F416358

General Info

Members Datasets Scaffolds Average Seq Length
345 188 344 165

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10999352|Ga0105241_109993522
Length 166
Sequence MPDIEIRTIREEDNPSIATIIRNTLAEFGANKPGTVYFDPTTDNLYDLFAKKGSRYHVAFVDIDGERQMAGGAGIYPTEGLPKDTAELVKMYLSPAARGIGLGKELIARSLEFAKEAGYKKVYLETMPELSKAVSVYEKFGFRYLDGPMGNTGHFGCHIWMLKDPL

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
183 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0
Rhizoplane 0.29
Rhizosphere 92.46
Stem 0
Stem Tuber 0
Unclassified 3.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10003679 3300003320 Bacteria 27278
2 rootH1_10088937 3300003323 Bacteria 1992
3 Ga0070658_10000903 3300005327 Bacteria 25434
4 Ga0070676_10005739 3300005328 Bacteria 6616
5 Ga0070683_100132348 3300005329 Bacteria 2360
6 Ga0070690_100286213 3300005330 Bacteria 1177
7 Ga0070690_100444430 3300005330 Bacteria 960
8 Ga0070670_100250449 3300005331 Bacteria 1543
9 Ga0070670_100424548 3300005331 Bacteria 1175
10 Ga0070670_100684616 3300005331 Unclassified 921
11 Ga0068869_100131352 3300005334 Bacteria 1925
12 Ga0068869_100250365 3300005334 Bacteria 1415
13 Ga0068869_100262362 3300005334 Bacteria 1383
14 Ga0070666_10000074 3300005335 Bacteria 72739
15 Ga0070666_10100142 3300005335 Bacteria 1996
16 Ga0070666_10160074 3300005335 Bacteria 1573
17 Ga0068868_100002331 3300005338 Bacteria 13134
18 Ga0068868_100006670 3300005338 Bacteria 8192
19 Ga0070660_100948121 3300005339 Unclassified 726
20 Ga0070660_101306003 3300005339 Bacteria 616
21 Ga0070687_100140784 3300005343 Unclassified 1405
22 Ga0070661_100482245 3300005344 Bacteria 990
23 Ga0070692_10033510 3300005345 Bacteria 2588
24 Ga0070668_100000022 3300005347 Bacteria 96336
25 Ga0070668_100609690 3300005347 Bacteria 956
26 Ga0070669_100321318 3300005353 Bacteria 1250
27 Ga0070675_100129754 3300005354 Bacteria 2147
28 Ga0070671_100023062 3300005355 Bacteria 5087
29 Ga0070671_100032781 3300005355 Bacteria 4293
30 Ga0070671_100199620 3300005355 Unclassified 1696
31 Ga0070673_100034889 3300005364 Bacteria 3811
32 Ga0070673_100183360 3300005364 Bacteria 1793
33 Ga0070673_100396389 3300005364 Bacteria 1233
34 Ga0070688_100075848 3300005365 Bacteria 2162
35 Ga0070688_101052524 3300005365 Bacteria 649
36 Ga0070659_100010660 3300005366 Bacteria 6769
37 Ga0070667_100001525 3300005367 Bacteria 20730
38 Ga0070667_100011346 3300005367 Bacteria 7367
39 Ga0070667_100024194 3300005367 Bacteria 5044
40 Ga0070667_100886090 3300005367 Bacteria 830
41 Ga0070667_101550433 3300005367 Unclassified 622
42 Ga0070663_100769896 3300005455 Bacteria 823
43 Ga0070662_100013892 3300005457 Bacteria 5364
44 Ga0070662_101383667 3300005457 Bacteria 606
45 Ga0070681_10199176 3300005458 Unclassified 1921
46 Ga0068867_100017526 3300005459 Bacteria 5087
47 Ga0070685_10756951 3300005466 Unclassified 713
48 Ga0070679_100017007 3300005530 Bacteria 7030
49 Ga0070684_100056698 3300005535 Bacteria 3420
50 Ga0068853_100006544 3300005539 Bacteria 9276
51 Ga0068853_100082720 3300005539 Bacteria 2812
52 Ga0068853_100284103 3300005539 Bacteria 1526
53 Ga0068853_100883521 3300005539 Unclassified 858
54 Ga0070672_100000021 3300005543 Bacteria 69249
55 Ga0070672_100121006 3300005543 Bacteria 2142
56 Ga0070672_100637591 3300005543 Bacteria 930
57 Ga0070665_100011401 3300005548 Bacteria 8986
58 Ga0068855_100015722 3300005563 Bacteria 9103
59 Ga0068855_100041406 3300005563 Bacteria 5460
60 Ga0070664_100016326 3300005564 Bacteria 6087
61 Ga0070664_100571937 3300005564 Bacteria 1046
62 Ga0068857_100028459 3300005577 Bacteria 4932
63 Ga0068857_100281384 3300005577 Unclassified 1530
64 Ga0068856_100032809 3300005614 Bacteria 5085
65 Ga0068852_100045226 3300005616 Unclassified 3744
66 Ga0068859_100000064 3300005617 Bacteria 104971
67 Ga0068859_100050734 3300005617 Bacteria 4168
68 Ga0068859_100407708 3300005617 Bacteria 1455
69 Ga0068859_100972282 3300005617 Unclassified 932
70 Ga0068864_100001140 3300005618 Bacteria 22143
71 Ga0068864_100003479 3300005618 Bacteria 13008
72 Ga0068864_100297207 3300005618 Unclassified 1511
73 Ga0068866_10141760 3300005718 Bacteria 1380
74 Ga0068851_10001028 3300005834 Bacteria 12107
75 Ga0068851_10041419 3300005834 Bacteria 2315
76 Ga0068863_100000216 3300005841 Bacteria 61837
77 Ga0068863_100024789 3300005841 Bacteria 5721
78 Ga0068863_100128266 3300005841 Bacteria 2421
79 Ga0068863_100310013 3300005841 Bacteria 1532
80 Ga0068863_101133013 3300005841 Bacteria 787
81 Ga0068858_100002789 3300005842 Bacteria 17554
82 Ga0068858_100042993 3300005842 Bacteria 4190
83 Ga0068858_100396728 3300005842 Unclassified 1325
84 Ga0068858_100733474 3300005842 Bacteria 962
85 Ga0068860_100011746 3300005843 Bacteria 8629
86 Ga0068860_100012918 3300005843 Bacteria 8203
87 Ga0068860_100013810 3300005843 Bacteria 7916
88 Ga0068860_100036822 3300005843 Bacteria 4686
89 Ga0070712_100725775 3300006175 Bacteria 849
90 Ga0097621_100004653 3300006237 Bacteria 9582
91 Ga0068871_100004694 3300006358 Bacteria 9551
92 Ga0068871_100016795 3300006358 Bacteria 5524
93 Ga0068871_100289580 3300006358 Bacteria 1435
94 Ga0068871_100316739 3300006358 Bacteria 1373
95 Ga0068871_101186942 3300006358 Unclassified 715
96 Ga0068865_100005377 3300006881 Bacteria 7759
97 Ga0068865_100382706 3300006881 Bacteria 1148
98 Ga0097620_100000064 3300006931 Bacteria 104971
99 Ga0097620_100050731 3300006931 Bacteria 4168
100 Ga0097620_100407697 3300006931 Bacteria 1455
101 Ga0097620_100972392 3300006931 Unclassified 932
102 Ga0105240_10104586 3300009093 Unclassified 3438
103 Ga0105240_10440742 3300009093 Bacteria 1459
104 Ga0111539_10309330 3300009094 Bacteria 1839
105 Ga0105245_10147359 3300009098 Bacteria 2222
106 Ga0105245_10648067 3300009098 Bacteria 1086
107 Ga0105247_10028400 3300009101 Unclassified 3385
108 Ga0114129_10001869 3300009147 Bacteria 28696
109 Ga0105243_10198857 3300009148 Bacteria 1756
110 Ga0105241_10001283 3300009174 Bacteria 19188
111 Ga0105241_10163765 3300009174 Bacteria 1831
112 Ga0105241_10194207 3300009174 Bacteria 1691
113 Ga0105241_10457470 3300009174 Bacteria 1130
114 Ga0105241_10999352 3300009174 Unclassified 782
115 Ga0105242_10026095 3300009176 Bacteria 4629
116 Ga0105242_10154527 3300009176 Bacteria 2003
117 Ga0105242_11034584 3300009176 Bacteria 831
118 Ga0105242_11308061 3300009176 Unclassified 749
119 Ga0105248_11444540 3300009177 Unclassified 778
120 Ga0105237_10032136 3300009545 Bacteria 5315
121 Ga0105237_10305390 3300009545 Bacteria 1594
122 Ga0105237_10513011 3300009545 Bacteria 1205
123 Ga0105249_10011147 3300009553 Bacteria 7898
124 Ga0105249_10023823 3300009553 Bacteria 5498
125 Ga0105249_10795313 3300009553 Bacteria 1010
126 Ga0105239_10000785 3300010375 Bacteria 45044
127 Ga0105239_10129512 3300010375 Unclassified 2806
128 Ga0105246_10157779 3300011119 Bacteria 1725
129 Ga0105246_10157840 3300011119 Unclassified 1725
130 Ga0105246_10717079 3300011119 Bacteria 878
131 Ga0157373_10017711 3300013100 Bacteria 5187
132 Ga0157373_10572353 3300013100 Bacteria 821
133 Ga0157371_10643808 3300013102 Unclassified 791
134 Ga0157369_10580753 3300013105 Bacteria 1157
135 Ga0157374_10000263 3300013296 Bacteria 48612
136 Ga0157374_10032047 3300013296 Bacteria 4783
137 Ga0157374_10912942 3300013296 Bacteria 896
138 Ga0157378_10003436 3300013297 Bacteria 14052
139 Ga0157378_10026552 3300013297 Bacteria 5104
140 Ga0157378_10047245 3300013297 Bacteria 3826
141 Ga0157378_10249077 3300013297 Bacteria 1700
142 Ga0163162_10000190 3300013306 Bacteria 56892
143 Ga0163162_10000257 3300013306 Bacteria 48216
144 Ga0163162_10004838 3300013306 Bacteria 12998
145 Ga0163162_10012063 3300013306 Bacteria 8429
146 Ga0163162_10016844 3300013306 Bacteria 7144
147 Ga0163162_10021837 3300013306 Bacteria 6306
148 Ga0163162_10220141 3300013306 Bacteria 2028
149 Ga0157372_10150566 3300013307 Bacteria 2685
150 Ga0157372_10187635 3300013307 Unclassified 2394
151 Ga0157372_10226026 3300013307 Bacteria 2170
152 Ga0157372_10408092 3300013307 Bacteria 1583
153 Ga0157372_10448288 3300013307 Bacteria 1504
154 Ga0157372_10507721 3300013307 Bacteria 1406
155 Ga0157372_10607537 3300013307 Bacteria 1275
156 Ga0157372_10676862 3300013307 Unclassified 1201
157 Ga0157372_11525205 3300013307 Bacteria 770
158 Ga0157372_11634182 3300013307 Unclassified 742
159 Ga0157375_10001759 3300013308 Bacteria 18571
160 Ga0157375_10069909 3300013308 Bacteria 3518
161 Ga0157375_10862352 3300013308 Unclassified 1051
162 Ga0163163_10000316 3300014325 Bacteria 47024
163 Ga0157380_10041792 3300014326 Bacteria 3580
164 Ga0157377_10278666 3300014745 Bacteria 1095
165 Ga0157379_10002129 3300014968 Bacteria 16411
166 Ga0157379_10081253 3300014968 Bacteria 2903
167 Ga0157376_10000661 3300014969 Bacteria 22276
168 Ga0157376_10001835 3300014969 Bacteria 14153
169 Ga0157376_10012788 3300014969 Bacteria 6242
170 Ga0157376_10114192 3300014969 Bacteria 2382
171 Ga0157376_10349635 3300014969 Bacteria 1414
172 Ga0163161_10040694 3300017792 Bacteria 3338
173 Ga0163161_10133842 3300017792 Bacteria 1872
174 Ga0209646_1003045 3300025246 Bacteria 3436
175 Ga0207426_1000023 3300025302 Bacteria 545465
176 Ga0207697_10050988 3300025315 Bacteria 1709
177 Ga0207656_10000868 3300025321 Bacteria 9865
178 Ga0207642_10834199 3300025899 Unclassified 588
179 Ga0207710_10188963 3300025900 Unclassified 1013
180 Ga0207680_10000034 3300025903 Bacteria 74519
181 Ga0207680_10000623 3300025903 Bacteria 16679
182 Ga0207680_10226098 3300025903 Bacteria 1285
183 Ga0207647_10148174 3300025904 Bacteria 1373
184 Ga0207645_10006805 3300025907 Bacteria 8160
185 Ga0207705_10049046 3300025909 Bacteria 3039
186 Ga0207705_10077557 3300025909 Bacteria 2417
187 Ga0207705_10127712 3300025909 Bacteria 1890
188 Ga0207654_10248764 3300025911 Bacteria 1191
189 Ga0207654_10784516 3300025911 Unclassified 688
190 Ga0207695_10686351 3300025913 Bacteria 905
191 Ga0207671_10015578 3300025914 Bacteria 5946
192 Ga0207671_10572014 3300025914 Bacteria 901
193 Ga0207662_10006417 3300025918 Bacteria 6348
194 Ga0207652_10001696 3300025921 Bacteria 19285
195 Ga0207652_10139503 3300025921 Unclassified 2167
196 Ga0207681_10825687 3300025923 Bacteria 775
197 Ga0207650_10187628 3300025925 Bacteria 1651
198 Ga0207650_10202908 3300025925 Bacteria 1589
199 Ga0207650_10258696 3300025925 Bacteria 1411
200 Ga0207650_10889600 3300025925 Unclassified 756
201 Ga0207659_10445678 3300025926 Bacteria 1090
202 Ga0207687_10567180 3300025927 Bacteria 954
203 Ga0207644_10036344 3300025931 Bacteria 3457
204 Ga0207690_10027231 3300025932 Bacteria 3611
205 Ga0207706_10005522 3300025933 Bacteria 11791
206 Ga0207686_10093728 3300025934 Bacteria 1989
207 Ga0207670_10390119 3300025936 Bacteria 1111
208 Ga0207669_10422588 3300025937 Bacteria 1049
209 Ga0207704_10002571 3300025938 Bacteria 8184
210 Ga0207704_10417844 3300025938 Bacteria 1062
211 Ga0207704_11475261 3300025938 Unclassified 583
212 Ga0207691_10000115 3300025940 Bacteria 72014
213 Ga0207691_10105468 3300025940 Bacteria 2511
214 Ga0207691_10599482 3300025940 Bacteria 933
215 Ga0207689_10000835 3300025942 Bacteria 29733
216 Ga0207689_10030557 3300025942 Bacteria 4489
217 Ga0207689_10049414 3300025942 Bacteria 3469
218 Ga0207661_10031569 3300025944 Bacteria 4094
219 Ga0207679_10021060 3300025945 Bacteria 4411
220 Ga0207679_10726721 3300025945 Bacteria 902
221 Ga0207667_10049014 3300025949 Bacteria 4463
222 Ga0207667_10085392 3300025949 Bacteria 3268
223 Ga0207651_10029674 3300025960 Bacteria 3469
224 Ga0207651_10179337 3300025960 Unclassified 1679
225 Ga0207712_10002930 3300025961 Bacteria 10899
226 Ga0207712_10013320 3300025961 Bacteria 5273
227 Ga0207712_10187076 3300025961 Bacteria 1632
228 Ga0207668_10014419 3300025972 Bacteria 4891
229 Ga0207668_10424314 3300025972 Unclassified 1129
230 Ga0207640_10215422 3300025981 Bacteria 1466
231 Ga0207658_10007406 3300025986 Bacteria 7485
232 Ga0207677_10016085 3300026023 Bacteria 4421
233 Ga0207677_10102230 3300026023 Unclassified 2112
234 Ga0207677_10117427 3300026023 Unclassified 1994
235 Ga0207677_10296971 3300026023 Bacteria 1333
236 Ga0207703_10005435 3300026035 Bacteria 10253
237 Ga0207703_10006374 3300026035 Bacteria 9430
238 Ga0207639_10006922 3300026041 Bacteria 7724
239 Ga0207639_10021872 3300026041 Bacteria 4599
240 Ga0207639_10218223 3300026041 Bacteria 1646
241 Ga0207639_10811622 3300026041 Unclassified 872
242 Ga0207678_10196741 3300026067 Bacteria 1723
243 Ga0207641_10000082 3300026088 Bacteria 138385
244 Ga0207641_10008582 3300026088 Bacteria 8437
245 Ga0207641_11172793 3300026088 Bacteria 767
246 Ga0207641_11185602 3300026088 Bacteria 763
247 Ga0207648_10009342 3300026089 Bacteria 9396
248 Ga0207648_10175448 3300026089 Bacteria 1895
249 Ga0207676_10002210 3300026095 Bacteria 14039
250 Ga0207676_10074023 3300026095 Bacteria 2743
251 Ga0207676_10407496 3300026095 Bacteria 1272
252 Ga0207676_10444905 3300026095 Bacteria 1220
253 Ga0207674_10064514 3300026116 Bacteria 3694
254 Ga0207674_10093437 3300026116 Bacteria 2996
255 Ga0207674_10162745 3300026116 Bacteria 2186
256 Ga0207675_101376808 3300026118 Bacteria 726
257 Ga0207683_10082899 3300026121 Bacteria 2849
258 Ga0207683_10109587 3300026121 Bacteria 2471
259 Ga0207698_10072886 3300026142 Bacteria 2732
260 Ga0207698_10300716 3300026142 Bacteria 1493
261 Ga0207698_10776361 3300026142 Bacteria 959
262 Ga0207698_10811169 3300026142 Unclassified 938
263 Ga0268266_10247227 3300028379 Bacteria 1648
264 Ga0268264_10013213 3300028381 Bacteria 6795
265 Ga0268264_10041332 3300028381 Bacteria 3814
266 Ga0268264_10064360 3300028381 Bacteria 3086
267 Ga0268264_10192950 3300028381 Unclassified 1858
268 Ga0307515_10000091 3300028794 Bacteria 214014
269 Ga0265338_10163408 3300028800 Bacteria 1717
270 Ga0265332_10090003 3300031238 Bacteria 1298
271 Ga0265327_10000152 3300031251 Bacteria 149065
272 Ga0307513_10408274 3300031456 Bacteria 1091
273 Ga0307509_10123637 3300031507 Unclassified 2559
274 Ga0307508_10032628 3300031616 Bacteria 4704
275 Ga0307508_10309064 3300031616 Unclassified 1173
276 Ga0265314_10333498 3300031711 Bacteria 840
277 Ga0307413_11341145 3300031824 Bacteria 627
278 Ga0307507_10099198 3300033179 Bacteria 2448
279 Ga0307507_10423076 3300033179 Bacteria 747
280 Ga0373935_0254457 3300035692 Bacteria 1230
281 Ga0395899_0001701 3300037312 Bacteria 18337
282 Ga0395899_0022642 3300037312 Bacteria 4760
283 Ga0395900_0001238 3300037418 Bacteria 31389
284 Ga0395900_0045056 3300037418 Bacteria 4543
285 Ga0395898_0001199 3300037466 Bacteria 39218
286 Ga0395898_0355186 3300037466 Bacteria 1398
287 Ga0395905_0174739 3300037471 Bacteria 2017
288 Ga0395901_0021133 3300038443 Bacteria 6668
289 Ga0451845_0778692 3300041501 Bacteria 788
290 Ga0451847_0919454 3300041503 Unclassified 688
291 Ga0439449_0153548 3300042007 Bacteria 859
292 Ga0451577_0003576 3300042876 Bacteria 17122
293 Ga0451577_0415623 3300042876 Bacteria 1221
294 Ga0451577_0840480 3300042876 Bacteria 828
295 Ga0466969_0000238 3300044656 Bacteria 30098
296 Ga0466972_0010280 3300044658 Bacteria 4700
297 Ga0453683_0000069 3300044673 Bacteria 162908
298 Ga0466966_0000136 3300044684 Bacteria 47038
299 Ga0466964_0030938 3300044706 Unclassified 2121
300 Ga0453684_0014466 3300044712 Bacteria 12621
301 Ga0453684_0045020 3300044712 Bacteria 5892
302 Ga0453684_0069106 3300044712 Bacteria 4482
303 Ga0453684_0150689 3300044712 Bacteria 2764
304 Ga0453684_0173124 3300044712 Bacteria 2542
305 Ga0453684_0367617 3300044712 Bacteria 1618
306 Ga0466968_0089514 3300044735 Unclassified 1362
307 Ga0466957_0029800 3300044842 Bacteria 3256
308 Ga0466959_0000002 3300045049 Bacteria 362671
309 Ga0466959_0049931 3300045049 Unclassified 3073
310 Ga0451576_0000300 3300045051 Bacteria 119685
311 Ga0495629_0613380 3300046459 Unclassified 727
312 Ga0495625_0727099 3300046660 Unclassified 584
313 Ga0495635_0037514 3300046663 Bacteria 3355
314 Ga0495657_0686119 3300046675 Bacteria 589
315 Ga0495674_0192530 3300047319 Bacteria 1694
316 Ga0495672_0011784 3300047320 Bacteria 6143
317 Ga0496108_0258977 3300048911 Bacteria 1514
318 Ga0501031_0003432 3300049568 Bacteria 10166
319 Ga0501033_0804370 3300049570 Viruses 635
320 Ga0501034_0319550 3300049571 Unclassified 1486
321 Ga0501034_0515903 3300049571 Unclassified 1107
322 Ga0501036_0007222 3300049572 Bacteria 9047
323 Ga0501037_0009380 3300049573 Bacteria 7184
324 Ga0501038_0016633 3300049574 Bacteria 6667
325 Ga0501039_0072329 3300049575 Bacteria 2679
326 Ga0501043_0012748 3300049579 Bacteria 6571
327 Ga0501046_0024472 3300049580 Bacteria 4952
328 Ga0501047_0306328 3300049581 Unclassified 1430
329 Ga0501035_0136838 3300049822 Bacteria 2132
330 Ga0501044_0020153 3300049823 Bacteria 7117
331 nmdc:mga05p37_1503_c1 3300050507 Bacteria 27101
332 Ga0500578_0283159 3300053086 Bacteria 988
333 Ga0500583_0002199 3300053092 Bacteria 5793
334 Ga0500651_0252595 3300053093 Unclassified 1025
335 Ga0500641_0009429 3300053096 Bacteria 3512
336 Ga0500652_024549 3300053131 Bacteria 2302
337 Ga0500588_0022673 3300053146 Bacteria 1713
338 Ga0500589_011097 3300053147 Bacteria 3885
339 Ga0500622_0017284 3300053156 Bacteria 3839
340 Ga0500622_0186045 3300053156 Bacteria 956
341 Ga0500636_0172458 3300053177 Bacteria 1169
342 Ga0500587_038590 3300053739 Unclassified 678
343 Ga0501082_0810771 3300060353 Unclassified 819
344 Ga0466962_0295636 3300061719 Bacteria 801

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_11634182 Ga0157372_116341821 148
2 3300025925 Ga0207650_10258696 Ga0207650_102586962 154
3 3300044658 Ga0466972_0010280 Ga0466972_0010280_2244_2729 154
4 3300009147 Ga0114129_10001869 Ga0114129_1000186911 155
5 3300050507 nmdc:mga05p37_1503_c1 nmdc:mga05p37_1503_c1_12037_12522 155
6 3300005339 Ga0070660_101306003 Ga0070660_1013060031 158
7 3300005345 Ga0070692_10033510 Ga0070692_100335103 158
8 3300005366 Ga0070659_100010660 Ga0070659_1000106605 158
9 3300005530 Ga0070679_100017007 Ga0070679_1000170072 158
10 3300005834 Ga0068851_10041419 Ga0068851_100414192 158
11 3300013100 Ga0157373_10017711 Ga0157373_100177114 158
12 3300013307 Ga0157372_10408092 Ga0157372_104080922 158
13 3300025909 Ga0207705_10077557 Ga0207705_100775572 158
14 3300025921 Ga0207652_10001696 Ga0207652_1000169618 158
15 3300025932 Ga0207690_10027231 Ga0207690_100272312 158
16 3300026116 Ga0207674_10064514 Ga0207674_100645142 158
17 3300037312 Ga0395899_0001701 Ga0395899_0001701_5377_5859 158
18 3300037312 Ga0395899_0022642 Ga0395899_0022642_4206_4688 158
19 3300037418 Ga0395900_0001238 Ga0395900_0001238_21874_22356 158
20 3300037418 Ga0395900_0045056 Ga0395900_0045056_2075_2557 158
21 3300037466 Ga0395898_0001199 Ga0395898_0001199_33139_33621 158
22 3300038443 Ga0395901_0021133 Ga0395901_0021133_5597_6079 158
23 3300005841 Ga0068863_101133013 Ga0068863_1011330132 160
24 3300005843 Ga0068860_100036822 Ga0068860_1000368222 160
25 3300009553 Ga0105249_10795313 Ga0105249_107953132 160
26 3300013306 Ga0163162_10021837 Ga0163162_100218372 160
27 3300025981 Ga0207640_10215422 Ga0207640_102154222 160
28 3300026088 Ga0207641_11172793 Ga0207641_111727932 160
29 3300028381 Ga0268264_10064360 Ga0268264_100643603 160
30 3300035692 Ga0373935_0254457 Ga0373935_0254457_315_797 160
31 3300042876 Ga0451577_0003576 Ga0451577_0003576_1768_2250 160
32 3300044673 Ga0453683_0000069 Ga0453683_0000069_97224_97706 160
33 3300044712 Ga0453684_0150689 Ga0453684_0150689_2200_2682 160
34 3300044712 Ga0453684_0173124 Ga0453684_0173124_251_733 160
35 3300044712 Ga0453684_0367617 Ga0453684_0367617_1121_1603 160
36 3300045051 Ga0451576_0000300 Ga0451576_0000300_58451_58933 160
37 3300003320 rootH2_10003679 rootH2_1000367912 161
38 3300003323 rootH1_10088937 rootH1_100889372 161
39 3300005327 Ga0070658_10000903 Ga0070658_100009035 161
40 3300005328 Ga0070676_10005739 Ga0070676_100057392 161
41 3300005329 Ga0070683_100132348 Ga0070683_1001323483 161
42 3300005330 Ga0070690_100286213 Ga0070690_1002862132 161
43 3300005330 Ga0070690_100444430 Ga0070690_1004444301 161
44 3300005331 Ga0070670_100250449 Ga0070670_1002504492 161
45 3300005331 Ga0070670_100424548 Ga0070670_1004245482 161
46 3300005331 Ga0070670_100684616 Ga0070670_1006846161 161
47 3300005334 Ga0068869_100131352 Ga0068869_1001313522 161
48 3300005334 Ga0068869_100250365 Ga0068869_1002503651 161
49 3300005334 Ga0068869_100262362 Ga0068869_1002623622 161
50 3300005335 Ga0070666_10000074 Ga0070666_1000007453 161
51 3300005335 Ga0070666_10100142 Ga0070666_101001423 161
52 3300005335 Ga0070666_10160074 Ga0070666_101600742 161
53 3300005338 Ga0068868_100002331 Ga0068868_1000023312 161
54 3300005338 Ga0068868_100006670 Ga0068868_1000066704 161
55 3300005339 Ga0070660_100948121 Ga0070660_1009481211 161
56 3300005343 Ga0070687_100140784 Ga0070687_1001407842 161
57 3300005344 Ga0070661_100482245 Ga0070661_1004822452 161
58 3300005347 Ga0070668_100000022 Ga0070668_10000002277 161
59 3300005347 Ga0070668_100609690 Ga0070668_1006096901 161
60 3300005353 Ga0070669_100321318 Ga0070669_1003213182 161
61 3300005354 Ga0070675_100129754 Ga0070675_1001297543 161
62 3300005355 Ga0070671_100023062 Ga0070671_1000230623 161
63 3300005355 Ga0070671_100032781 Ga0070671_1000327819 161
64 3300005355 Ga0070671_100199620 Ga0070671_1001996201 161
65 3300005364 Ga0070673_100034889 Ga0070673_1000348892 161
66 3300005364 Ga0070673_100183360 Ga0070673_1001833602 161
67 3300005364 Ga0070673_100396389 Ga0070673_1003963891 161
68 3300005365 Ga0070688_100075848 Ga0070688_1000758483 161
69 3300005365 Ga0070688_101052524 Ga0070688_1010525241 161
70 3300005367 Ga0070667_100001525 Ga0070667_1000015259 161
71 3300005367 Ga0070667_100011346 Ga0070667_1000113466 161
72 3300005367 Ga0070667_100024194 Ga0070667_1000241948 161
73 3300005367 Ga0070667_100886090 Ga0070667_1008860902 161
74 3300005367 Ga0070667_101550433 Ga0070667_1015504331 161
75 3300005455 Ga0070663_100769896 Ga0070663_1007698962 161
76 3300005457 Ga0070662_100013892 Ga0070662_1000138922 161
77 3300005457 Ga0070662_101383667 Ga0070662_1013836671 161
78 3300005458 Ga0070681_10199176 Ga0070681_101991762 161
79 3300005459 Ga0068867_100017526 Ga0068867_1000175265 161
80 3300005466 Ga0070685_10756951 Ga0070685_107569511 161
81 3300005535 Ga0070684_100056698 Ga0070684_1000566982 161
82 3300005539 Ga0068853_100006544 Ga0068853_1000065448 161
83 3300005539 Ga0068853_100082720 Ga0068853_1000827203 161
84 3300005539 Ga0068853_100284103 Ga0068853_1002841032 161
85 3300005539 Ga0068853_100883521 Ga0068853_1008835211 161
86 3300005543 Ga0070672_100000021 Ga0070672_10000002116 161
87 3300005543 Ga0070672_100121006 Ga0070672_1001210062 161
88 3300005543 Ga0070672_100637591 Ga0070672_1006375911 161
89 3300005548 Ga0070665_100011401 Ga0070665_1000114016 161
90 3300005563 Ga0068855_100015722 Ga0068855_1000157228 161
91 3300005563 Ga0068855_100041406 Ga0068855_1000414064 161
92 3300005564 Ga0070664_100016326 Ga0070664_1000163261 161
93 3300005564 Ga0070664_100571937 Ga0070664_1005719372 161
94 3300005577 Ga0068857_100028459 Ga0068857_1000284594 161
95 3300005577 Ga0068857_100281384 Ga0068857_1002813842 161
96 3300005614 Ga0068856_100032809 Ga0068856_1000328097 161
97 3300005616 Ga0068852_100045226 Ga0068852_1000452264 161
98 3300005617 Ga0068859_100000064 Ga0068859_10000006496 161
99 3300005617 Ga0068859_100050734 Ga0068859_1000507344 161
100 3300005617 Ga0068859_100407708 Ga0068859_1004077081 161
101 3300005617 Ga0068859_100972282 Ga0068859_1009722821 161
102 3300005618 Ga0068864_100001140 Ga0068864_1000011402 161
103 3300005618 Ga0068864_100003479 Ga0068864_1000034799 161
104 3300005618 Ga0068864_100297207 Ga0068864_1002972072 161
105 3300005718 Ga0068866_10141760 Ga0068866_101417601 161
106 3300005834 Ga0068851_10001028 Ga0068851_1000102810 161
107 3300005841 Ga0068863_100000216 Ga0068863_1000002162 161
108 3300005841 Ga0068863_100024789 Ga0068863_1000247893 161
109 3300005841 Ga0068863_100128266 Ga0068863_1001282663 161
110 3300005841 Ga0068863_100310013 Ga0068863_1003100132 161
111 3300005842 Ga0068858_100002789 Ga0068858_1000027899 161
112 3300005842 Ga0068858_100042993 Ga0068858_1000429932 161
113 3300005842 Ga0068858_100396728 Ga0068858_1003967282 161
114 3300005842 Ga0068858_100733474 Ga0068858_1007334742 161
115 3300005843 Ga0068860_100011746 Ga0068860_1000117469 161
116 3300005843 Ga0068860_100012918 Ga0068860_1000129183 161
117 3300005843 Ga0068860_100013810 Ga0068860_1000138104 161
118 3300006175 Ga0070712_100725775 Ga0070712_1007257751 161
119 3300006237 Ga0097621_100004653 Ga0097621_1000046536 161
120 3300006358 Ga0068871_100004694 Ga0068871_1000046945 161
121 3300006358 Ga0068871_100016795 Ga0068871_1000167957 161
122 3300006358 Ga0068871_100289580 Ga0068871_1002895801 161
123 3300006358 Ga0068871_100316739 Ga0068871_1003167392 161
124 3300006358 Ga0068871_101186942 Ga0068871_1011869422 161
125 3300006881 Ga0068865_100005377 Ga0068865_1000053774 161
126 3300006881 Ga0068865_100382706 Ga0068865_1003827061 161
127 3300006931 Ga0097620_100000064 Ga0097620_10000006496 161
128 3300006931 Ga0097620_100050731 Ga0097620_1000507316 161
129 3300006931 Ga0097620_100407697 Ga0097620_1004076971 161
130 3300006931 Ga0097620_100972392 Ga0097620_1009723921 161
131 3300009093 Ga0105240_10104586 Ga0105240_101045863 161
132 3300009093 Ga0105240_10440742 Ga0105240_104407422 161
133 3300009094 Ga0111539_10309330 Ga0111539_103093302 161
134 3300009098 Ga0105245_10147359 Ga0105245_101473593 161
135 3300009098 Ga0105245_10648067 Ga0105245_106480673 161
136 3300009101 Ga0105247_10028400 Ga0105247_100284002 161
137 3300009148 Ga0105243_10198857 Ga0105243_101988572 161
138 3300009174 Ga0105241_10001283 Ga0105241_100012831 161
139 3300009174 Ga0105241_10163765 Ga0105241_101637652 161
140 3300009174 Ga0105241_10194207 Ga0105241_101942071 161
141 3300009174 Ga0105241_10457470 Ga0105241_104574702 161
142 3300009174 Ga0105241_10999352 Ga0105241_109993522 161
143 3300009176 Ga0105242_10026095 Ga0105242_100260956 161
144 3300009176 Ga0105242_10154527 Ga0105242_101545272 161
145 3300009176 Ga0105242_11034584 Ga0105242_110345841 161
146 3300009176 Ga0105242_11308061 Ga0105242_113080612 161
147 3300009177 Ga0105248_11444540 Ga0105248_114445401 161
148 3300009545 Ga0105237_10032136 Ga0105237_100321362 161
149 3300009545 Ga0105237_10305390 Ga0105237_103053903 161
150 3300009545 Ga0105237_10513011 Ga0105237_105130112 161
151 3300009553 Ga0105249_10011147 Ga0105249_100111474 161
152 3300009553 Ga0105249_10023823 Ga0105249_100238234 161
153 3300010375 Ga0105239_10000785 Ga0105239_1000078513 161
154 3300010375 Ga0105239_10129512 Ga0105239_101295124 161
155 3300011119 Ga0105246_10157779 Ga0105246_101577793 161
156 3300011119 Ga0105246_10157840 Ga0105246_101578403 161
157 3300011119 Ga0105246_10717079 Ga0105246_107170791 161
158 3300013100 Ga0157373_10572353 Ga0157373_105723532 161
159 3300013102 Ga0157371_10643808 Ga0157371_106438082 161
160 3300013105 Ga0157369_10580753 Ga0157369_105807531 161
161 3300013296 Ga0157374_10000263 Ga0157374_1000026325 161
162 3300013296 Ga0157374_10032047 Ga0157374_100320476 161
163 3300013296 Ga0157374_10912942 Ga0157374_109129421 161
164 3300013297 Ga0157378_10003436 Ga0157378_100034368 161
165 3300013297 Ga0157378_10026552 Ga0157378_100265523 161
166 3300013297 Ga0157378_10047245 Ga0157378_100472452 161
167 3300013297 Ga0157378_10249077 Ga0157378_102490772 161
168 3300013306 Ga0163162_10000190 Ga0163162_1000019012 161
169 3300013306 Ga0163162_10000257 Ga0163162_1000025718 161
170 3300013306 Ga0163162_10004838 Ga0163162_100048388 161
171 3300013306 Ga0163162_10012063 Ga0163162_100120638 161
172 3300013306 Ga0163162_10016844 Ga0163162_100168443 161
173 3300013306 Ga0163162_10220141 Ga0163162_102201413 161
174 3300013307 Ga0157372_10150566 Ga0157372_101505663 161
175 3300013307 Ga0157372_10187635 Ga0157372_101876352 161
176 3300013307 Ga0157372_10226026 Ga0157372_102260263 161
177 3300013307 Ga0157372_10448288 Ga0157372_104482882 161
178 3300013307 Ga0157372_10507721 Ga0157372_105077212 161
179 3300013307 Ga0157372_10607537 Ga0157372_106075372 161
180 3300013307 Ga0157372_10676862 Ga0157372_106768622 161
181 3300013307 Ga0157372_11525205 Ga0157372_115252051 161
182 3300013308 Ga0157375_10001759 Ga0157375_100017596 161
183 3300013308 Ga0157375_10069909 Ga0157375_100699092 161
184 3300013308 Ga0157375_10862352 Ga0157375_108623523 161
185 3300014325 Ga0163163_10000316 Ga0163163_100003169 161
186 3300014326 Ga0157380_10041792 Ga0157380_100417924 161
187 3300014745 Ga0157377_10278666 Ga0157377_102786662 161
188 3300014968 Ga0157379_10002129 Ga0157379_1000212913 161
189 3300014968 Ga0157379_10081253 Ga0157379_100812532 161
190 3300014969 Ga0157376_10000661 Ga0157376_1000066116 161
191 3300014969 Ga0157376_10001835 Ga0157376_1000183512 161
192 3300014969 Ga0157376_10012788 Ga0157376_100127886 161
193 3300014969 Ga0157376_10114192 Ga0157376_101141923 161
194 3300014969 Ga0157376_10349635 Ga0157376_103496352 161
195 3300017792 Ga0163161_10040694 Ga0163161_100406944 161
196 3300017792 Ga0163161_10133842 Ga0163161_101338422 161
197 3300025246 Ga0209646_1003045 Ga0209646_10030455 161
198 3300025302 Ga0207426_1000023 Ga0207426_1000023342 161
199 3300025315 Ga0207697_10050988 Ga0207697_100509881 161
200 3300025321 Ga0207656_10000868 Ga0207656_100008689 161
201 3300025899 Ga0207642_10834199 Ga0207642_108341991 161
202 3300025900 Ga0207710_10188963 Ga0207710_101889631 161
203 3300025903 Ga0207680_10000034 Ga0207680_1000003447 161
204 3300025903 Ga0207680_10000623 Ga0207680_100006232 161
205 3300025903 Ga0207680_10226098 Ga0207680_102260982 161
206 3300025904 Ga0207647_10148174 Ga0207647_101481742 161
207 3300025907 Ga0207645_10006805 Ga0207645_100068056 161
208 3300025909 Ga0207705_10049046 Ga0207705_100490464 161
209 3300025909 Ga0207705_10127712 Ga0207705_101277123 161
210 3300025911 Ga0207654_10248764 Ga0207654_102487641 161
211 3300025911 Ga0207654_10784516 Ga0207654_107845161 161
212 3300025913 Ga0207695_10686351 Ga0207695_106863512 161
213 3300025914 Ga0207671_10015578 Ga0207671_100155781 161
214 3300025914 Ga0207671_10572014 Ga0207671_105720141 161
215 3300025918 Ga0207662_10006417 Ga0207662_100064174 161
216 3300025921 Ga0207652_10139503 Ga0207652_101395032 161
217 3300025923 Ga0207681_10825687 Ga0207681_108256871 161
218 3300025925 Ga0207650_10187628 Ga0207650_101876282 161
219 3300025925 Ga0207650_10202908 Ga0207650_102029082 161
220 3300025925 Ga0207650_10889600 Ga0207650_108896002 161
221 3300025926 Ga0207659_10445678 Ga0207659_104456782 161
222 3300025927 Ga0207687_10567180 Ga0207687_105671802 161
223 3300025931 Ga0207644_10036344 Ga0207644_100363442 161
224 3300025933 Ga0207706_10005522 Ga0207706_100055224 161
225 3300025934 Ga0207686_10093728 Ga0207686_100937283 161
226 3300025936 Ga0207670_10390119 Ga0207670_103901191 161
227 3300025937 Ga0207669_10422588 Ga0207669_104225882 161
228 3300025938 Ga0207704_10002571 Ga0207704_100025714 161
229 3300025938 Ga0207704_10417844 Ga0207704_104178441 161
230 3300025938 Ga0207704_11475261 Ga0207704_114752611 161
231 3300025940 Ga0207691_10000115 Ga0207691_1000011518 161
232 3300025940 Ga0207691_10105468 Ga0207691_101054682 161
233 3300025940 Ga0207691_10599482 Ga0207691_105994821 161
234 3300025942 Ga0207689_10000835 Ga0207689_100008359 161
235 3300025942 Ga0207689_10030557 Ga0207689_100305572 161
236 3300025942 Ga0207689_10049414 Ga0207689_100494142 161
237 3300025944 Ga0207661_10031569 Ga0207661_100315693 161
238 3300025945 Ga0207679_10021060 Ga0207679_100210602 161
239 3300025945 Ga0207679_10726721 Ga0207679_107267212 161
240 3300025949 Ga0207667_10049014 Ga0207667_100490141 161
241 3300025949 Ga0207667_10085392 Ga0207667_100853924 161
242 3300025960 Ga0207651_10029674 Ga0207651_100296742 161
243 3300025960 Ga0207651_10179337 Ga0207651_101793372 161
244 3300025961 Ga0207712_10002930 Ga0207712_100029307 161
245 3300025961 Ga0207712_10013320 Ga0207712_100133202 161
246 3300025961 Ga0207712_10187076 Ga0207712_101870762 161
247 3300025972 Ga0207668_10014419 Ga0207668_100144193 161
248 3300025972 Ga0207668_10424314 Ga0207668_104243142 161
249 3300025986 Ga0207658_10007406 Ga0207658_100074064 161
250 3300026023 Ga0207677_10016085 Ga0207677_100160852 161
251 3300026023 Ga0207677_10102230 Ga0207677_101022302 161
252 3300026023 Ga0207677_10117427 Ga0207677_101174271 161
253 3300026023 Ga0207677_10296971 Ga0207677_102969711 161
254 3300026035 Ga0207703_10005435 Ga0207703_100054358 161
255 3300026035 Ga0207703_10006374 Ga0207703_100063745 161
256 3300026041 Ga0207639_10006922 Ga0207639_100069223 161
257 3300026041 Ga0207639_10021872 Ga0207639_100218725 161
258 3300026041 Ga0207639_10218223 Ga0207639_102182233 161
259 3300026041 Ga0207639_10811622 Ga0207639_108116222 161
260 3300026067 Ga0207678_10196741 Ga0207678_101967414 161
261 3300026088 Ga0207641_10000082 Ga0207641_1000008214 161
262 3300026088 Ga0207641_10008582 Ga0207641_100085827 161
263 3300026088 Ga0207641_11185602 Ga0207641_111856021 161
264 3300026089 Ga0207648_10009342 Ga0207648_100093426 161
265 3300026089 Ga0207648_10175448 Ga0207648_101754483 161
266 3300026095 Ga0207676_10002210 Ga0207676_1000221013 161
267 3300026095 Ga0207676_10074023 Ga0207676_100740232 161
268 3300026095 Ga0207676_10407496 Ga0207676_104074962 161
269 3300026095 Ga0207676_10444905 Ga0207676_104449053 161
270 3300026116 Ga0207674_10093437 Ga0207674_100934374 161
271 3300026116 Ga0207674_10162745 Ga0207674_101627452 161
272 3300026118 Ga0207675_101376808 Ga0207675_1013768081 161
273 3300026121 Ga0207683_10082899 Ga0207683_100828993 161
274 3300026121 Ga0207683_10109587 Ga0207683_101095871 161
275 3300026142 Ga0207698_10072886 Ga0207698_100728865 161
276 3300026142 Ga0207698_10300716 Ga0207698_103007162 161
277 3300026142 Ga0207698_10776361 Ga0207698_107763612 161
278 3300026142 Ga0207698_10811169 Ga0207698_108111692 161
279 3300028379 Ga0268266_10247227 Ga0268266_102472272 161
280 3300028381 Ga0268264_10013213 Ga0268264_100132132 161
281 3300028381 Ga0268264_10041332 Ga0268264_100413322 161
282 3300028381 Ga0268264_10192950 Ga0268264_101929501 161
283 3300028794 Ga0307515_10000091 Ga0307515_1000009173 161
284 3300028800 Ga0265338_10163408 Ga0265338_101634082 161
285 3300031238 Ga0265332_10090003 Ga0265332_100900032 161
286 3300031251 Ga0265327_10000152 Ga0265327_1000015287 161
287 3300031456 Ga0307513_10408274 Ga0307513_104082741 161
288 3300031507 Ga0307509_10123637 Ga0307509_101236372 161
289 3300031616 Ga0307508_10032628 Ga0307508_100326283 161
290 3300031616 Ga0307508_10309064 Ga0307508_103090641 161
291 3300031711 Ga0265314_10333498 Ga0265314_103334982 161
292 3300031824 Ga0307413_11341145 Ga0307413_113411451 161
293 3300033179 Ga0307507_10099198 Ga0307507_100991983 161
294 3300033179 Ga0307507_10423076 Ga0307507_104230761 161
295 3300037466 Ga0395898_0355186 Ga0395898_0355186_696_1202 161
296 3300037471 Ga0395905_0174739 Ga0395905_0174739_158_646 161
297 3300041501 Ga0451845_0778692 Ga0451845_0778692_154_657 161
298 3300041503 Ga0451847_0919454 Ga0451847_0919454_57_542 161
299 3300042007 Ga0439449_0153548 Ga0439449_0153548_313_801 161
300 3300042876 Ga0451577_0415623 Ga0451577_0415623_91_591 161
301 3300042876 Ga0451577_0840480 Ga0451577_0840480_310_804 161
302 3300044656 Ga0466969_0000238 Ga0466969_0000238_11576_12067 161
303 3300044684 Ga0466966_0000136 Ga0466966_0000136_18564_19055 161
304 3300044706 Ga0466964_0030938 Ga0466964_0030938_1334_1825 161
305 3300044712 Ga0453684_0014466 Ga0453684_0014466_4741_5235 161
306 3300044712 Ga0453684_0045020 Ga0453684_0045020_1662_2171 161
307 3300044712 Ga0453684_0069106 Ga0453684_0069106_3152_3646 161
308 3300044735 Ga0466968_0089514 Ga0466968_0089514_735_1226 161
309 3300044842 Ga0466957_0029800 Ga0466957_0029800_454_942 161
310 3300045049 Ga0466959_0000002 Ga0466959_0000002_274058_274549 161
311 3300045049 Ga0466959_0049931 Ga0466959_0049931_557_1096 161
312 3300046459 Ga0495629_0613380 Ga0495629_0613380_191_676 161
313 3300046660 Ga0495625_0727099 Ga0495625_0727099_70_561 161
314 3300046663 Ga0495635_0037514 Ga0495635_0037514_2728_3213 161
315 3300046675 Ga0495657_0686119 Ga0495657_0686119_42_530 161
316 3300047319 Ga0495674_0192530 Ga0495674_0192530_172_657 161
317 3300047320 Ga0495672_0011784 Ga0495672_0011784_4628_5113 161
318 3300048911 Ga0496108_0258977 Ga0496108_0258977_567_1052 161
319 3300049568 Ga0501031_0003432 Ga0501031_0003432_2030_2518 161
320 3300049570 Ga0501033_0804370 Ga0501033_0804370_85_570 161
321 3300049571 Ga0501034_0319550 Ga0501034_0319550_474_959 161
322 3300049571 Ga0501034_0515903 Ga0501034_0515903_421_909 161
323 3300049572 Ga0501036_0007222 Ga0501036_0007222_8500_8988 161
324 3300049573 Ga0501037_0009380 Ga0501037_0009380_3477_3965 161
325 3300049574 Ga0501038_0016633 Ga0501038_0016633_2097_2585 161
326 3300049575 Ga0501039_0072329 Ga0501039_0072329_1323_1811 161
327 3300049579 Ga0501043_0012748 Ga0501043_0012748_461_949 161
328 3300049580 Ga0501046_0024472 Ga0501046_0024472_158_646 161
329 3300049581 Ga0501047_0306328 Ga0501047_0306328_448_936 161
330 3300049822 Ga0501035_0136838 Ga0501035_0136838_1377_1865 161
331 3300049823 Ga0501044_0020153 Ga0501044_0020153_6234_6722 161
332 3300053086 Ga0500578_0283159 Ga0500578_0283159_271_762 161
333 3300053092 Ga0500583_0002199 Ga0500583_0002199_4051_4536 161
334 3300053093 Ga0500651_0252595 Ga0500651_0252595_386_877 161
335 3300053096 Ga0500641_0009429 Ga0500641_0009429_1872_2408 161
336 3300053131 Ga0500652_024549 Ga0500652_024549_675_1160 161
337 3300053146 Ga0500588_0022673 Ga0500588_0022673_756_1256 161
338 3300053147 Ga0500589_011097 Ga0500589_011097_3258_3749 161
339 3300053156 Ga0500622_0017284 Ga0500622_0017284_515_1000 161
340 3300053156 Ga0500622_0186045 Ga0500622_0186045_168_653 161
341 3300053177 Ga0500636_0172458 Ga0500636_0172458_534_1025 161
342 3300053739 Ga0500587_038590 Ga0500587_038590_115_600 161
343 3300060353 Ga0501082_0810771 Ga0501082_0810771_284_772 161
344 3300061719 Ga0466962_0295636 Ga0466962_0295636_45_536 161
345 iso_pu_bacteria 2818991444 2819588649 161

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

142

0.87

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

3

143

0.78

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

144

0.77

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

29

158

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.8883 3 160
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.8825 3 160
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.8726 3 160
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.8669 3 160
4zbp-assembly1.cif.gz_B crystal structure of the ampcpr-bound atnudt7 0.8595 101 160
ID Description Score Start End Superfamily
af_P39337_13_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9555 9 145 3.40.630.30
af_P39337_13_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9357 9 145 3.40.630.30
af_Q94AC8_62_254_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8937 64 144 3.40.630.30
af_Q54IG0_5_154_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8776 1 153 3.40.630.30
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8745 3 160 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2R7KL63-F1-model_v4 GNAT family N-acetyltransferase 0.9884 3 141 GO:0016747
AF-A0A3L9Z7J4-F1-model_v4 deleted 0.9879 2 161
AF-A0A1P8E632-F1-model_v4 deleted 0.9876 3 160
AF-A0A369PUW8-F1-model_v4 GNAT family N-acetyltransferase 0.9862 3 161 GO:0016747
AF-A0A4R5MLX3-F1-model_v4 GNAT family N-acetyltransferase 0.9853 3 161 GO:0008080

Feature Viewer

pLDDT pTM Quality
93.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map