207654_10020015 3300025911 Bacteria 3541
179 Ga0207707_10023254 3300025912 Bacteria 5422
180 Ga0207707_10105501 3300025912 Unclassified 2463
181 Ga0207695_10056074 3300025913 Bacteria 4102
182 Ga0207671_10233547 3300025914 Bacteria 1443
183 Ga0207693_10000053 3300025915 Bacteria 97139
184 Ga0207693_10000071 3300025915 Bacteria 89988
185 Ga0207693_10092010 3300025915 Unclassified 2377
186 Ga0207693_10379603 3300025915 Bacteria 1105
187 Ga0207663_10002430 3300025916 Bacteria 8946
188 Ga0207663_10044209 3300025916 Unclassified 2733
189 Ga0207663_10157038 3300025916 Unclassified 1601
190 Ga0207662_10015393 3300025918 Bacteria 4304
191 Ga0207657_10003461 3300025919 Bacteria 16840
192 Ga0207657_10016776 3300025919 Bacteria 7051
193 Ga0207649_10000783 3300025920 Bacteria 20616
194 Ga0207649_10100220 3300025920 Bacteria 1915
195 Ga0207652_10168181 3300025921 Bacteria 1967
196 Ga0207646_10006813 3300025922 Bacteria 11751
197 Ga0207646_10007618 3300025922 Bacteria 10964
198 Ga0207646_10042821 3300025922 Unclassified 4068
199 Ga0207650_10000024 3300025925 Bacteria 299184
200 Ga0207650_10105776 3300025925 Bacteria 2173
201 Ga0207659_10144718 3300025926 Bacteria 1849
202 Ga0207700_10000153 3300025928 Bacteria 41130
203 Ga0207700_10000674 3300025928 Bacteria 19930
204 Ga0207700_10016956 3300025928 Unclassified 4851
205 Ga0207700_10062335 3300025928 Bacteria 2831
206 Ga0207664_10000029 3300025929 Bacteria 183815
207 Ga0207664_10004921 3300025929 Bacteria 9079
208 Ga0207644_10080374 3300025931 Bacteria 2407
209 Ga0207644_10308395 3300025931 Unclassified 1277
210 Ga0207706_10000578 3300025933 Bacteria 39082
211 Ga0207670_10022323 3300025936 Bacteria 3920
212 Ga0207669_10126041 3300025937 Bacteria 1749
213 Ga0207704_10012354 3300025938 Bacteria 4240
214 Ga0207665_10005766 3300025939 Bacteria 8235
215 Ga0207665_10041895 3300025939 Bacteria 3059
216 Ga0207691_10000072 3300025940 Bacteria 83580
217 Ga0207689_10001329 3300025942 Bacteria 23863
218 Ga0207661_10000062 3300025944 Bacteria 75988
219 Ga0207661_10042655 3300025944 Unclassified 3578
220 Ga0207679_10000040 3300025945 Bacteria 127317
221 Ga0207667_10172698 3300025949 Unclassified 2221
222 Ga0207651_10017952 3300025960 Bacteria 4195
223 Ga0207712_10330907 3300025961 Bacteria 1260
224 Ga0207668_10031614 3300025972 Bacteria 3488
225 Ga0207640_10012599 3300025981 Bacteria 4822
226 Ga0207640_10162944 3300025981 Unclassified 1652
227 Ga0207640_10333961 3300025981 Unclassified 1211
228 Ga0207658_10008825 3300025986 Bacteria 6841
229 Ga0207677_10026055 3300026023 Unclassified 3661
230 Ga0207639_10023181 3300026041 Bacteria 4480
231 Ga0207678_10000208 3300026067 Bacteria 51930
232 Ga0207702_10145462 3300026078 Unclassified 2150
233 Ga0207702_10192262 3300026078 Unclassified 1886
234 Ga0207641_10000030 3300026088 Bacteria 224468
235 Ga0207648_10000303 3300026089 Bacteria 53727
236 Ga0207676_10000256 3300026095 Bacteria 46055
237 Ga0207674_10000069 3300026116 Bacteria 106470
238 Ga0207674_10037298 3300026116 Bacteria 5057
239 Ga0207675_100177354 3300026118 Bacteria 2039
240 Ga0207683_10000662 3300026121 Bacteria 31638
241 Ga0207698_10333245 3300026142 Unclassified 1426
242 Ga0268266_10002820 3300028379 Bacteria 18130
243 Ga0268265_10004314 3300028380 Bacteria 9909
244 Ga0268264_10117553 3300028381 Bacteria 2339
245 Ga0265338_10002879 3300028800 Bacteria 25111
246 Ga0265338_10102640 3300028800 Bacteria 2325
247 Ga0265338_10259188 3300028800 Unclassified 1279
248 Ga0265762_1001509 3300030760 Bacteria 4223
249 Ga0265760_10018266 3300031090 Bacteria 2018
250 Ga0265325_10082105 3300031241 Bacteria 1600
251 Ga0265339_10006673 3300031249 Bacteria 7546
252 Ga0265339_10147327 3300031249 Unclassified 1193
253 Ga0265342_10070193 3300031712 Bacteria 2044
254 Ga0307416_100503113 3300032002 Unclassified 1276
255 Ga0373926_0026949 3300035083 Bacteria 2013
256 Ga0373934_0002314 3300035086 Bacteria 7009
257 Ga0373936_0017336 3300035113 Bacteria 2772
258 Ga0373936_0042522 3300035113 Bacteria 1824
259 Ga0373945_0004112 3300035116 Bacteria 4614
260 Ga0373953_0016320 3300035117 Bacteria 2709
261 Ga0373954_0021198 3300035118 Unclassified 2941
262 Ga0373956_0037277 3300035119 Unclassified 2149
263 Ga0373957_0019028 3300035120 Bacteria 2411
264 Ga0373943_0000157 3300035170 Bacteria 26667
265 Ga0373924_0000117 3300035410 Bacteria 22914
266 Ga0373931_0006408 3300035691 Bacteria 5499
267 Ga0373927_0000070 3300035695 Bacteria 73849
268 Ga0373927_0091499 3300035695 Bacteria 1975
269 Ga0373927_0114465 3300035695 Bacteria 1758
270 Ga0373927_0154986 3300035695 Bacteria 1500
271 Ga0373947_0001581 3300035725 Bacteria 13952
272 Ga0373947_0006333 3300035725 Bacteria 6877
273 Ga0373947_0099035 3300035725 Bacteria 1829
274 Ga0373937_0060353 3300036401 Bacteria 3485
275 Ga0373925_0001522 3300037068 Bacteria 19795
276 Ga0373925_0176408 3300037068 Bacteria 1689
277 Ga0373925_0347729 3300037068 Unclassified 1203
278 Ga0395898_0272057 3300037466 Bacteria 1616
279 Ga0395905_0003037 3300037471 Bacteria 18179
280 Ga0395905_0016093 3300037471 Bacteria 7109
281 Ga0395905_0029891 3300037471 Bacteria 5136
282 Ga0395905_0059349 3300037471 Bacteria 3576
283 Ga0395905_0094376 3300037471 Bacteria 2807
284 Ga0395905_0168761 3300037471 Bacteria 2056
285 Ga0436364_0415424 3300037853 Bacteria 6047
286 Ga0436365_1855381 3300039437 Bacteria 1440
287 Ga0436363_0502718 3300039450 Bacteria 4588
288 Ga0436363_1251884 3300039450 Bacteria 3679
289 Ga0451577_0018783 3300042876 Bacteria 6361
290 Ga0466963_0019878 3300044694 Bacteria 4218
291 Ga0466963_0161721 3300044694 Unclassified 1558
292 Ga0466963_0329519 3300044694 Unclassified 1075
293 Ga0466957_0078244 3300044842 Unclassified 2056
294 Ga0466957_0234508 3300044842 Unclassified 1216
295 Ga0466967_0000853 3300045976 Bacteria 16182
296 Ga0466967_0011128 3300045976 Bacteria 6797
297 Ga0466967_0436472 3300045976 Unclassified 1278
298 Ga0495653_0081792 3300046463 Unclassified 2386
299 Ga0495580_0000108 3300046472 Bacteria 55508
300 Ga0495580_0001723 3300046472 Bacteria 19219
301 Ga0495580_0032581 3300046472 Bacteria 3760
302 Ga0495580_0044959 3300046472 Unclassified 3138
303 Ga0495582_0023263 3300046473 Bacteria 3390
304 Ga0495639_0008114 3300046475 Bacteria 4509
305 Ga0495630_0030330 3300046517 Bacteria 4022
306 Ga0495666_0106154 3300046526 Unclassified 1322
307 Ga0495586_0050885 3300046535 Bacteria 2242
308 Ga0495586_0121309 3300046535 Bacteria 1461
309 Ga0495645_0038674 3300046543 Bacteria 3480
310 Ga0495667_0114695 3300046559 Unclassified 1741
311 Ga0495635_0033197 3300046663 Bacteria 3580
312 Ga0495635_0115896 3300046663 Unclassified 1829
313 Ga0495659_0021910 3300046664 Viruses 2156
314 Ga0495658_0082370 3300046683 Bacteria 1891
315 Ga0495669_0003551 3300046684 Bacteria 6430
316 Ga0495669_0017677 3300046684 Bacteria 3062
317 Ga0495674_0051459 3300047319 Bacteria 3631
318 Ga0495675_0009381 3300047444 Bacteria 6088
319 Ga0496102_0120059 3300048905 Bacteria 2455
320 Ga0496102_0258398 3300048905 Unclassified 1642
321 Ga0496103_0024690 3300048906 Unclassified 3627
322 Ga0496104_0114362 3300048907 Bacteria 2588
323 Ga0496104_0290253 3300048907 Unclassified 1548
324 Ga0496106_0252374 3300048909 Bacteria 1410
325 Ga0496106_0269793 3300048909 Bacteria 1362
326 Ga0496107_0289539 3300048910 Unclassified 1219
327 Ga0496108_0000410 3300048911 Bacteria 35171
328 Ga0496108_0029739 3300048911 Bacteria 4527
329 Ga0496109_0409327 3300048912 Bacteria 1281
330 Ga0496110_0005663 3300048913 Bacteria 9804
331 Ga0496112_0000155 3300048915 Bacteria 43076
332 Ga0496112_0018989 3300048915 Bacteria 6480
333 Ga0496112_0020108 3300048915 Bacteria 6320
334 Ga0496112_0041710 3300048915 Unclassified 4490
335 Ga0496113_0002103 3300048916 Bacteria 11478
336 Ga0496113_0013614 3300048916 Bacteria 5519
337 Ga0496115_0023906 3300048918 Bacteria 4745
338 Ga0496115_0247555 3300048918 Bacteria 1468
339 Ga0501298_004997 3300049521 Bacteria 2110
340 Ga0501216_009768 3300049660 Bacteria 1534
341 nmdc:mga05p37_197412_c1 3300050507 Bacteria 2439
342 nmdc:mga0rr50_15222_c1 3300050513 Bacteria 5072
343 nmdc:mga0rr50_69928_c1 3300050513 Unclassified 2673
344 Ga0495601_0010401 3300053077 Bacteria 5536
345 Ga0495612_0025457 3300053078 Unclassified 2376
346 Ga0070697_100084638
347 MBSR1b_contig_9211755
348 JGI24034J26672_10011554
349 JGI24751J29686_10001372
350 Ga0058862_11714472
351 Ga0065715_10022507
352 Ga0065715_10102599
353 Ga0070676_10001539
354 Ga0070683_100003068
355 Ga0070683_100042539
356 Ga0070670_100010978
357 Ga0070670_100043040
358 Ga0070670_100142317
359 Ga0070677_10005728
360 Ga0068869_100113480
361 Ga0070680_100247067
362 Ga0068868_100002828
363 Ga0068868_100036578
364 Ga0070660_100021423
365 Ga0070660_100203999
366 Ga0070661_100000564
367 Ga0070661_100145059
368 Ga0070668_100010468
369 Ga0070669_100104915
370 Ga0070675_100011704
371 Ga0070675_100106852
372 Ga0070673_100011141
373 Ga0070673_100130566
374 Ga0070688_100000761
375 Ga0070659_100003196
376 Ga0070659_100092743
377 Ga0070667_100048424
378 Ga0070709_10004888
379 Ga0070709_10078710
380 Ga0070709_10082590
381 Ga0070714_100000040
382 Ga0070714_100063060
383 Ga0070714_100229923
384 Ga0070713_100000634
385 Ga0070713_100001648
386 Ga0070713_100354308
387 Ga0070710_10089800
388 Ga0070711_100001709
389 Ga0070711_100006344
390 Ga0070711_100142996
391 Ga0070708_100000770
392 Ga0070708_100001110
393 Ga0070708_100018478
394 Ga0070708_100224515
395 Ga0070663_100005971
396 Ga0070681_10014888
397 Ga0070681_10131417
398 Ga0068867_100001635
399 Ga0070685_10003192
400 Ga0070706_100001381
401 Ga0070706_100046590
402 Ga0070706_100055949
403 Ga0070706_100316637
404 Ga0070707_100069530
405 Ga0070707_100121152
406 Ga0070698_100000336
407 Ga0070698_100014191
408 Ga0070698_100105357
409 Ga0070699_100000648
410 Ga0070699_100333501
411 Ga0070679_100297197
412 Ga0070684_100001979
413 Ga0070684_100028825
414 Ga0070684_100177731
415 Ga0070697_100001964
416 Ga0070697_100002439
417 Ga0070697_100007086
418 Ga0070697_100022280
419 Ga0068853_100034605
420 Ga0070686_100005119
421 Ga0070696_100057526
422 Ga0068855_100274077
423 Ga0070664_100017332
424 Ga0068854_100168936
425 Ga0068856_100003015
426 Ga0068856_100035164
427 Ga0068856_100054988
428 Ga0068856_100220773
429 Ga0068852_100006298
430 Ga0068852_100157998
431 Ga0068864_100026522
432 Ga0068866_10005966
433 Ga0068861_100139985
434 Ga0068851_10003451
435 Ga0068851_10044034
436 Ga0068858_100012401
437 Ga0068860_100068076
438 Ga0068862_100003832
439 Ga0070717_10002200
440 Ga0070717_10003006
441 Ga0070717_10005322
442 Ga0070717_10027909
443 Ga0070717_10062241
444 Ga0070717_10094833
445 Ga0070717_10156559
446 Ga0070717_10161491
447 Ga0070716_100239706
448 Ga0070712_100001404
449 Ga0070712_100003230
450 Ga0097621_100281004
451 Ga0075431_100307333
452 Ga0068865_100016958
453 Ga0075436_100003071
454 Ga0099795_10015577
455 Ga0099795_10038390
456 Ga0105250_10016650
457 Ga0105240_10025067
458 Ga0105240_10032204
459 Ga0105240_10046717
460 Ga0105240_10257169
461 Ga0105245_10006534
462 Ga0105247_10001438
463 Ga0114129_10125206
464 Ga0105241_10013724
465 Ga0105241_10021251
466 Ga0105241_10099387
467 Ga0105242_10001741
468 Ga0105248_10080828
469 Ga0105237_10007944
470 Ga0105237_10035956
471 Ga0105237_10087930
472 Ga0105238_10062827
473 Ga0105249_10029432
474 Ga0105239_10011180
475 Ga0105239_10055366
476 Ga0105239_10267052
477 Ga0105246_10000398
478 Ga0157373_10007420
479 Ga0157373_10041853
480 Ga0157371_10020562
481 Ga0157370_10295776
482 Ga0157369_10000972
483 Ga0157369_10038911
484 Ga0157369_10073254
485 Ga0157369_10207925
486 Ga0157374_10002566
487 Ga0157374_10040983
488 Ga0157374_10049886
489 Ga0157378_10055104
490 Ga0163162_10093699
491 Ga0157372_10006719
492 Ga0157372_10009135
493 Ga0157372_10080023
494 Ga0157372_10152947
495 Ga0163163_10005253
496 Ga0163163_10012732
497 Ga0163163_10073141
498 Ga0182008_10004202
499 Ga0182008_10031987
500 Ga0157377_10001486
501 Ga0157379_10008207
502 Ga0182006_1035216
503 Ga0182007_10002598
504 Ga0182007_10006582
505 Ga0163161_10004168
506 Ga0213875_10059832
507 Ga0207697_10003029
508 Ga0207656_10001918
509 Ga0207682_10006955
510 Ga0207688_10001958
511 Ga0207647_10003556
512 Ga0207685_10028381
513 Ga0207699_10001094
514 Ga0207699_10035848
515 Ga0207699_10072891
516 Ga0207645_10000772
517 Ga0207643_10000412
518 Ga0207684_10000203
519 Ga0207684_10005498
520 Ga0207684_10024604
521 Ga0207684_10028393
522 Ga0207684_10068628
523 Ga0207654_10020015
524 Ga0207707_10023254
525 Ga0207707_10105501
526 Ga0207695_10056074
527 Ga0207671_10233547
528 Ga0207693_10000053
529 Ga0207693_10000071
530 Ga0207693_10092010
531 Ga0207693_10379603
532 Ga0207663_10002430
533 Ga0207663_10044209
534 Ga0207663_10157038
535 Ga0207662_10015393
536 Ga0207657_10003461
537 Ga0207657_10016776
538 Ga0207649_10000783
539 Ga0207649_10100220
540 Ga0207652_10168181
541 Ga0207646_10006813
542 Ga0207646_10007618
543 Ga0207646_10042821
544 Ga0207650_10000024
545 Ga0207650_10105776
546 Ga0207659_10144718
547 Ga0207700_10000153
548 Ga0207700_10000674
549 Ga0207700_10016956
550 Ga0207700_10062335
551 Ga0207664_10000029
552 Ga0207664_10004921
553 Ga0207644_10080374
554 Ga0207644_10308395
555 Ga0207706_10000578
556 Ga0207670_10022323
557 Ga0207669_10126041
558 Ga0207704_10012354
559 Ga0207665_10005766
560 Ga0207665_10041895
561 Ga0207691_10000072
562 Ga0207689_10001329
563 Ga0207661_10000062
564 Ga0207661_10042655
565 Ga0207679_10000040
566 Ga0207667_10172698
567 Ga0207651_10017952
568 Ga0207712_10330907
569 Ga0207668_10031614
570 Ga0207640_10012599
571 Ga0207640_10162944
572 Ga0207640_10333961
573 Ga0207658_10008825
574 Ga0207677_10026055
575 Ga0207639_10023181
576 Ga0207678_10000208
577 Ga0207702_10145462
578 Ga0207702_10192262
579 Ga0207641_10000030
580 Ga0207648_10000303
581 Ga0207676_10000256
582 Ga0207674_10000069
583 Ga0207674_10037298
584 Ga0207675_100177354
585 Ga0207683_10000662
586 Ga0207698_10333245
587 Ga0268266_10002820
588 Ga0268265_10004314
589 Ga0268264_10117553
590 Ga0265338_10002879
591 Ga0265338_10102640
592 Ga0265338_10259188
593 Ga0265762_1001509
594 Ga0265760_10018266
595 Ga0265325_10082105
596 Ga0265339_10006673
597 Ga0265339_10147327
598 Ga0265342_10070193
599 Ga0307416_100503113
600 Ga0373926_0026949
601 Ga0373934_0002314
602 Ga0373936_0017336
603 Ga0373936_0042522
604 Ga0373945_0004112
605 Ga0373953_0016320
606 Ga0373954_0021198
607 Ga0373956_0037277
608 Ga0373957_0019028
609 Ga0373943_0000157
610 Ga0373924_0000117
611 Ga0373931_0006408
612 Ga0373927_0000070
613 Ga0373927_0091499
614 Ga0373927_0114465
615 Ga0373927_0154986
616 Ga0373947_0001581
617 Ga0373947_0006333
618 Ga0373947_0099035
619 Ga0373937_0060353
620 Ga0373925_0001522
621 Ga0373925_0176408
622 Ga0373925_0347729
623 Ga0395898_0272057
624 Ga0395905_0003037
625 Ga0395905_0016093
626 Ga0395905_0029891
627 Ga0395905_0059349
628 Ga0395905_0094376
629 Ga0395905_0168761
630 Ga0436364_0415424
631 Ga0436365_1855381
632 Ga0436363_0502718
633 Ga0436363_1251884
634 Ga0451577_0018783
635 Ga0466963_0019878
636 Ga0466963_0161721
637 Ga0466963_0329519
638 Ga0466957_0078244
639 Ga0466957_0234508
640 Ga0466967_0000853
641 Ga0466967_0011128
642 Ga0466967_0436472
643 Ga0495653_0081792
644 Ga0495580_0000108
645 Ga0495580_0001723
646 Ga0495580_0032581
647 Ga0495580_0044959
648 Ga0495582_0023263
649 Ga0495639_0008114
650 Ga0495630_0030330
651 Ga0495666_0106154
652 Ga0495586_0050885
653 Ga0495586_0121309
654 Ga0495645_0038674
655 Ga0495667_0114695
656 Ga0495635_0033197
657 Ga0495635_0115896
658 Ga0495659_0021910
659 Ga0495658_0082370
660 Ga0495669_0003551
661 Ga0495669_0017677
662 Ga0495674_0051459
663 Ga0495675_0009381
664 Ga0496102_0120059
665 Ga0496102_0258398
666 Ga0496103_0024690
667 Ga0496104_0114362
668 Ga0496104_0290253
669 Ga0496106_0252374
670 Ga0496106_0269793
671 Ga0496107_0289539
672 Ga0496108_0000410
673 Ga0496108_0029739
674 Ga0496109_0409327
675 Ga0496110_0005663
676 Ga0496112_0000155
677 Ga0496112_0018989
678 Ga0496112_0020108
679 Ga0496112_0041710
680 Ga0496113_0002103
681 Ga0496113_0013614
682 Ga0496115_0023906
683 Ga0496115_0247555
684 Ga0501298_004997
685 Ga0501216_009768
686 nmdc:mga05p37_197412_c1
687 nmdc:mga0rr50_15222_c1
688 nmdc:mga0rr50_69928_c1
689 Ga0495601_0010401
690 Ga0495612_0025457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nmi-assembly1.cif.gz_E cryo-em structure of the human tfiih core complex 0.8082 92 283
4cn9-assembly2.cif.gz_B structure of proximal thread matrix protein 1 (ptmp1) from the mussel byssus with zinc occupied midas motif 0.8007 84 291
8ebw-assembly1.cif.gz_E initial dna-lesion (ap) binding by xpc and tfiih complex2 0.8001 92 283
8ft6-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, ala-ala linker variant, sumo tag-free preparation. 0.7996 95 285
6ro4-assembly1.cif.gz_D structure of the core tfiih-xpa-dna complex 0.7896 91 283
ID Description Score Start End Superfamily
af_Q66H58_3_138_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8926 96 163 3.40.50.410
af_D3ZN64_788_986_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8292 89 286 3.40.50.410
af_A0A0P0WT04_289_392_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8199 95 166 3.40.50.410
af_A0A0P0XV48_261_417_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8168 95 220 3.40.50.410
af_X1WEX1_155_342_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8168 92 286 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A257VP29-F1-model_v4 VWA domain-containing protein 0.9625 43 330
AF-A0A257VP29-F1-model_v4 VWA domain-containing protein 0.9592 43 330
AF-A0A833HID0-F1-model_v4 VWA domain-containing protein 0.9533 43 326
AF-A0A3N5GDP9-F1-model_v4 VWA domain-containing protein 0.9499 41 326
AF-A0A2V7YYK7-F1-model_v4 VWFA domain-containing protein 0.9487 41 326

Map