F416358
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 345 | 188 | 344 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10999352|Ga0105241_109993522 |
| Length | 166 |
| Sequence | MPDIEIRTIREEDNPSIATIIRNTLAEFGANKPGTVYFDPTTDNLYDLFAKKGSRYHVAFVDIDGERQMAGGAGIYPTEGLPKDTAELVKMYLSPAARGIGLGKELIARSLEFAKEAGYKKVYLETMPELSKAVSVYEKFGFRYLDGPMGNTGHFGCHIWMLKDPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 133 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 144 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 145 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 146 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 152 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 153 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 154 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 155 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 178 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 179 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 180 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 181 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 182 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 183 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 184 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 185 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 187 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.48 |
| Nodule | 0 |
| Rhizoplane | 0.29 |
| Rhizosphere | 92.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10003679 | 3300003320 | Bacteria | 27278 |
| 2 | rootH1_10088937 | 3300003323 | Bacteria | 1992 |
| 3 | Ga0070658_10000903 | 3300005327 | Bacteria | 25434 |
| 4 | Ga0070676_10005739 | 3300005328 | Bacteria | 6616 |
| 5 | Ga0070683_100132348 | 3300005329 | Bacteria | 2360 |
| 6 | Ga0070690_100286213 | 3300005330 | Bacteria | 1177 |
| 7 | Ga0070690_100444430 | 3300005330 | Bacteria | 960 |
| 8 | Ga0070670_100250449 | 3300005331 | Bacteria | 1543 |
| 9 | Ga0070670_100424548 | 3300005331 | Bacteria | 1175 |
| 10 | Ga0070670_100684616 | 3300005331 | Unclassified | 921 |
| 11 | Ga0068869_100131352 | 3300005334 | Bacteria | 1925 |
| 12 | Ga0068869_100250365 | 3300005334 | Bacteria | 1415 |
| 13 | Ga0068869_100262362 | 3300005334 | Bacteria | 1383 |
| 14 | Ga0070666_10000074 | 3300005335 | Bacteria | 72739 |
| 15 | Ga0070666_10100142 | 3300005335 | Bacteria | 1996 |
| 16 | Ga0070666_10160074 | 3300005335 | Bacteria | 1573 |
| 17 | Ga0068868_100002331 | 3300005338 | Bacteria | 13134 |
| 18 | Ga0068868_100006670 | 3300005338 | Bacteria | 8192 |
| 19 | Ga0070660_100948121 | 3300005339 | Unclassified | 726 |
| 20 | Ga0070660_101306003 | 3300005339 | Bacteria | 616 |
| 21 | Ga0070687_100140784 | 3300005343 | Unclassified | 1405 |
| 22 | Ga0070661_100482245 | 3300005344 | Bacteria | 990 |
| 23 | Ga0070692_10033510 | 3300005345 | Bacteria | 2588 |
| 24 | Ga0070668_100000022 | 3300005347 | Bacteria | 96336 |
| 25 | Ga0070668_100609690 | 3300005347 | Bacteria | 956 |
| 26 | Ga0070669_100321318 | 3300005353 | Bacteria | 1250 |
| 27 | Ga0070675_100129754 | 3300005354 | Bacteria | 2147 |
| 28 | Ga0070671_100023062 | 3300005355 | Bacteria | 5087 |
| 29 | Ga0070671_100032781 | 3300005355 | Bacteria | 4293 |
| 30 | Ga0070671_100199620 | 3300005355 | Unclassified | 1696 |
| 31 | Ga0070673_100034889 | 3300005364 | Bacteria | 3811 |
| 32 | Ga0070673_100183360 | 3300005364 | Bacteria | 1793 |
| 33 | Ga0070673_100396389 | 3300005364 | Bacteria | 1233 |
| 34 | Ga0070688_100075848 | 3300005365 | Bacteria | 2162 |
| 35 | Ga0070688_101052524 | 3300005365 | Bacteria | 649 |
| 36 | Ga0070659_100010660 | 3300005366 | Bacteria | 6769 |
| 37 | Ga0070667_100001525 | 3300005367 | Bacteria | 20730 |
| 38 | Ga0070667_100011346 | 3300005367 | Bacteria | 7367 |
| 39 | Ga0070667_100024194 | 3300005367 | Bacteria | 5044 |
| 40 | Ga0070667_100886090 | 3300005367 | Bacteria | 830 |
| 41 | Ga0070667_101550433 | 3300005367 | Unclassified | 622 |
| 42 | Ga0070663_100769896 | 3300005455 | Bacteria | 823 |
| 43 | Ga0070662_100013892 | 3300005457 | Bacteria | 5364 |
| 44 | Ga0070662_101383667 | 3300005457 | Bacteria | 606 |
| 45 | Ga0070681_10199176 | 3300005458 | Unclassified | 1921 |
| 46 | Ga0068867_100017526 | 3300005459 | Bacteria | 5087 |
| 47 | Ga0070685_10756951 | 3300005466 | Unclassified | 713 |
| 48 | Ga0070679_100017007 | 3300005530 | Bacteria | 7030 |
| 49 | Ga0070684_100056698 | 3300005535 | Bacteria | 3420 |
| 50 | Ga0068853_100006544 | 3300005539 | Bacteria | 9276 |
| 51 | Ga0068853_100082720 | 3300005539 | Bacteria | 2812 |
| 52 | Ga0068853_100284103 | 3300005539 | Bacteria | 1526 |
| 53 | Ga0068853_100883521 | 3300005539 | Unclassified | 858 |
| 54 | Ga0070672_100000021 | 3300005543 | Bacteria | 69249 |
| 55 | Ga0070672_100121006 | 3300005543 | Bacteria | 2142 |
| 56 | Ga0070672_100637591 | 3300005543 | Bacteria | 930 |
| 57 | Ga0070665_100011401 | 3300005548 | Bacteria | 8986 |
| 58 | Ga0068855_100015722 | 3300005563 | Bacteria | 9103 |
| 59 | Ga0068855_100041406 | 3300005563 | Bacteria | 5460 |
| 60 | Ga0070664_100016326 | 3300005564 | Bacteria | 6087 |
| 61 | Ga0070664_100571937 | 3300005564 | Bacteria | 1046 |
| 62 | Ga0068857_100028459 | 3300005577 | Bacteria | 4932 |
| 63 | Ga0068857_100281384 | 3300005577 | Unclassified | 1530 |
| 64 | Ga0068856_100032809 | 3300005614 | Bacteria | 5085 |
| 65 | Ga0068852_100045226 | 3300005616 | Unclassified | 3744 |
| 66 | Ga0068859_100000064 | 3300005617 | Bacteria | 104971 |
| 67 | Ga0068859_100050734 | 3300005617 | Bacteria | 4168 |
| 68 | Ga0068859_100407708 | 3300005617 | Bacteria | 1455 |
| 69 | Ga0068859_100972282 | 3300005617 | Unclassified | 932 |
| 70 | Ga0068864_100001140 | 3300005618 | Bacteria | 22143 |
| 71 | Ga0068864_100003479 | 3300005618 | Bacteria | 13008 |
| 72 | Ga0068864_100297207 | 3300005618 | Unclassified | 1511 |
| 73 | Ga0068866_10141760 | 3300005718 | Bacteria | 1380 |
| 74 | Ga0068851_10001028 | 3300005834 | Bacteria | 12107 |
| 75 | Ga0068851_10041419 | 3300005834 | Bacteria | 2315 |
| 76 | Ga0068863_100000216 | 3300005841 | Bacteria | 61837 |
| 77 | Ga0068863_100024789 | 3300005841 | Bacteria | 5721 |
| 78 | Ga0068863_100128266 | 3300005841 | Bacteria | 2421 |
| 79 | Ga0068863_100310013 | 3300005841 | Bacteria | 1532 |
| 80 | Ga0068863_101133013 | 3300005841 | Bacteria | 787 |
| 81 | Ga0068858_100002789 | 3300005842 | Bacteria | 17554 |
| 82 | Ga0068858_100042993 | 3300005842 | Bacteria | 4190 |
| 83 | Ga0068858_100396728 | 3300005842 | Unclassified | 1325 |
| 84 | Ga0068858_100733474 | 3300005842 | Bacteria | 962 |
| 85 | Ga0068860_100011746 | 3300005843 | Bacteria | 8629 |
| 86 | Ga0068860_100012918 | 3300005843 | Bacteria | 8203 |
| 87 | Ga0068860_100013810 | 3300005843 | Bacteria | 7916 |
| 88 | Ga0068860_100036822 | 3300005843 | Bacteria | 4686 |
| 89 | Ga0070712_100725775 | 3300006175 | Bacteria | 849 |
| 90 | Ga0097621_100004653 | 3300006237 | Bacteria | 9582 |
| 91 | Ga0068871_100004694 | 3300006358 | Bacteria | 9551 |
| 92 | Ga0068871_100016795 | 3300006358 | Bacteria | 5524 |
| 93 | Ga0068871_100289580 | 3300006358 | Bacteria | 1435 |
| 94 | Ga0068871_100316739 | 3300006358 | Bacteria | 1373 |
| 95 | Ga0068871_101186942 | 3300006358 | Unclassified | 715 |
| 96 | Ga0068865_100005377 | 3300006881 | Bacteria | 7759 |
| 97 | Ga0068865_100382706 | 3300006881 | Bacteria | 1148 |
| 98 | Ga0097620_100000064 | 3300006931 | Bacteria | 104971 |
| 99 | Ga0097620_100050731 | 3300006931 | Bacteria | 4168 |
| 100 | Ga0097620_100407697 | 3300006931 | Bacteria | 1455 |
| 101 | Ga0097620_100972392 | 3300006931 | Unclassified | 932 |
| 102 | Ga0105240_10104586 | 3300009093 | Unclassified | 3438 |
| 103 | Ga0105240_10440742 | 3300009093 | Bacteria | 1459 |
| 104 | Ga0111539_10309330 | 3300009094 | Bacteria | 1839 |
| 105 | Ga0105245_10147359 | 3300009098 | Bacteria | 2222 |
| 106 | Ga0105245_10648067 | 3300009098 | Bacteria | 1086 |
| 107 | Ga0105247_10028400 | 3300009101 | Unclassified | 3385 |
| 108 | Ga0114129_10001869 | 3300009147 | Bacteria | 28696 |
| 109 | Ga0105243_10198857 | 3300009148 | Bacteria | 1756 |
| 110 | Ga0105241_10001283 | 3300009174 | Bacteria | 19188 |
| 111 | Ga0105241_10163765 | 3300009174 | Bacteria | 1831 |
| 112 | Ga0105241_10194207 | 3300009174 | Bacteria | 1691 |
| 113 | Ga0105241_10457470 | 3300009174 | Bacteria | 1130 |
| 114 | Ga0105241_10999352 | 3300009174 | Unclassified | 782 |
| 115 | Ga0105242_10026095 | 3300009176 | Bacteria | 4629 |
| 116 | Ga0105242_10154527 | 3300009176 | Bacteria | 2003 |
| 117 | Ga0105242_11034584 | 3300009176 | Bacteria | 831 |
| 118 | Ga0105242_11308061 | 3300009176 | Unclassified | 749 |
| 119 | Ga0105248_11444540 | 3300009177 | Unclassified | 778 |
| 120 | Ga0105237_10032136 | 3300009545 | Bacteria | 5315 |
| 121 | Ga0105237_10305390 | 3300009545 | Bacteria | 1594 |
| 122 | Ga0105237_10513011 | 3300009545 | Bacteria | 1205 |
| 123 | Ga0105249_10011147 | 3300009553 | Bacteria | 7898 |
| 124 | Ga0105249_10023823 | 3300009553 | Bacteria | 5498 |
| 125 | Ga0105249_10795313 | 3300009553 | Bacteria | 1010 |
| 126 | Ga0105239_10000785 | 3300010375 | Bacteria | 45044 |
| 127 | Ga0105239_10129512 | 3300010375 | Unclassified | 2806 |
| 128 | Ga0105246_10157779 | 3300011119 | Bacteria | 1725 |
| 129 | Ga0105246_10157840 | 3300011119 | Unclassified | 1725 |
| 130 | Ga0105246_10717079 | 3300011119 | Bacteria | 878 |
| 131 | Ga0157373_10017711 | 3300013100 | Bacteria | 5187 |
| 132 | Ga0157373_10572353 | 3300013100 | Bacteria | 821 |
| 133 | Ga0157371_10643808 | 3300013102 | Unclassified | 791 |
| 134 | Ga0157369_10580753 | 3300013105 | Bacteria | 1157 |
| 135 | Ga0157374_10000263 | 3300013296 | Bacteria | 48612 |
| 136 | Ga0157374_10032047 | 3300013296 | Bacteria | 4783 |
| 137 | Ga0157374_10912942 | 3300013296 | Bacteria | 896 |
| 138 | Ga0157378_10003436 | 3300013297 | Bacteria | 14052 |
| 139 | Ga0157378_10026552 | 3300013297 | Bacteria | 5104 |
| 140 | Ga0157378_10047245 | 3300013297 | Bacteria | 3826 |
| 141 | Ga0157378_10249077 | 3300013297 | Bacteria | 1700 |
| 142 | Ga0163162_10000190 | 3300013306 | Bacteria | 56892 |
| 143 | Ga0163162_10000257 | 3300013306 | Bacteria | 48216 |
| 144 | Ga0163162_10004838 | 3300013306 | Bacteria | 12998 |
| 145 | Ga0163162_10012063 | 3300013306 | Bacteria | 8429 |
| 146 | Ga0163162_10016844 | 3300013306 | Bacteria | 7144 |
| 147 | Ga0163162_10021837 | 3300013306 | Bacteria | 6306 |
| 148 | Ga0163162_10220141 | 3300013306 | Bacteria | 2028 |
| 149 | Ga0157372_10150566 | 3300013307 | Bacteria | 2685 |
| 150 | Ga0157372_10187635 | 3300013307 | Unclassified | 2394 |
| 151 | Ga0157372_10226026 | 3300013307 | Bacteria | 2170 |
| 152 | Ga0157372_10408092 | 3300013307 | Bacteria | 1583 |
| 153 | Ga0157372_10448288 | 3300013307 | Bacteria | 1504 |
| 154 | Ga0157372_10507721 | 3300013307 | Bacteria | 1406 |
| 155 | Ga0157372_10607537 | 3300013307 | Bacteria | 1275 |
| 156 | Ga0157372_10676862 | 3300013307 | Unclassified | 1201 |
| 157 | Ga0157372_11525205 | 3300013307 | Bacteria | 770 |
| 158 | Ga0157372_11634182 | 3300013307 | Unclassified | 742 |
| 159 | Ga0157375_10001759 | 3300013308 | Bacteria | 18571 |
| 160 | Ga0157375_10069909 | 3300013308 | Bacteria | 3518 |
| 161 | Ga0157375_10862352 | 3300013308 | Unclassified | 1051 |
| 162 | Ga0163163_10000316 | 3300014325 | Bacteria | 47024 |
| 163 | Ga0157380_10041792 | 3300014326 | Bacteria | 3580 |
| 164 | Ga0157377_10278666 | 3300014745 | Bacteria | 1095 |
| 165 | Ga0157379_10002129 | 3300014968 | Bacteria | 16411 |
| 166 | Ga0157379_10081253 | 3300014968 | Bacteria | 2903 |
| 167 | Ga0157376_10000661 | 3300014969 | Bacteria | 22276 |
| 168 | Ga0157376_10001835 | 3300014969 | Bacteria | 14153 |
| 169 | Ga0157376_10012788 | 3300014969 | Bacteria | 6242 |
| 170 | Ga0157376_10114192 | 3300014969 | Bacteria | 2382 |
| 171 | Ga0157376_10349635 | 3300014969 | Bacteria | 1414 |
| 172 | Ga0163161_10040694 | 3300017792 | Bacteria | 3338 |
| 173 | Ga0163161_10133842 | 3300017792 | Bacteria | 1872 |
| 174 | Ga0209646_1003045 | 3300025246 | Bacteria | 3436 |
| 175 | Ga0207426_1000023 | 3300025302 | Bacteria | 545465 |
| 176 | Ga0207697_10050988 | 3300025315 | Bacteria | 1709 |
| 177 | Ga0207656_10000868 | 3300025321 | Bacteria | 9865 |
| 178 | Ga0207642_10834199 | 3300025899 | Unclassified | 588 |
| 179 | Ga0207710_10188963 | 3300025900 | Unclassified | 1013 |
| 180 | Ga0207680_10000034 | 3300025903 | Bacteria | 74519 |
| 181 | Ga0207680_10000623 | 3300025903 | Bacteria | 16679 |
| 182 | Ga0207680_10226098 | 3300025903 | Bacteria | 1285 |
| 183 | Ga0207647_10148174 | 3300025904 | Bacteria | 1373 |
| 184 | Ga0207645_10006805 | 3300025907 | Bacteria | 8160 |
| 185 | Ga0207705_10049046 | 3300025909 | Bacteria | 3039 |
| 186 | Ga0207705_10077557 | 3300025909 | Bacteria | 2417 |
| 187 | Ga0207705_10127712 | 3300025909 | Bacteria | 1890 |
| 188 | Ga0207654_10248764 | 3300025911 | Bacteria | 1191 |
| 189 | Ga0207654_10784516 | 3300025911 | Unclassified | 688 |
| 190 | Ga0207695_10686351 | 3300025913 | Bacteria | 905 |
| 191 | Ga0207671_10015578 | 3300025914 | Bacteria | 5946 |
| 192 | Ga0207671_10572014 | 3300025914 | Bacteria | 901 |
| 193 | Ga0207662_10006417 | 3300025918 | Bacteria | 6348 |
| 194 | Ga0207652_10001696 | 3300025921 | Bacteria | 19285 |
| 195 | Ga0207652_10139503 | 3300025921 | Unclassified | 2167 |
| 196 | Ga0207681_10825687 | 3300025923 | Bacteria | 775 |
| 197 | Ga0207650_10187628 | 3300025925 | Bacteria | 1651 |
| 198 | Ga0207650_10202908 | 3300025925 | Bacteria | 1589 |
| 199 | Ga0207650_10258696 | 3300025925 | Bacteria | 1411 |
| 200 | Ga0207650_10889600 | 3300025925 | Unclassified | 756 |
| 201 | Ga0207659_10445678 | 3300025926 | Bacteria | 1090 |
| 202 | Ga0207687_10567180 | 3300025927 | Bacteria | 954 |
| 203 | Ga0207644_10036344 | 3300025931 | Bacteria | 3457 |
| 204 | Ga0207690_10027231 | 3300025932 | Bacteria | 3611 |
| 205 | Ga0207706_10005522 | 3300025933 | Bacteria | 11791 |
| 206 | Ga0207686_10093728 | 3300025934 | Bacteria | 1989 |
| 207 | Ga0207670_10390119 | 3300025936 | Bacteria | 1111 |
| 208 | Ga0207669_10422588 | 3300025937 | Bacteria | 1049 |
| 209 | Ga0207704_10002571 | 3300025938 | Bacteria | 8184 |
| 210 | Ga0207704_10417844 | 3300025938 | Bacteria | 1062 |
| 211 | Ga0207704_11475261 | 3300025938 | Unclassified | 583 |
| 212 | Ga0207691_10000115 | 3300025940 | Bacteria | 72014 |
| 213 | Ga0207691_10105468 | 3300025940 | Bacteria | 2511 |
| 214 | Ga0207691_10599482 | 3300025940 | Bacteria | 933 |
| 215 | Ga0207689_10000835 | 3300025942 | Bacteria | 29733 |
| 216 | Ga0207689_10030557 | 3300025942 | Bacteria | 4489 |
| 217 | Ga0207689_10049414 | 3300025942 | Bacteria | 3469 |
| 218 | Ga0207661_10031569 | 3300025944 | Bacteria | 4094 |
| 219 | Ga0207679_10021060 | 3300025945 | Bacteria | 4411 |
| 220 | Ga0207679_10726721 | 3300025945 | Bacteria | 902 |
| 221 | Ga0207667_10049014 | 3300025949 | Bacteria | 4463 |
| 222 | Ga0207667_10085392 | 3300025949 | Bacteria | 3268 |
| 223 | Ga0207651_10029674 | 3300025960 | Bacteria | 3469 |
| 224 | Ga0207651_10179337 | 3300025960 | Unclassified | 1679 |
| 225 | Ga0207712_10002930 | 3300025961 | Bacteria | 10899 |
| 226 | Ga0207712_10013320 | 3300025961 | Bacteria | 5273 |
| 227 | Ga0207712_10187076 | 3300025961 | Bacteria | 1632 |
| 228 | Ga0207668_10014419 | 3300025972 | Bacteria | 4891 |
| 229 | Ga0207668_10424314 | 3300025972 | Unclassified | 1129 |
| 230 | Ga0207640_10215422 | 3300025981 | Bacteria | 1466 |
| 231 | Ga0207658_10007406 | 3300025986 | Bacteria | 7485 |
| 232 | Ga0207677_10016085 | 3300026023 | Bacteria | 4421 |
| 233 | Ga0207677_10102230 | 3300026023 | Unclassified | 2112 |
| 234 | Ga0207677_10117427 | 3300026023 | Unclassified | 1994 |
| 235 | Ga0207677_10296971 | 3300026023 | Bacteria | 1333 |
| 236 | Ga0207703_10005435 | 3300026035 | Bacteria | 10253 |
| 237 | Ga0207703_10006374 | 3300026035 | Bacteria | 9430 |
| 238 | Ga0207639_10006922 | 3300026041 | Bacteria | 7724 |
| 239 | Ga0207639_10021872 | 3300026041 | Bacteria | 4599 |
| 240 | Ga0207639_10218223 | 3300026041 | Bacteria | 1646 |
| 241 | Ga0207639_10811622 | 3300026041 | Unclassified | 872 |
| 242 | Ga0207678_10196741 | 3300026067 | Bacteria | 1723 |
| 243 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 244 | Ga0207641_10008582 | 3300026088 | Bacteria | 8437 |
| 245 | Ga0207641_11172793 | 3300026088 | Bacteria | 767 |
| 246 | Ga0207641_11185602 | 3300026088 | Bacteria | 763 |
| 247 | Ga0207648_10009342 | 3300026089 | Bacteria | 9396 |
| 248 | Ga0207648_10175448 | 3300026089 | Bacteria | 1895 |
| 249 | Ga0207676_10002210 | 3300026095 | Bacteria | 14039 |
| 250 | Ga0207676_10074023 | 3300026095 | Bacteria | 2743 |
| 251 | Ga0207676_10407496 | 3300026095 | Bacteria | 1272 |
| 252 | Ga0207676_10444905 | 3300026095 | Bacteria | 1220 |
| 253 | Ga0207674_10064514 | 3300026116 | Bacteria | 3694 |
| 254 | Ga0207674_10093437 | 3300026116 | Bacteria | 2996 |
| 255 | Ga0207674_10162745 | 3300026116 | Bacteria | 2186 |
| 256 | Ga0207675_101376808 | 3300026118 | Bacteria | 726 |
| 257 | Ga0207683_10082899 | 3300026121 | Bacteria | 2849 |
| 258 | Ga0207683_10109587 | 3300026121 | Bacteria | 2471 |
| 259 | Ga0207698_10072886 | 3300026142 | Bacteria | 2732 |
| 260 | Ga0207698_10300716 | 3300026142 | Bacteria | 1493 |
| 261 | Ga0207698_10776361 | 3300026142 | Bacteria | 959 |
| 262 | Ga0207698_10811169 | 3300026142 | Unclassified | 938 |
| 263 | Ga0268266_10247227 | 3300028379 | Bacteria | 1648 |
| 264 | Ga0268264_10013213 | 3300028381 | Bacteria | 6795 |
| 265 | Ga0268264_10041332 | 3300028381 | Bacteria | 3814 |
| 266 | Ga0268264_10064360 | 3300028381 | Bacteria | 3086 |
| 267 | Ga0268264_10192950 | 3300028381 | Unclassified | 1858 |
| 268 | Ga0307515_10000091 | 3300028794 | Bacteria | 214014 |
| 269 | Ga0265338_10163408 | 3300028800 | Bacteria | 1717 |
| 270 | Ga0265332_10090003 | 3300031238 | Bacteria | 1298 |
| 271 | Ga0265327_10000152 | 3300031251 | Bacteria | 149065 |
| 272 | Ga0307513_10408274 | 3300031456 | Bacteria | 1091 |
| 273 | Ga0307509_10123637 | 3300031507 | Unclassified | 2559 |
| 274 | Ga0307508_10032628 | 3300031616 | Bacteria | 4704 |
| 275 | Ga0307508_10309064 | 3300031616 | Unclassified | 1173 |
| 276 | Ga0265314_10333498 | 3300031711 | Bacteria | 840 |
| 277 | Ga0307413_11341145 | 3300031824 | Bacteria | 627 |
| 278 | Ga0307507_10099198 | 3300033179 | Bacteria | 2448 |
| 279 | Ga0307507_10423076 | 3300033179 | Bacteria | 747 |
| 280 | Ga0373935_0254457 | 3300035692 | Bacteria | 1230 |
| 281 | Ga0395899_0001701 | 3300037312 | Bacteria | 18337 |
| 282 | Ga0395899_0022642 | 3300037312 | Bacteria | 4760 |
| 283 | Ga0395900_0001238 | 3300037418 | Bacteria | 31389 |
| 284 | Ga0395900_0045056 | 3300037418 | Bacteria | 4543 |
| 285 | Ga0395898_0001199 | 3300037466 | Bacteria | 39218 |
| 286 | Ga0395898_0355186 | 3300037466 | Bacteria | 1398 |
| 287 | Ga0395905_0174739 | 3300037471 | Bacteria | 2017 |
| 288 | Ga0395901_0021133 | 3300038443 | Bacteria | 6668 |
| 289 | Ga0451845_0778692 | 3300041501 | Bacteria | 788 |
| 290 | Ga0451847_0919454 | 3300041503 | Unclassified | 688 |
| 291 | Ga0439449_0153548 | 3300042007 | Bacteria | 859 |
| 292 | Ga0451577_0003576 | 3300042876 | Bacteria | 17122 |
| 293 | Ga0451577_0415623 | 3300042876 | Bacteria | 1221 |
| 294 | Ga0451577_0840480 | 3300042876 | Bacteria | 828 |
| 295 | Ga0466969_0000238 | 3300044656 | Bacteria | 30098 |
| 296 | Ga0466972_0010280 | 3300044658 | Bacteria | 4700 |
| 297 | Ga0453683_0000069 | 3300044673 | Bacteria | 162908 |
| 298 | Ga0466966_0000136 | 3300044684 | Bacteria | 47038 |
| 299 | Ga0466964_0030938 | 3300044706 | Unclassified | 2121 |
| 300 | Ga0453684_0014466 | 3300044712 | Bacteria | 12621 |
| 301 | Ga0453684_0045020 | 3300044712 | Bacteria | 5892 |
| 302 | Ga0453684_0069106 | 3300044712 | Bacteria | 4482 |
| 303 | Ga0453684_0150689 | 3300044712 | Bacteria | 2764 |
| 304 | Ga0453684_0173124 | 3300044712 | Bacteria | 2542 |
| 305 | Ga0453684_0367617 | 3300044712 | Bacteria | 1618 |
| 306 | Ga0466968_0089514 | 3300044735 | Unclassified | 1362 |
| 307 | Ga0466957_0029800 | 3300044842 | Bacteria | 3256 |
| 308 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 309 | Ga0466959_0049931 | 3300045049 | Unclassified | 3073 |
| 310 | Ga0451576_0000300 | 3300045051 | Bacteria | 119685 |
| 311 | Ga0495629_0613380 | 3300046459 | Unclassified | 727 |
| 312 | Ga0495625_0727099 | 3300046660 | Unclassified | 584 |
| 313 | Ga0495635_0037514 | 3300046663 | Bacteria | 3355 |
| 314 | Ga0495657_0686119 | 3300046675 | Bacteria | 589 |
| 315 | Ga0495674_0192530 | 3300047319 | Bacteria | 1694 |
| 316 | Ga0495672_0011784 | 3300047320 | Bacteria | 6143 |
| 317 | Ga0496108_0258977 | 3300048911 | Bacteria | 1514 |
| 318 | Ga0501031_0003432 | 3300049568 | Bacteria | 10166 |
| 319 | Ga0501033_0804370 | 3300049570 | Viruses | 635 |
| 320 | Ga0501034_0319550 | 3300049571 | Unclassified | 1486 |
| 321 | Ga0501034_0515903 | 3300049571 | Unclassified | 1107 |
| 322 | Ga0501036_0007222 | 3300049572 | Bacteria | 9047 |
| 323 | Ga0501037_0009380 | 3300049573 | Bacteria | 7184 |
| 324 | Ga0501038_0016633 | 3300049574 | Bacteria | 6667 |
| 325 | Ga0501039_0072329 | 3300049575 | Bacteria | 2679 |
| 326 | Ga0501043_0012748 | 3300049579 | Bacteria | 6571 |
| 327 | Ga0501046_0024472 | 3300049580 | Bacteria | 4952 |
| 328 | Ga0501047_0306328 | 3300049581 | Unclassified | 1430 |
| 329 | Ga0501035_0136838 | 3300049822 | Bacteria | 2132 |
| 330 | Ga0501044_0020153 | 3300049823 | Bacteria | 7117 |
| 331 | nmdc:mga05p37_1503_c1 | 3300050507 | Bacteria | 27101 |
| 332 | Ga0500578_0283159 | 3300053086 | Bacteria | 988 |
| 333 | Ga0500583_0002199 | 3300053092 | Bacteria | 5793 |
| 334 | Ga0500651_0252595 | 3300053093 | Unclassified | 1025 |
| 335 | Ga0500641_0009429 | 3300053096 | Bacteria | 3512 |
| 336 | Ga0500652_024549 | 3300053131 | Bacteria | 2302 |
| 337 | Ga0500588_0022673 | 3300053146 | Bacteria | 1713 |
| 338 | Ga0500589_011097 | 3300053147 | Bacteria | 3885 |
| 339 | Ga0500622_0017284 | 3300053156 | Bacteria | 3839 |
| 340 | Ga0500622_0186045 | 3300053156 | Bacteria | 956 |
| 341 | Ga0500636_0172458 | 3300053177 | Bacteria | 1169 |
| 342 | Ga0500587_038590 | 3300053739 | Unclassified | 678 |
| 343 | Ga0501082_0810771 | 3300060353 | Unclassified | 819 |
| 344 | Ga0466962_0295636 | 3300061719 | Bacteria | 801 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_11634182 | Ga0157372_116341821 | 148 |
| 2 | 3300025925 | Ga0207650_10258696 | Ga0207650_102586962 | 154 |
| 3 | 3300044658 | Ga0466972_0010280 | Ga0466972_0010280_2244_2729 | 154 |
| 4 | 3300009147 | Ga0114129_10001869 | Ga0114129_1000186911 | 155 |
| 5 | 3300050507 | nmdc:mga05p37_1503_c1 | nmdc:mga05p37_1503_c1_12037_12522 | 155 |
| 6 | 3300005339 | Ga0070660_101306003 | Ga0070660_1013060031 | 158 |
| 7 | 3300005345 | Ga0070692_10033510 | Ga0070692_100335103 | 158 |
| 8 | 3300005366 | Ga0070659_100010660 | Ga0070659_1000106605 | 158 |
| 9 | 3300005530 | Ga0070679_100017007 | Ga0070679_1000170072 | 158 |
| 10 | 3300005834 | Ga0068851_10041419 | Ga0068851_100414192 | 158 |
| 11 | 3300013100 | Ga0157373_10017711 | Ga0157373_100177114 | 158 |
| 12 | 3300013307 | Ga0157372_10408092 | Ga0157372_104080922 | 158 |
| 13 | 3300025909 | Ga0207705_10077557 | Ga0207705_100775572 | 158 |
| 14 | 3300025921 | Ga0207652_10001696 | Ga0207652_1000169618 | 158 |
| 15 | 3300025932 | Ga0207690_10027231 | Ga0207690_100272312 | 158 |
| 16 | 3300026116 | Ga0207674_10064514 | Ga0207674_100645142 | 158 |
| 17 | 3300037312 | Ga0395899_0001701 | Ga0395899_0001701_5377_5859 | 158 |
| 18 | 3300037312 | Ga0395899_0022642 | Ga0395899_0022642_4206_4688 | 158 |
| 19 | 3300037418 | Ga0395900_0001238 | Ga0395900_0001238_21874_22356 | 158 |
| 20 | 3300037418 | Ga0395900_0045056 | Ga0395900_0045056_2075_2557 | 158 |
| 21 | 3300037466 | Ga0395898_0001199 | Ga0395898_0001199_33139_33621 | 158 |
| 22 | 3300038443 | Ga0395901_0021133 | Ga0395901_0021133_5597_6079 | 158 |
| 23 | 3300005841 | Ga0068863_101133013 | Ga0068863_1011330132 | 160 |
| 24 | 3300005843 | Ga0068860_100036822 | Ga0068860_1000368222 | 160 |
| 25 | 3300009553 | Ga0105249_10795313 | Ga0105249_107953132 | 160 |
| 26 | 3300013306 | Ga0163162_10021837 | Ga0163162_100218372 | 160 |
| 27 | 3300025981 | Ga0207640_10215422 | Ga0207640_102154222 | 160 |
| 28 | 3300026088 | Ga0207641_11172793 | Ga0207641_111727932 | 160 |
| 29 | 3300028381 | Ga0268264_10064360 | Ga0268264_100643603 | 160 |
| 30 | 3300035692 | Ga0373935_0254457 | Ga0373935_0254457_315_797 | 160 |
| 31 | 3300042876 | Ga0451577_0003576 | Ga0451577_0003576_1768_2250 | 160 |
| 32 | 3300044673 | Ga0453683_0000069 | Ga0453683_0000069_97224_97706 | 160 |
| 33 | 3300044712 | Ga0453684_0150689 | Ga0453684_0150689_2200_2682 | 160 |
| 34 | 3300044712 | Ga0453684_0173124 | Ga0453684_0173124_251_733 | 160 |
| 35 | 3300044712 | Ga0453684_0367617 | Ga0453684_0367617_1121_1603 | 160 |
| 36 | 3300045051 | Ga0451576_0000300 | Ga0451576_0000300_58451_58933 | 160 |
| 37 | 3300003320 | rootH2_10003679 | rootH2_1000367912 | 161 |
| 38 | 3300003323 | rootH1_10088937 | rootH1_100889372 | 161 |
| 39 | 3300005327 | Ga0070658_10000903 | Ga0070658_100009035 | 161 |
| 40 | 3300005328 | Ga0070676_10005739 | Ga0070676_100057392 | 161 |
| 41 | 3300005329 | Ga0070683_100132348 | Ga0070683_1001323483 | 161 |
| 42 | 3300005330 | Ga0070690_100286213 | Ga0070690_1002862132 | 161 |
| 43 | 3300005330 | Ga0070690_100444430 | Ga0070690_1004444301 | 161 |
| 44 | 3300005331 | Ga0070670_100250449 | Ga0070670_1002504492 | 161 |
| 45 | 3300005331 | Ga0070670_100424548 | Ga0070670_1004245482 | 161 |
| 46 | 3300005331 | Ga0070670_100684616 | Ga0070670_1006846161 | 161 |
| 47 | 3300005334 | Ga0068869_100131352 | Ga0068869_1001313522 | 161 |
| 48 | 3300005334 | Ga0068869_100250365 | Ga0068869_1002503651 | 161 |
| 49 | 3300005334 | Ga0068869_100262362 | Ga0068869_1002623622 | 161 |
| 50 | 3300005335 | Ga0070666_10000074 | Ga0070666_1000007453 | 161 |
| 51 | 3300005335 | Ga0070666_10100142 | Ga0070666_101001423 | 161 |
| 52 | 3300005335 | Ga0070666_10160074 | Ga0070666_101600742 | 161 |
| 53 | 3300005338 | Ga0068868_100002331 | Ga0068868_1000023312 | 161 |
| 54 | 3300005338 | Ga0068868_100006670 | Ga0068868_1000066704 | 161 |
| 55 | 3300005339 | Ga0070660_100948121 | Ga0070660_1009481211 | 161 |
| 56 | 3300005343 | Ga0070687_100140784 | Ga0070687_1001407842 | 161 |
| 57 | 3300005344 | Ga0070661_100482245 | Ga0070661_1004822452 | 161 |
| 58 | 3300005347 | Ga0070668_100000022 | Ga0070668_10000002277 | 161 |
| 59 | 3300005347 | Ga0070668_100609690 | Ga0070668_1006096901 | 161 |
| 60 | 3300005353 | Ga0070669_100321318 | Ga0070669_1003213182 | 161 |
| 61 | 3300005354 | Ga0070675_100129754 | Ga0070675_1001297543 | 161 |
| 62 | 3300005355 | Ga0070671_100023062 | Ga0070671_1000230623 | 161 |
| 63 | 3300005355 | Ga0070671_100032781 | Ga0070671_1000327819 | 161 |
| 64 | 3300005355 | Ga0070671_100199620 | Ga0070671_1001996201 | 161 |
| 65 | 3300005364 | Ga0070673_100034889 | Ga0070673_1000348892 | 161 |
| 66 | 3300005364 | Ga0070673_100183360 | Ga0070673_1001833602 | 161 |
| 67 | 3300005364 | Ga0070673_100396389 | Ga0070673_1003963891 | 161 |
| 68 | 3300005365 | Ga0070688_100075848 | Ga0070688_1000758483 | 161 |
| 69 | 3300005365 | Ga0070688_101052524 | Ga0070688_1010525241 | 161 |
| 70 | 3300005367 | Ga0070667_100001525 | Ga0070667_1000015259 | 161 |
| 71 | 3300005367 | Ga0070667_100011346 | Ga0070667_1000113466 | 161 |
| 72 | 3300005367 | Ga0070667_100024194 | Ga0070667_1000241948 | 161 |
| 73 | 3300005367 | Ga0070667_100886090 | Ga0070667_1008860902 | 161 |
| 74 | 3300005367 | Ga0070667_101550433 | Ga0070667_1015504331 | 161 |
| 75 | 3300005455 | Ga0070663_100769896 | Ga0070663_1007698962 | 161 |
| 76 | 3300005457 | Ga0070662_100013892 | Ga0070662_1000138922 | 161 |
| 77 | 3300005457 | Ga0070662_101383667 | Ga0070662_1013836671 | 161 |
| 78 | 3300005458 | Ga0070681_10199176 | Ga0070681_101991762 | 161 |
| 79 | 3300005459 | Ga0068867_100017526 | Ga0068867_1000175265 | 161 |
| 80 | 3300005466 | Ga0070685_10756951 | Ga0070685_107569511 | 161 |
| 81 | 3300005535 | Ga0070684_100056698 | Ga0070684_1000566982 | 161 |
| 82 | 3300005539 | Ga0068853_100006544 | Ga0068853_1000065448 | 161 |
| 83 | 3300005539 | Ga0068853_100082720 | Ga0068853_1000827203 | 161 |
| 84 | 3300005539 | Ga0068853_100284103 | Ga0068853_1002841032 | 161 |
| 85 | 3300005539 | Ga0068853_100883521 | Ga0068853_1008835211 | 161 |
| 86 | 3300005543 | Ga0070672_100000021 | Ga0070672_10000002116 | 161 |
| 87 | 3300005543 | Ga0070672_100121006 | Ga0070672_1001210062 | 161 |
| 88 | 3300005543 | Ga0070672_100637591 | Ga0070672_1006375911 | 161 |
| 89 | 3300005548 | Ga0070665_100011401 | Ga0070665_1000114016 | 161 |
| 90 | 3300005563 | Ga0068855_100015722 | Ga0068855_1000157228 | 161 |
| 91 | 3300005563 | Ga0068855_100041406 | Ga0068855_1000414064 | 161 |
| 92 | 3300005564 | Ga0070664_100016326 | Ga0070664_1000163261 | 161 |
| 93 | 3300005564 | Ga0070664_100571937 | Ga0070664_1005719372 | 161 |
| 94 | 3300005577 | Ga0068857_100028459 | Ga0068857_1000284594 | 161 |
| 95 | 3300005577 | Ga0068857_100281384 | Ga0068857_1002813842 | 161 |
| 96 | 3300005614 | Ga0068856_100032809 | Ga0068856_1000328097 | 161 |
| 97 | 3300005616 | Ga0068852_100045226 | Ga0068852_1000452264 | 161 |
| 98 | 3300005617 | Ga0068859_100000064 | Ga0068859_10000006496 | 161 |
| 99 | 3300005617 | Ga0068859_100050734 | Ga0068859_1000507344 | 161 |
| 100 | 3300005617 | Ga0068859_100407708 | Ga0068859_1004077081 | 161 |
| 101 | 3300005617 | Ga0068859_100972282 | Ga0068859_1009722821 | 161 |
| 102 | 3300005618 | Ga0068864_100001140 | Ga0068864_1000011402 | 161 |
| 103 | 3300005618 | Ga0068864_100003479 | Ga0068864_1000034799 | 161 |
| 104 | 3300005618 | Ga0068864_100297207 | Ga0068864_1002972072 | 161 |
| 105 | 3300005718 | Ga0068866_10141760 | Ga0068866_101417601 | 161 |
| 106 | 3300005834 | Ga0068851_10001028 | Ga0068851_1000102810 | 161 |
| 107 | 3300005841 | Ga0068863_100000216 | Ga0068863_1000002162 | 161 |
| 108 | 3300005841 | Ga0068863_100024789 | Ga0068863_1000247893 | 161 |
| 109 | 3300005841 | Ga0068863_100128266 | Ga0068863_1001282663 | 161 |
| 110 | 3300005841 | Ga0068863_100310013 | Ga0068863_1003100132 | 161 |
| 111 | 3300005842 | Ga0068858_100002789 | Ga0068858_1000027899 | 161 |
| 112 | 3300005842 | Ga0068858_100042993 | Ga0068858_1000429932 | 161 |
| 113 | 3300005842 | Ga0068858_100396728 | Ga0068858_1003967282 | 161 |
| 114 | 3300005842 | Ga0068858_100733474 | Ga0068858_1007334742 | 161 |
| 115 | 3300005843 | Ga0068860_100011746 | Ga0068860_1000117469 | 161 |
| 116 | 3300005843 | Ga0068860_100012918 | Ga0068860_1000129183 | 161 |
| 117 | 3300005843 | Ga0068860_100013810 | Ga0068860_1000138104 | 161 |
| 118 | 3300006175 | Ga0070712_100725775 | Ga0070712_1007257751 | 161 |
| 119 | 3300006237 | Ga0097621_100004653 | Ga0097621_1000046536 | 161 |
| 120 | 3300006358 | Ga0068871_100004694 | Ga0068871_1000046945 | 161 |
| 121 | 3300006358 | Ga0068871_100016795 | Ga0068871_1000167957 | 161 |
| 122 | 3300006358 | Ga0068871_100289580 | Ga0068871_1002895801 | 161 |
| 123 | 3300006358 | Ga0068871_100316739 | Ga0068871_1003167392 | 161 |
| 124 | 3300006358 | Ga0068871_101186942 | Ga0068871_1011869422 | 161 |
| 125 | 3300006881 | Ga0068865_100005377 | Ga0068865_1000053774 | 161 |
| 126 | 3300006881 | Ga0068865_100382706 | Ga0068865_1003827061 | 161 |
| 127 | 3300006931 | Ga0097620_100000064 | Ga0097620_10000006496 | 161 |
| 128 | 3300006931 | Ga0097620_100050731 | Ga0097620_1000507316 | 161 |
| 129 | 3300006931 | Ga0097620_100407697 | Ga0097620_1004076971 | 161 |
| 130 | 3300006931 | Ga0097620_100972392 | Ga0097620_1009723921 | 161 |
| 131 | 3300009093 | Ga0105240_10104586 | Ga0105240_101045863 | 161 |
| 132 | 3300009093 | Ga0105240_10440742 | Ga0105240_104407422 | 161 |
| 133 | 3300009094 | Ga0111539_10309330 | Ga0111539_103093302 | 161 |
| 134 | 3300009098 | Ga0105245_10147359 | Ga0105245_101473593 | 161 |
| 135 | 3300009098 | Ga0105245_10648067 | Ga0105245_106480673 | 161 |
| 136 | 3300009101 | Ga0105247_10028400 | Ga0105247_100284002 | 161 |
| 137 | 3300009148 | Ga0105243_10198857 | Ga0105243_101988572 | 161 |
| 138 | 3300009174 | Ga0105241_10001283 | Ga0105241_100012831 | 161 |
| 139 | 3300009174 | Ga0105241_10163765 | Ga0105241_101637652 | 161 |
| 140 | 3300009174 | Ga0105241_10194207 | Ga0105241_101942071 | 161 |
| 141 | 3300009174 | Ga0105241_10457470 | Ga0105241_104574702 | 161 |
| 142 | 3300009174 | Ga0105241_10999352 | Ga0105241_109993522 | 161 |
| 143 | 3300009176 | Ga0105242_10026095 | Ga0105242_100260956 | 161 |
| 144 | 3300009176 | Ga0105242_10154527 | Ga0105242_101545272 | 161 |
| 145 | 3300009176 | Ga0105242_11034584 | Ga0105242_110345841 | 161 |
| 146 | 3300009176 | Ga0105242_11308061 | Ga0105242_113080612 | 161 |
| 147 | 3300009177 | Ga0105248_11444540 | Ga0105248_114445401 | 161 |
| 148 | 3300009545 | Ga0105237_10032136 | Ga0105237_100321362 | 161 |
| 149 | 3300009545 | Ga0105237_10305390 | Ga0105237_103053903 | 161 |
| 150 | 3300009545 | Ga0105237_10513011 | Ga0105237_105130112 | 161 |
| 151 | 3300009553 | Ga0105249_10011147 | Ga0105249_100111474 | 161 |
| 152 | 3300009553 | Ga0105249_10023823 | Ga0105249_100238234 | 161 |
| 153 | 3300010375 | Ga0105239_10000785 | Ga0105239_1000078513 | 161 |
| 154 | 3300010375 | Ga0105239_10129512 | Ga0105239_101295124 | 161 |
| 155 | 3300011119 | Ga0105246_10157779 | Ga0105246_101577793 | 161 |
| 156 | 3300011119 | Ga0105246_10157840 | Ga0105246_101578403 | 161 |
| 157 | 3300011119 | Ga0105246_10717079 | Ga0105246_107170791 | 161 |
| 158 | 3300013100 | Ga0157373_10572353 | Ga0157373_105723532 | 161 |
| 159 | 3300013102 | Ga0157371_10643808 | Ga0157371_106438082 | 161 |
| 160 | 3300013105 | Ga0157369_10580753 | Ga0157369_105807531 | 161 |
| 161 | 3300013296 | Ga0157374_10000263 | Ga0157374_1000026325 | 161 |
| 162 | 3300013296 | Ga0157374_10032047 | Ga0157374_100320476 | 161 |
| 163 | 3300013296 | Ga0157374_10912942 | Ga0157374_109129421 | 161 |
| 164 | 3300013297 | Ga0157378_10003436 | Ga0157378_100034368 | 161 |
| 165 | 3300013297 | Ga0157378_10026552 | Ga0157378_100265523 | 161 |
| 166 | 3300013297 | Ga0157378_10047245 | Ga0157378_100472452 | 161 |
| 167 | 3300013297 | Ga0157378_10249077 | Ga0157378_102490772 | 161 |
| 168 | 3300013306 | Ga0163162_10000190 | Ga0163162_1000019012 | 161 |
| 169 | 3300013306 | Ga0163162_10000257 | Ga0163162_1000025718 | 161 |
| 170 | 3300013306 | Ga0163162_10004838 | Ga0163162_100048388 | 161 |
| 171 | 3300013306 | Ga0163162_10012063 | Ga0163162_100120638 | 161 |
| 172 | 3300013306 | Ga0163162_10016844 | Ga0163162_100168443 | 161 |
| 173 | 3300013306 | Ga0163162_10220141 | Ga0163162_102201413 | 161 |
| 174 | 3300013307 | Ga0157372_10150566 | Ga0157372_101505663 | 161 |
| 175 | 3300013307 | Ga0157372_10187635 | Ga0157372_101876352 | 161 |
| 176 | 3300013307 | Ga0157372_10226026 | Ga0157372_102260263 | 161 |
| 177 | 3300013307 | Ga0157372_10448288 | Ga0157372_104482882 | 161 |
| 178 | 3300013307 | Ga0157372_10507721 | Ga0157372_105077212 | 161 |
| 179 | 3300013307 | Ga0157372_10607537 | Ga0157372_106075372 | 161 |
| 180 | 3300013307 | Ga0157372_10676862 | Ga0157372_106768622 | 161 |
| 181 | 3300013307 | Ga0157372_11525205 | Ga0157372_115252051 | 161 |
| 182 | 3300013308 | Ga0157375_10001759 | Ga0157375_100017596 | 161 |
| 183 | 3300013308 | Ga0157375_10069909 | Ga0157375_100699092 | 161 |
| 184 | 3300013308 | Ga0157375_10862352 | Ga0157375_108623523 | 161 |
| 185 | 3300014325 | Ga0163163_10000316 | Ga0163163_100003169 | 161 |
| 186 | 3300014326 | Ga0157380_10041792 | Ga0157380_100417924 | 161 |
| 187 | 3300014745 | Ga0157377_10278666 | Ga0157377_102786662 | 161 |
| 188 | 3300014968 | Ga0157379_10002129 | Ga0157379_1000212913 | 161 |
| 189 | 3300014968 | Ga0157379_10081253 | Ga0157379_100812532 | 161 |
| 190 | 3300014969 | Ga0157376_10000661 | Ga0157376_1000066116 | 161 |
| 191 | 3300014969 | Ga0157376_10001835 | Ga0157376_1000183512 | 161 |
| 192 | 3300014969 | Ga0157376_10012788 | Ga0157376_100127886 | 161 |
| 193 | 3300014969 | Ga0157376_10114192 | Ga0157376_101141923 | 161 |
| 194 | 3300014969 | Ga0157376_10349635 | Ga0157376_103496352 | 161 |
| 195 | 3300017792 | Ga0163161_10040694 | Ga0163161_100406944 | 161 |
| 196 | 3300017792 | Ga0163161_10133842 | Ga0163161_101338422 | 161 |
| 197 | 3300025246 | Ga0209646_1003045 | Ga0209646_10030455 | 161 |
| 198 | 3300025302 | Ga0207426_1000023 | Ga0207426_1000023342 | 161 |
| 199 | 3300025315 | Ga0207697_10050988 | Ga0207697_100509881 | 161 |
| 200 | 3300025321 | Ga0207656_10000868 | Ga0207656_100008689 | 161 |
| 201 | 3300025899 | Ga0207642_10834199 | Ga0207642_108341991 | 161 |
| 202 | 3300025900 | Ga0207710_10188963 | Ga0207710_101889631 | 161 |
| 203 | 3300025903 | Ga0207680_10000034 | Ga0207680_1000003447 | 161 |
| 204 | 3300025903 | Ga0207680_10000623 | Ga0207680_100006232 | 161 |
| 205 | 3300025903 | Ga0207680_10226098 | Ga0207680_102260982 | 161 |
| 206 | 3300025904 | Ga0207647_10148174 | Ga0207647_101481742 | 161 |
| 207 | 3300025907 | Ga0207645_10006805 | Ga0207645_100068056 | 161 |
| 208 | 3300025909 | Ga0207705_10049046 | Ga0207705_100490464 | 161 |
| 209 | 3300025909 | Ga0207705_10127712 | Ga0207705_101277123 | 161 |
| 210 | 3300025911 | Ga0207654_10248764 | Ga0207654_102487641 | 161 |
| 211 | 3300025911 | Ga0207654_10784516 | Ga0207654_107845161 | 161 |
| 212 | 3300025913 | Ga0207695_10686351 | Ga0207695_106863512 | 161 |
| 213 | 3300025914 | Ga0207671_10015578 | Ga0207671_100155781 | 161 |
| 214 | 3300025914 | Ga0207671_10572014 | Ga0207671_105720141 | 161 |
| 215 | 3300025918 | Ga0207662_10006417 | Ga0207662_100064174 | 161 |
| 216 | 3300025921 | Ga0207652_10139503 | Ga0207652_101395032 | 161 |
| 217 | 3300025923 | Ga0207681_10825687 | Ga0207681_108256871 | 161 |
| 218 | 3300025925 | Ga0207650_10187628 | Ga0207650_101876282 | 161 |
| 219 | 3300025925 | Ga0207650_10202908 | Ga0207650_102029082 | 161 |
| 220 | 3300025925 | Ga0207650_10889600 | Ga0207650_108896002 | 161 |
| 221 | 3300025926 | Ga0207659_10445678 | Ga0207659_104456782 | 161 |
| 222 | 3300025927 | Ga0207687_10567180 | Ga0207687_105671802 | 161 |
| 223 | 3300025931 | Ga0207644_10036344 | Ga0207644_100363442 | 161 |
| 224 | 3300025933 | Ga0207706_10005522 | Ga0207706_100055224 | 161 |
| 225 | 3300025934 | Ga0207686_10093728 | Ga0207686_100937283 | 161 |
| 226 | 3300025936 | Ga0207670_10390119 | Ga0207670_103901191 | 161 |
| 227 | 3300025937 | Ga0207669_10422588 | Ga0207669_104225882 | 161 |
| 228 | 3300025938 | Ga0207704_10002571 | Ga0207704_100025714 | 161 |
| 229 | 3300025938 | Ga0207704_10417844 | Ga0207704_104178441 | 161 |
| 230 | 3300025938 | Ga0207704_11475261 | Ga0207704_114752611 | 161 |
| 231 | 3300025940 | Ga0207691_10000115 | Ga0207691_1000011518 | 161 |
| 232 | 3300025940 | Ga0207691_10105468 | Ga0207691_101054682 | 161 |
| 233 | 3300025940 | Ga0207691_10599482 | Ga0207691_105994821 | 161 |
| 234 | 3300025942 | Ga0207689_10000835 | Ga0207689_100008359 | 161 |
| 235 | 3300025942 | Ga0207689_10030557 | Ga0207689_100305572 | 161 |
| 236 | 3300025942 | Ga0207689_10049414 | Ga0207689_100494142 | 161 |
| 237 | 3300025944 | Ga0207661_10031569 | Ga0207661_100315693 | 161 |
| 238 | 3300025945 | Ga0207679_10021060 | Ga0207679_100210602 | 161 |
| 239 | 3300025945 | Ga0207679_10726721 | Ga0207679_107267212 | 161 |
| 240 | 3300025949 | Ga0207667_10049014 | Ga0207667_100490141 | 161 |
| 241 | 3300025949 | Ga0207667_10085392 | Ga0207667_100853924 | 161 |
| 242 | 3300025960 | Ga0207651_10029674 | Ga0207651_100296742 | 161 |
| 243 | 3300025960 | Ga0207651_10179337 | Ga0207651_101793372 | 161 |
| 244 | 3300025961 | Ga0207712_10002930 | Ga0207712_100029307 | 161 |
| 245 | 3300025961 | Ga0207712_10013320 | Ga0207712_100133202 | 161 |
| 246 | 3300025961 | Ga0207712_10187076 | Ga0207712_101870762 | 161 |
| 247 | 3300025972 | Ga0207668_10014419 | Ga0207668_100144193 | 161 |
| 248 | 3300025972 | Ga0207668_10424314 | Ga0207668_104243142 | 161 |
| 249 | 3300025986 | Ga0207658_10007406 | Ga0207658_100074064 | 161 |
| 250 | 3300026023 | Ga0207677_10016085 | Ga0207677_100160852 | 161 |
| 251 | 3300026023 | Ga0207677_10102230 | Ga0207677_101022302 | 161 |
| 252 | 3300026023 | Ga0207677_10117427 | Ga0207677_101174271 | 161 |
| 253 | 3300026023 | Ga0207677_10296971 | Ga0207677_102969711 | 161 |
| 254 | 3300026035 | Ga0207703_10005435 | Ga0207703_100054358 | 161 |
| 255 | 3300026035 | Ga0207703_10006374 | Ga0207703_100063745 | 161 |
| 256 | 3300026041 | Ga0207639_10006922 | Ga0207639_100069223 | 161 |
| 257 | 3300026041 | Ga0207639_10021872 | Ga0207639_100218725 | 161 |
| 258 | 3300026041 | Ga0207639_10218223 | Ga0207639_102182233 | 161 |
| 259 | 3300026041 | Ga0207639_10811622 | Ga0207639_108116222 | 161 |
| 260 | 3300026067 | Ga0207678_10196741 | Ga0207678_101967414 | 161 |
| 261 | 3300026088 | Ga0207641_10000082 | Ga0207641_1000008214 | 161 |
| 262 | 3300026088 | Ga0207641_10008582 | Ga0207641_100085827 | 161 |
| 263 | 3300026088 | Ga0207641_11185602 | Ga0207641_111856021 | 161 |
| 264 | 3300026089 | Ga0207648_10009342 | Ga0207648_100093426 | 161 |
| 265 | 3300026089 | Ga0207648_10175448 | Ga0207648_101754483 | 161 |
| 266 | 3300026095 | Ga0207676_10002210 | Ga0207676_1000221013 | 161 |
| 267 | 3300026095 | Ga0207676_10074023 | Ga0207676_100740232 | 161 |
| 268 | 3300026095 | Ga0207676_10407496 | Ga0207676_104074962 | 161 |
| 269 | 3300026095 | Ga0207676_10444905 | Ga0207676_104449053 | 161 |
| 270 | 3300026116 | Ga0207674_10093437 | Ga0207674_100934374 | 161 |
| 271 | 3300026116 | Ga0207674_10162745 | Ga0207674_101627452 | 161 |
| 272 | 3300026118 | Ga0207675_101376808 | Ga0207675_1013768081 | 161 |
| 273 | 3300026121 | Ga0207683_10082899 | Ga0207683_100828993 | 161 |
| 274 | 3300026121 | Ga0207683_10109587 | Ga0207683_101095871 | 161 |
| 275 | 3300026142 | Ga0207698_10072886 | Ga0207698_100728865 | 161 |
| 276 | 3300026142 | Ga0207698_10300716 | Ga0207698_103007162 | 161 |
| 277 | 3300026142 | Ga0207698_10776361 | Ga0207698_107763612 | 161 |
| 278 | 3300026142 | Ga0207698_10811169 | Ga0207698_108111692 | 161 |
| 279 | 3300028379 | Ga0268266_10247227 | Ga0268266_102472272 | 161 |
| 280 | 3300028381 | Ga0268264_10013213 | Ga0268264_100132132 | 161 |
| 281 | 3300028381 | Ga0268264_10041332 | Ga0268264_100413322 | 161 |
| 282 | 3300028381 | Ga0268264_10192950 | Ga0268264_101929501 | 161 |
| 283 | 3300028794 | Ga0307515_10000091 | Ga0307515_1000009173 | 161 |
| 284 | 3300028800 | Ga0265338_10163408 | Ga0265338_101634082 | 161 |
| 285 | 3300031238 | Ga0265332_10090003 | Ga0265332_100900032 | 161 |
| 286 | 3300031251 | Ga0265327_10000152 | Ga0265327_1000015287 | 161 |
| 287 | 3300031456 | Ga0307513_10408274 | Ga0307513_104082741 | 161 |
| 288 | 3300031507 | Ga0307509_10123637 | Ga0307509_101236372 | 161 |
| 289 | 3300031616 | Ga0307508_10032628 | Ga0307508_100326283 | 161 |
| 290 | 3300031616 | Ga0307508_10309064 | Ga0307508_103090641 | 161 |
| 291 | 3300031711 | Ga0265314_10333498 | Ga0265314_103334982 | 161 |
| 292 | 3300031824 | Ga0307413_11341145 | Ga0307413_113411451 | 161 |
| 293 | 3300033179 | Ga0307507_10099198 | Ga0307507_100991983 | 161 |
| 294 | 3300033179 | Ga0307507_10423076 | Ga0307507_104230761 | 161 |
| 295 | 3300037466 | Ga0395898_0355186 | Ga0395898_0355186_696_1202 | 161 |
| 296 | 3300037471 | Ga0395905_0174739 | Ga0395905_0174739_158_646 | 161 |
| 297 | 3300041501 | Ga0451845_0778692 | Ga0451845_0778692_154_657 | 161 |
| 298 | 3300041503 | Ga0451847_0919454 | Ga0451847_0919454_57_542 | 161 |
| 299 | 3300042007 | Ga0439449_0153548 | Ga0439449_0153548_313_801 | 161 |
| 300 | 3300042876 | Ga0451577_0415623 | Ga0451577_0415623_91_591 | 161 |
| 301 | 3300042876 | Ga0451577_0840480 | Ga0451577_0840480_310_804 | 161 |
| 302 | 3300044656 | Ga0466969_0000238 | Ga0466969_0000238_11576_12067 | 161 |
| 303 | 3300044684 | Ga0466966_0000136 | Ga0466966_0000136_18564_19055 | 161 |
| 304 | 3300044706 | Ga0466964_0030938 | Ga0466964_0030938_1334_1825 | 161 |
| 305 | 3300044712 | Ga0453684_0014466 | Ga0453684_0014466_4741_5235 | 161 |
| 306 | 3300044712 | Ga0453684_0045020 | Ga0453684_0045020_1662_2171 | 161 |
| 307 | 3300044712 | Ga0453684_0069106 | Ga0453684_0069106_3152_3646 | 161 |
| 308 | 3300044735 | Ga0466968_0089514 | Ga0466968_0089514_735_1226 | 161 |
| 309 | 3300044842 | Ga0466957_0029800 | Ga0466957_0029800_454_942 | 161 |
| 310 | 3300045049 | Ga0466959_0000002 | Ga0466959_0000002_274058_274549 | 161 |
| 311 | 3300045049 | Ga0466959_0049931 | Ga0466959_0049931_557_1096 | 161 |
| 312 | 3300046459 | Ga0495629_0613380 | Ga0495629_0613380_191_676 | 161 |
| 313 | 3300046660 | Ga0495625_0727099 | Ga0495625_0727099_70_561 | 161 |
| 314 | 3300046663 | Ga0495635_0037514 | Ga0495635_0037514_2728_3213 | 161 |
| 315 | 3300046675 | Ga0495657_0686119 | Ga0495657_0686119_42_530 | 161 |
| 316 | 3300047319 | Ga0495674_0192530 | Ga0495674_0192530_172_657 | 161 |
| 317 | 3300047320 | Ga0495672_0011784 | Ga0495672_0011784_4628_5113 | 161 |
| 318 | 3300048911 | Ga0496108_0258977 | Ga0496108_0258977_567_1052 | 161 |
| 319 | 3300049568 | Ga0501031_0003432 | Ga0501031_0003432_2030_2518 | 161 |
| 320 | 3300049570 | Ga0501033_0804370 | Ga0501033_0804370_85_570 | 161 |
| 321 | 3300049571 | Ga0501034_0319550 | Ga0501034_0319550_474_959 | 161 |
| 322 | 3300049571 | Ga0501034_0515903 | Ga0501034_0515903_421_909 | 161 |
| 323 | 3300049572 | Ga0501036_0007222 | Ga0501036_0007222_8500_8988 | 161 |
| 324 | 3300049573 | Ga0501037_0009380 | Ga0501037_0009380_3477_3965 | 161 |
| 325 | 3300049574 | Ga0501038_0016633 | Ga0501038_0016633_2097_2585 | 161 |
| 326 | 3300049575 | Ga0501039_0072329 | Ga0501039_0072329_1323_1811 | 161 |
| 327 | 3300049579 | Ga0501043_0012748 | Ga0501043_0012748_461_949 | 161 |
| 328 | 3300049580 | Ga0501046_0024472 | Ga0501046_0024472_158_646 | 161 |
| 329 | 3300049581 | Ga0501047_0306328 | Ga0501047_0306328_448_936 | 161 |
| 330 | 3300049822 | Ga0501035_0136838 | Ga0501035_0136838_1377_1865 | 161 |
| 331 | 3300049823 | Ga0501044_0020153 | Ga0501044_0020153_6234_6722 | 161 |
| 332 | 3300053086 | Ga0500578_0283159 | Ga0500578_0283159_271_762 | 161 |
| 333 | 3300053092 | Ga0500583_0002199 | Ga0500583_0002199_4051_4536 | 161 |
| 334 | 3300053093 | Ga0500651_0252595 | Ga0500651_0252595_386_877 | 161 |
| 335 | 3300053096 | Ga0500641_0009429 | Ga0500641_0009429_1872_2408 | 161 |
| 336 | 3300053131 | Ga0500652_024549 | Ga0500652_024549_675_1160 | 161 |
| 337 | 3300053146 | Ga0500588_0022673 | Ga0500588_0022673_756_1256 | 161 |
| 338 | 3300053147 | Ga0500589_011097 | Ga0500589_011097_3258_3749 | 161 |
| 339 | 3300053156 | Ga0500622_0017284 | Ga0500622_0017284_515_1000 | 161 |
| 340 | 3300053156 | Ga0500622_0186045 | Ga0500622_0186045_168_653 | 161 |
| 341 | 3300053177 | Ga0500636_0172458 | Ga0500636_0172458_534_1025 | 161 |
| 342 | 3300053739 | Ga0500587_038590 | Ga0500587_038590_115_600 | 161 |
| 343 | 3300060353 | Ga0501082_0810771 | Ga0501082_0810771_284_772 | 161 |
| 344 | 3300061719 | Ga0466962_0295636 | Ga0466962_0295636_45_536 | 161 |
| 345 | iso_pu_bacteria | 2818991444 | 2819588649 | 161 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d8p-assembly2.cif.gz_B | crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution | 0.8883 | 3 | 160 |
| 3d8p-assembly1.cif.gz_A | crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution | 0.8825 | 3 | 160 |
| 3d8p-assembly2.cif.gz_B | crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution | 0.8726 | 3 | 160 |
| 3d8p-assembly1.cif.gz_A | crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution | 0.8669 | 3 | 160 |
| 4zbp-assembly1.cif.gz_B | crystal structure of the ampcpr-bound atnudt7 | 0.8595 | 101 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39337_13_151_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9555 | 9 | 145 | 3.40.630.30 |
| af_P39337_13_151_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9357 | 9 | 145 | 3.40.630.30 |
| af_Q94AC8_62_254_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8937 | 64 | 144 | 3.40.630.30 |
| af_Q54IG0_5_154_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8776 | 1 | 153 | 3.40.630.30 |
| 3d8pA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8745 | 3 | 160 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7KL63-F1-model_v4 | GNAT family N-acetyltransferase | 0.9884 | 3 | 141 |
GO:0016747
|
| AF-A0A3L9Z7J4-F1-model_v4 | deleted | 0.9879 | 2 | 161 |
|
| AF-A0A1P8E632-F1-model_v4 | deleted | 0.9876 | 3 | 160 |
|
| AF-A0A369PUW8-F1-model_v4 | GNAT family N-acetyltransferase | 0.9862 | 3 | 161 |
GO:0016747
|
| AF-A0A4R5MLX3-F1-model_v4 | GNAT family N-acetyltransferase | 0.9853 | 3 | 161 |
GO:0008080
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar