F416484

General Info

Members Datasets Scaffolds Average Seq Length
345 214 690 283

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0179965|Ga0451576_0179965_1260_2099
Length 274
Sequence MALPAHEETFQGTGGLKIFFRSWRPTGSPRGVIVICHGVNSHGGQYLWPAQQFAASGLAAYAIDLRGRGKSGGERFYVDDVAEYQLIGIAKSRDPGLKVFLLGHSAGGVVSCSYTLDNQAELAGLICESFAFQVPAPDFALAIIKGLSTVAPRLPVLKLKNEDFSRDPKAVQTLNSDPLTHNEVQPAKTVAALVRANERLKREFPRITIPVFILHGTADKATVPAGSQLFYDTTASKDKTLKLYEGHYHDLLNDVGKDGVLSDIKSWIDKHLAA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
146 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
150 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
151 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
152 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
206 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
207 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 2738543024 Aminobacter sp. AP02 Isolate Unclassified
212 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
213 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
214 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.42
Nodule 0.29
Rhizoplane 1.16
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 5.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0179965 3300045051 Bacteria 2207
2 JGI25150J39212_1000050 3300002774 Bacteria 72743
3 JGI25153J46596_10000036 3300003215 Bacteria 182205
4 rootH1_10091269 3300003323 Bacteria 5654
5 Ga0055537_1001195 3300003773 Bacteria 11039
6 Ga0055530_10000061 3300003791 Bacteria 95363
7 Ga0055540_1001026 3300003792 Bacteria 17931
8 Ga0055540_1003043 3300003792 Bacteria 8364
9 Ga0055531_10000035 3300003794 Bacteria 147414
10 Ga0065165_1035619 3300005262 Bacteria 1527
11 Ga0065707_10089452 3300005295 Bacteria 4363
12 Ga0065707_10192591 3300005295 Bacteria 1353
13 Ga0070670_100004206 3300005331 Bacteria 12050
14 Ga0070670_100162041 3300005331 Bacteria 1938
15 Ga0070677_10006391 3300005333 Bacteria 3914
16 Ga0070680_100001980 3300005336 Bacteria 15068
17 Ga0070682_100010373 3300005337 Bacteria 5287
18 Ga0068868_100445054 3300005338 Bacteria 1126
19 Ga0070668_100005801 3300005347 Bacteria 9160
20 Ga0070675_100004438 3300005354 Bacteria 10693
21 Ga0070675_100015161 3300005354 Bacteria 6086
22 Ga0070675_100041394 3300005354 Bacteria 3764
23 Ga0070675_100256590 3300005354 Bacteria 1531
24 Ga0070671_100346980 3300005355 Bacteria 1267
25 Ga0070674_100055540 3300005356 Bacteria 2743
26 Ga0070673_100032058 3300005364 Bacteria 3951
27 Ga0070673_100166121 3300005364 Bacteria 1880
28 Ga0070673_100341716 3300005364 Bacteria 1326
29 Ga0070713_100028117 3300005436 Unclassified 4437
30 Ga0070705_100004292 3300005440 Bacteria 6948
31 Ga0070694_100005979 3300005444 Bacteria 7379
32 Ga0070694_100081258 3300005444 Bacteria 2254
33 Ga0070708_100027203 3300005445 Bacteria 4905
34 Ga0070708_100194246 3300005445 Unclassified 1899
35 Ga0070678_100018570 3300005456 Bacteria 4509
36 Ga0070678_100433056 3300005456 Unclassified 1149
37 Ga0070681_10000970 3300005458 Bacteria 24216
38 Ga0068867_100141232 3300005459 Bacteria 1882
39 Ga0070706_100032200 3300005467 Bacteria 4836
40 Ga0070707_100112233 3300005468 Bacteria 2644
41 Ga0070698_100015893 3300005471 Bacteria 7947
42 Ga0070698_100022909 3300005471 Bacteria 6530
43 Ga0070698_100025085 3300005471 Bacteria 6214
44 Ga0070698_100039630 3300005471 Unclassified 4847
45 Ga0070699_100011468 3300005518 Bacteria 7655
46 Ga0070699_100100651 3300005518 Bacteria 2533
47 Ga0070699_100356918 3300005518 Unclassified 1317
48 Ga0070679_100000493 3300005530 Bacteria 33616
49 Ga0070679_100288342 3300005530 Unclassified 1593
50 Ga0070684_100051796 3300005535 Bacteria 3568
51 Ga0070672_100000626 3300005543 Bacteria 20778
52 Ga0070672_100029882 3300005543 Bacteria 4090
53 Ga0070672_100426648 3300005543 Bacteria 1139
54 Ga0070695_100147726 3300005545 Bacteria 1637
55 Ga0070696_100002045 3300005546 Bacteria 13231
56 Ga0070665_100274047 3300005548 Bacteria 1689
57 Ga0070704_100002323 3300005549 Bacteria 10648
58 Ga0070704_100006975 3300005549 Bacteria 6701
59 Ga0068855_100003019 3300005563 Bacteria 20587
60 Ga0068856_100016841 3300005614 Bacteria 7083
61 Ga0068859_100011142 3300005617 Bacteria 9040
62 Ga0068859_100155477 3300005617 Bacteria 2364
63 Ga0068859_100242218 3300005617 Bacteria 1893
64 Ga0068864_100074973 3300005618 Bacteria 2953
65 Ga0068864_100514545 3300005618 Bacteria 1153
66 Ga0068863_100026736 3300005841 Bacteria 5502
67 Ga0068863_100300587 3300005841 Bacteria 1557
68 Ga0068860_100013038 3300005843 Bacteria 8160
69 Ga0068860_100096633 3300005843 Bacteria 2816
70 Ga0081539_10036288 3300005985 Bacteria 2952
71 Ga0075365_10009004 3300006038 Bacteria 5709
72 Ga0075368_10007058 3300006042 Bacteria 3954
73 Ga0075363_100010151 3300006048 Bacteria 4455
74 Ga0075364_10004317 3300006051 Bacteria 8154
75 Ga0075364_10033079 3300006051 Bacteria 3326
76 Ga0075364_10035512 3300006051 Bacteria 3221
77 Ga0075364_10041809 3300006051 Bacteria 2977
78 Ga0070716_100252370 3300006173 Bacteria 1202
79 Ga0075362_10021057 3300006177 Bacteria 2731
80 Ga0075367_10004837 3300006178 Bacteria 6637
81 Ga0075367_10009199 3300006178 Bacteria 5154
82 Ga0075367_10098498 3300006178 Bacteria 1785
83 Ga0075367_10370016 3300006178 Unclassified 905
84 Ga0075369_10004139 3300006186 Bacteria 5338
85 Ga0075366_10045235 3300006195 Bacteria 2609
86 Ga0097621_100001714 3300006237 Bacteria 14980
87 Ga0097621_100031026 3300006237 Bacteria 4237
88 Ga0097621_100319680 3300006237 Bacteria 1374
89 Ga0097621_100357712 3300006237 Bacteria 1300
90 Ga0075370_10058761 3300006353 Bacteria 2188
91 Ga0075370_10085867 3300006353 Bacteria 1812
92 Ga0068871_100020120 3300006358 Bacteria 5107
93 Ga0068871_100253596 3300006358 Bacteria 1533
94 Ga0075428_100000019 3300006844 Bacteria 137803
95 Ga0075428_100001448 3300006844 Bacteria 25368
96 Ga0075428_100009562 3300006844 Archaea 10765
97 Ga0075428_100345772 3300006844 Bacteria 1597
98 Ga0075430_100024348 3300006846 Bacteria 5152
99 Ga0075430_100358489 3300006846 Bacteria 1204
100 Ga0075430_100422465 3300006846 Bacteria 1100
101 Ga0075431_100004860 3300006847 Bacteria 13232
102 Ga0075431_100023330 3300006847 Bacteria 6329
103 Ga0075431_100032317 3300006847 Bacteria 5393
104 Ga0075431_100038730 3300006847 Unclassified 4911
105 Ga0075434_100008947 3300006871 Bacteria 9325
106 Ga0075429_100010994 3300006880 Bacteria 7831
107 Ga0075429_100078088 3300006880 Bacteria 2885
108 Ga0068865_100118083 3300006881 Bacteria 1967
109 Ga0068865_100158933 3300006881 Bacteria 1722
110 Ga0097620_100011142 3300006931 Bacteria 9040
111 Ga0097620_100155473 3300006931 Bacteria 2364
112 Ga0097620_100242212 3300006931 Bacteria 1893
113 Ga0075435_100155483 3300007076 Bacteria 1924
114 Ga0105251_10100610 3300009011 Bacteria 1321
115 Ga0105240_10001245 3300009093 Bacteria 44167
116 Ga0111539_10000002 3300009094 Bacteria 983359
117 Ga0111539_10044687 3300009094 Bacteria 5304
118 Ga0105245_10184160 3300009098 Bacteria 1997
119 Ga0105247_10086124 3300009101 Bacteria 1988
120 Ga0114129_10014748 3300009147 Bacteria 11133
121 Ga0114129_10030841 3300009147 Bacteria 7582
122 Ga0114129_10055508 3300009147 Bacteria 5551
123 Ga0114129_10153508 3300009147 Bacteria 3150
124 Ga0114129_10203196 3300009147 Bacteria 2682
125 Ga0105242_10020366 3300009176 Bacteria 5199
126 Ga0105242_10206390 3300009176 Bacteria 1748
127 Ga0105242_10522326 3300009176 Bacteria 1133
128 Ga0105248_10013027 3300009177 Bacteria 9166
129 Ga0105248_10069664 3300009177 Bacteria 3949
130 Ga0105248_10080954 3300009177 Bacteria 3651
131 Ga0105248_10133015 3300009177 Bacteria 2806
132 Ga0105248_10309930 3300009177 Bacteria 1778
133 Ga0105248_10371429 3300009177 Unclassified 1610
134 Ga0105237_10029907 3300009545 Bacteria 5534
135 Ga0163162_10158919 3300013306 Bacteria 2381
136 Ga0163162_10306988 3300013306 Bacteria 1719
137 Ga0163162_10351475 3300013306 Bacteria 1607
138 Ga0157375_10001936 3300013308 Bacteria 17825
139 Ga0157375_10094616 3300013308 Bacteria 3057
140 Ga0157375_10158524 3300013308 Unclassified 2404
141 Ga0163163_10000001 3300014325 Bacteria 622185
142 Ga0163163_10282932 3300014325 Bacteria 1710
143 Ga0157380_10003065 3300014326 Bacteria 11386
144 Ga0157380_10153683 3300014326 Bacteria 1992
145 Ga0157380_10408536 3300014326 Bacteria 1291
146 Ga0157377_10151734 3300014745 Bacteria 1433
147 Ga0157379_10067660 3300014968 Bacteria 3193
148 Ga0157376_10027316 3300014969 Bacteria 4522
149 Ga0157376_10032075 3300014969 Bacteria 4214
150 Ga0157376_10124210 3300014969 Bacteria 2292
151 Ga0157376_10170148 3300014969 Bacteria 1983
152 Ga0163161_10523430 3300017792 Bacteria 969
153 Ga0213876_10002243 3300021384 Bacteria 11407
154 Ga0207425_1000037 3300025245 Bacteria 224645
155 Ga0209565_1000290 3300025263 Bacteria 48865
156 Ga0209673_1003989 3300025273 Bacteria 8207
157 Ga0209025_1000117 3300025294 Bacteria 215073
158 Ga0209564_1001191 3300025295 Bacteria 29869
159 Ga0209564_1024902 3300025295 Bacteria 2031
160 Ga0209758_1000103 3300025297 Bacteria 223968
161 Ga0209758_1047667 3300025297 Bacteria 1531
162 Ga0209050_1000001 3300025298 Bacteria 3563507
163 Ga0209050_1000014 3300025298 Bacteria 774327
164 Ga0209050_1010540 3300025298 Bacteria 4538
165 Ga0209050_1010745 3300025298 Bacteria 4460
166 Ga0207426_1051357 3300025302 Bacteria 1225
167 Ga0209051_1000838 3300025303 Bacteria 31660
168 Ga0209257_1000019 3300025304 Bacteria 774261
169 Ga0209257_1001391 3300025304 Bacteria 28995
170 Ga0209257_1001422 3300025304 Bacteria 28466
171 Ga0207697_10018343 3300025315 Bacteria 2870
172 Ga0207682_10005937 3300025893 Bacteria 4940
173 Ga0207645_10078691 3300025907 Bacteria 2113
174 Ga0207684_10035574 3300025910 Bacteria 4229
175 Ga0207684_10124572 3300025910 Bacteria 2210
176 Ga0207671_10060494 3300025914 Bacteria 2810
177 Ga0207660_10247519 3300025917 Bacteria 1406
178 Ga0207646_10095586 3300025922 Bacteria 2662
179 Ga0207650_10000254 3300025925 Bacteria 58014
180 Ga0207650_10141163 3300025925 Bacteria 1894
181 Ga0207659_10019525 3300025926 Bacteria 4463
182 Ga0207659_10034072 3300025926 Bacteria 3509
183 Ga0207659_10116816 3300025926 Bacteria 2038
184 Ga0207659_10199213 3300025926 Bacteria 1598
185 Ga0207659_10213518 3300025926 Bacteria 1548
186 Ga0207687_10114149 3300025927 Bacteria 2010
187 Ga0207700_10028316 3300025928 Unclassified 3937
188 Ga0207644_10229279 3300025931 Bacteria 1475
189 Ga0207706_10511951 3300025933 Bacteria 1035
190 Ga0207686_10288324 3300025934 Bacteria 1214
191 Ga0207704_10040220 3300025938 Bacteria 2730
192 Ga0207704_10102373 3300025938 Bacteria 1912
193 Ga0207704_10439161 3300025938 Bacteria 1039
194 Ga0207691_10016932 3300025940 Bacteria 6916
195 Ga0207691_10369483 3300025940 Bacteria 1225
196 Ga0207711_10022513 3300025941 Bacteria 5270
197 Ga0207711_10035038 3300025941 Bacteria 4253
198 Ga0207711_10086598 3300025941 Bacteria 2747
199 Ga0207711_10119978 3300025941 Bacteria 2347
200 Ga0207711_10194241 3300025941 Bacteria 1851
201 Ga0207711_10291314 3300025941 Bacteria 1505
202 Ga0207689_10109109 3300025942 Bacteria 2274
203 Ga0207667_10004619 3300025949 Bacteria 16896
204 Ga0207651_10015533 3300025960 Bacteria 4428
205 Ga0207651_10053667 3300025960 Bacteria 2757
206 Ga0207668_10003551 3300025972 Bacteria 9170
207 Ga0207658_10000347 3300025986 Bacteria 45971
208 Ga0207678_10439486 3300026067 Bacteria 1133
209 Ga0207708_10573274 3300026075 Bacteria 954
210 Ga0207641_10014883 3300026088 Bacteria 6378
211 Ga0207641_10054809 3300026088 Bacteria 3385
212 Ga0207641_10068364 3300026088 Bacteria 3046
213 Ga0207641_10546872 3300026088 Bacteria 1129
214 Ga0207648_10012600 3300026089 Bacteria 7911
215 Ga0207676_10232967 3300026095 Bacteria 1647
216 Ga0207683_10005275 3300026121 Bacteria 11092
217 Ga0207683_10007552 3300026121 Bacteria 9317
218 Ga0207683_10427805 3300026121 Bacteria 1220
219 Ga0207683_10493416 3300026121 Unclassified 1131
220 Ga0209813_10000030 3300027866 Bacteria 65385
221 Ga0209974_10050942 3300027876 Bacteria 1391
222 Ga0207428_10000004 3300027907 Bacteria 727800
223 Ga0207428_10000254 3300027907 Bacteria 72967
224 Ga0207428_10179263 3300027907 Unclassified 1601
225 Ga0268264_10067555 3300028381 Bacteria 3018
226 Ga0268264_10161936 3300028381 Bacteria 2016
227 Ga0265337_1005382 3300028556 Bacteria 5085
228 Ga0265338_10032818 3300028800 Bacteria 5054
229 Ga0265339_10001186 3300031249 Bacteria 19711
230 Ga0265316_10022910 3300031344 Bacteria 5255
231 Ga0307408_100262753 3300031548 Unclassified 1429
232 Ga0265314_10000002 3300031711 Bacteria 2092193
233 Ga0307516_10001826 3300031730 Bacteria 29257
234 Ga0307516_10002260 3300031730 Bacteria 25992
235 Ga0307516_10163136 3300031730 Bacteria 1977
236 Ga0307405_10083250 3300031731 Bacteria 2097
237 Ga0307410_10008765 3300031852 Bacteria 5631
238 Ga0307406_10069970 3300031901 Bacteria 2296
239 Ga0307407_10013048 3300031903 Bacteria 4019
240 Ga0307407_10098044 3300031903 Unclassified 1813
241 Ga0307412_10018377 3300031911 Bacteria 4205
242 Ga0307409_100244376 3300031995 Bacteria 1636
243 Ga0307409_100460406 3300031995 Unclassified 1229
244 Ga0307416_100001209 3300032002 Bacteria 13909
245 Ga0307414_10082199 3300032004 Bacteria 2361
246 Ga0307411_10011399 3300032005 Bacteria 4797
247 Ga0307411_10022672 3300032005 Bacteria 3702
248 Ga0307415_100088199 3300032126 Unclassified 2238
249 Ga0373937_0196761 3300036401 Bacteria 1894
250 Ga0373925_0003693 3300037068 Bacteria 11757
251 Ga0451835_0046063 3300041492 Bacteria 1129
252 Ga0451841_1309528 3300041498 Bacteria 2868
253 Ga0451853_0777360 3300041512 Bacteria 40336
254 Ga0439431_0006636 3300041997 Bacteria 2564
255 Ga0450920_000799 3300042122 Bacteria 5082
256 Ga0450920_002492 3300042122 Bacteria 3135
257 Ga0450920_023181 3300042122 Bacteria 1203
258 Ga0450923_000313 3300042125 Bacteria 4969
259 Ga0450923_001523 3300042125 Bacteria 3102
260 Ga0450895_000771 3300042132 Bacteria 2011
261 Ga0450898_007032 3300042134 Bacteria 1745
262 Ga0439446_0010396 3300042156 Bacteria 2504
263 Ga0439434_0022136 3300042435 Bacteria 1910
264 Ga0439435_0029002 3300042436 Unclassified 1491
265 Ga0450918_006520 3300042531 Bacteria 2078
266 Ga0495638_0030407 3300046460 Bacteria 3477
267 Ga0495642_0027654 3300046528 Bacteria 2257
268 Ga0495609_0097542 3300046538 Bacteria 1275
269 Ga0495649_0211851 3300046694 Bacteria 1004
270 Ga0495674_0527879 3300047319 Bacteria 942
271 Ga0495675_0058724 3300047444 Bacteria 2439
272 Ga0496104_0572674 3300048907 Bacteria 1040
273 Ga0496108_0311860 3300048911 Bacteria 1371
274 Ga0496114_0050445 3300048917 Bacteria 3464
275 Ga0496114_0417016 3300048917 Bacteria 1189
276 Ga0496117_0012084 3300048920 Bacteria 7662
277 Ga0496120_0027179 3300048923 Bacteria 3524
278 Ga0496121_0000001 3300048924 Bacteria 1830318
279 Ga0496121_0070916 3300048924 Bacteria 2804
280 Ga0496122_0057442 3300048925 Bacteria 2889
281 Ga0496123_0027294 3300048926 Bacteria 4255
282 Ga0496124_0134375 3300048927 Bacteria 1960
283 Ga0496125_0000001 3300048928 Bacteria 1766138
284 Ga0501032_0086268 3300049569 Bacteria 2086
285 Ga0501034_0025741 3300049571 Bacteria 5992
286 Ga0501036_0119472 3300049572 Bacteria 2226
287 Ga0501037_0020291 3300049573 Bacteria 4906
288 Ga0501047_0032990 3300049581 Bacteria 4999
289 Ga0501067_0219221 3300049583 Bacteria 1059
290 Ga0501068_0008915 3300049584 Bacteria 5598
291 Ga0501070_0049291 3300049586 Bacteria 3497
292 Ga0501073_0029666 3300049589 Bacteria 3908
293 Ga0501075_0000923 3300049591 Bacteria 18653
294 Ga0501077_0002233 3300049593 Bacteria 11684
295 Ga0501080_0004041 3300049742 Bacteria 12993
296 Ga0501080_0005043 3300049742 Bacteria 11764
297 Ga0501081_0021148 3300049743 Bacteria 4342
298 Ga0501083_0052677 3300049744 Bacteria 2734
299 Ga0501044_0117360 3300049823 Bacteria 2665
300 nmdc:mga03683_129_c1 3300050489 Bacteria 25227
301 nmdc:mga03n38_2478_c1 3300050490 Bacteria 5710
302 nmdc:mga00v17_197315_c1 3300050491 Bacteria 1301
303 nmdc:mga00v17_31431_c1 3300050491 Bacteria 3131
304 nmdc:mga00v17_5527_c1 3300050491 Bacteria 6661
305 nmdc:mga0k408_40697_c1 3300050493 Bacteria 2675
306 nmdc:mga06z11_122_c1 3300050494 Bacteria 32025
307 nmdc:mga06z11_233963_c1 3300050494 Unclassified 1077
308 nmdc:mga06z11_67433_c1 3300050494 Bacteria 1883
309 nmdc:mga04h51_544_c1 3300050495 Bacteria 8972
310 nmdc:mga07m45_21619_c1 3300050496 Unclassified 3505
311 nmdc:mga07m45_32_c1 3300050496 Bacteria 78063
312 nmdc:mga07m45_50336_c1 3300050496 Bacteria 2347
313 nmdc:mga07m45_58943_c1 3300050496 Bacteria 2172
314 nmdc:mga05p37_193640_c1 3300050507 Bacteria 2466
315 nmdc:mga05p37_24070_c1 3300050507 Bacteria 7396
316 nmdc:mga05p37_5055_c1 3300050507 Bacteria 15461
317 nmdc:mga05p37_63120_c1 3300050507 Bacteria 4559
318 nmdc:mga05p37_798406_c1 3300050507 Bacteria 1033
319 nmdc:mga09592_121097_c1 3300050508 Bacteria 2248
320 nmdc:mga09592_8849_c1 3300050508 Bacteria 8189
321 nmdc:mga0qj67_7047_c1 3300050509 Bacteria 8289
322 nmdc:mga06r32_26226_c1 3300050510 Bacteria 5430
323 nmdc:mga06r32_30374_c1 3300050510 Bacteria 5069
324 nmdc:mga06r32_32081_c1 3300050510 Bacteria 4939
325 nmdc:mga06r32_47397_c1 3300050510 Bacteria 4105
326 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
327 nmdc:mga08y16_43936_c1 3300050511 Bacteria 4682
328 nmdc:mga08y16_505_c1 3300050511 Bacteria 36001
329 nmdc:mga0rr50_452429_c1 3300050513 Bacteria 1089
330 nmdc:mga0sz30_5603_c1 3300050516 Bacteria 4614
331 nmdc:mga0sz30_87766_c1 3300050516 Bacteria 1351
332 Ga0500635_0094975 3300053080 Bacteria 1090
333 Ga0500641_0024423 3300053096 Bacteria 2330
334 Ga0500595_021029 3300053119 Bacteria 2336
335 Ga0500595_039551 3300053119 Bacteria 1525
336 Ga0500607_000721 3300053121 Bacteria 31928
337 Ga0500626_085055 3300053128 Bacteria 1394
338 Ga0500652_000035 3300053131 Bacteria 74022
339 Ga0500616_0058852 3300053153 Bacteria 1997
340 Ga0500636_0008423 3300053177 Bacteria 5980
341 Ga0501082_0000991 3300060353 Bacteria 25066
342 2739310586 2738543024 Bacteria 5603683
343 2840881553 2840878972 Bacteria 5483153
344 2885317664 2885312484 Bacteria 6415165
345 2929139661 2929138655 Bacteria 5810547
346 Ga0451576_0179965
347 JGI25150J39212_1000050
348 JGI25153J46596_10000036
349 rootH1_10091269
350 Ga0055537_1001195
351 Ga0055530_10000061
352 Ga0055540_1001026
353 Ga0055540_1003043
354 Ga0055531_10000035
355 Ga0065165_1035619
356 Ga0065707_10089452
357 Ga0065707_10192591
358 Ga0070670_100004206
359 Ga0070670_100162041
360 Ga0070677_10006391
361 Ga0070680_100001980
362 Ga0070682_100010373
363 Ga0068868_100445054
364 Ga0070668_100005801
365 Ga0070675_100004438
366 Ga0070675_100015161
367 Ga0070675_100041394
368 Ga0070675_100256590
369 Ga0070671_100346980
370 Ga0070674_100055540
371 Ga0070673_100032058
372 Ga0070673_100166121
373 Ga0070673_100341716
374 Ga0070713_100028117
375 Ga0070705_100004292
376 Ga0070694_100005979
377 Ga0070694_100081258
378 Ga0070708_100027203
379 Ga0070708_100194246
380 Ga0070678_100018570
381 Ga0070678_100433056
382 Ga0070681_10000970
383 Ga0068867_100141232
384 Ga0070706_100032200
385 Ga0070707_100112233
386 Ga0070698_100015893
387 Ga0070698_100022909
388 Ga0070698_100025085
389 Ga0070698_100039630
390 Ga0070699_100011468
391 Ga0070699_100100651
392 Ga0070699_100356918
393 Ga0070679_100000493
394 Ga0070679_100288342
395 Ga0070684_100051796
396 Ga0070672_100000626
397 Ga0070672_100029882
398 Ga0070672_100426648
399 Ga0070695_100147726
400 Ga0070696_100002045
401 Ga0070665_100274047
402 Ga0070704_100002323
403 Ga0070704_100006975
404 Ga0068855_100003019
405 Ga0068856_100016841
406 Ga0068859_100011142
407 Ga0068859_100155477
408 Ga0068859_100242218
409 Ga0068864_100074973
410 Ga0068864_100514545
411 Ga0068863_100026736
412 Ga0068863_100300587
413 Ga0068860_100013038
414 Ga0068860_100096633
415 Ga0081539_10036288
416 Ga0075365_10009004
417 Ga0075368_10007058
418 Ga0075363_100010151
419 Ga0075364_10004317
420 Ga0075364_10033079
421 Ga0075364_10035512
422 Ga0075364_10041809
423 Ga0070716_100252370
424 Ga0075362_10021057
425 Ga0075367_10004837
426 Ga0075367_10009199
427 Ga0075367_10098498
428 Ga0075367_10370016
429 Ga0075369_10004139
430 Ga0075366_10045235
431 Ga0097621_100001714
432 Ga0097621_100031026
433 Ga0097621_100319680
434 Ga0097621_100357712
435 Ga0075370_10058761
436 Ga0075370_10085867
437 Ga0068871_100020120
438 Ga0068871_100253596
439 Ga0075428_100000019
440 Ga0075428_100001448
441 Ga0075428_100009562
442 Ga0075428_100345772
443 Ga0075430_100024348
444 Ga0075430_100358489
445 Ga0075430_100422465
446 Ga0075431_100004860
447 Ga0075431_100023330
448 Ga0075431_100032317
449 Ga0075431_100038730
450 Ga0075434_100008947
451 Ga0075429_100010994
452 Ga0075429_100078088
453 Ga0068865_100118083
454 Ga0068865_100158933
455 Ga0097620_100011142
456 Ga0097620_100155473
457 Ga0097620_100242212
458 Ga0075435_100155483
459 Ga0105251_10100610
460 Ga0105240_10001245
461 Ga0111539_10000002
462 Ga0111539_10044687
463 Ga0105245_10184160
464 Ga0105247_10086124
465 Ga0114129_10014748
466 Ga0114129_10030841
467 Ga0114129_10055508
468 Ga0114129_10153508
469 Ga0114129_10203196
470 Ga0105242_10020366
471 Ga0105242_10206390
472 Ga0105242_10522326
473 Ga0105248_10013027
474 Ga0105248_10069664
475 Ga0105248_10080954
476 Ga0105248_10133015
477 Ga0105248_10309930
478 Ga0105248_10371429
479 Ga0105237_10029907
480 Ga0163162_10158919
481 Ga0163162_10306988
482 Ga0163162_10351475
483 Ga0157375_10001936
484 Ga0157375_10094616
485 Ga0157375_10158524
486 Ga0163163_10000001
487 Ga0163163_10282932
488 Ga0157380_10003065
489 Ga0157380_10153683
490 Ga0157380_10408536
491 Ga0157377_10151734
492 Ga0157379_10067660
493 Ga0157376_10027316
494 Ga0157376_10032075
495 Ga0157376_10124210
496 Ga0157376_10170148
497 Ga0163161_10523430
498 Ga0213876_10002243
499 Ga0207425_1000037
500 Ga0209565_1000290
501 Ga0209673_1003989
502 Ga0209025_1000117
503 Ga0209564_1001191
504 Ga0209564_1024902
505 Ga0209758_1000103
506 Ga0209758_1047667
507 Ga0209050_1000001
508 Ga0209050_1000014
509 Ga0209050_1010540
510 Ga0209050_1010745
511 Ga0207426_1051357
512 Ga0209051_1000838
513 Ga0209257_1000019
514 Ga0209257_1001391
515 Ga0209257_1001422
516 Ga0207697_10018343
517 Ga0207682_10005937
518 Ga0207645_10078691
519 Ga0207684_10035574
520 Ga0207684_10124572
521 Ga0207671_10060494
522 Ga0207660_10247519
523 Ga0207646_10095586
524 Ga0207650_10000254
525 Ga0207650_10141163
526 Ga0207659_10019525
527 Ga0207659_10034072
528 Ga0207659_10116816
529 Ga0207659_10199213
530 Ga0207659_10213518
531 Ga0207687_10114149
532 Ga0207700_10028316
533 Ga0207644_10229279
534 Ga0207706_10511951
535 Ga0207686_10288324
536 Ga0207704_10040220
537 Ga0207704_10102373
538 Ga0207704_10439161
539 Ga0207691_10016932
540 Ga0207691_10369483
541 Ga0207711_10022513
542 Ga0207711_10035038
543 Ga0207711_10086598
544 Ga0207711_10119978
545 Ga0207711_10194241
546 Ga0207711_10291314
547 Ga0207689_10109109
548 Ga0207667_10004619
549 Ga0207651_10015533
550 Ga0207651_10053667
551 Ga0207668_10003551
552 Ga0207658_10000347
553 Ga0207678_10439486
554 Ga0207708_10573274
555 Ga0207641_10014883
556 Ga0207641_10054809
557 Ga0207641_10068364
558 Ga0207641_10546872
559 Ga0207648_10012600
560 Ga0207676_10232967
561 Ga0207683_10005275
562 Ga0207683_10007552
563 Ga0207683_10427805
564 Ga0207683_10493416
565 Ga0209813_10000030
566 Ga0209974_10050942
567 Ga0207428_10000004
568 Ga0207428_10000254
569 Ga0207428_10179263
570 Ga0268264_10067555
571 Ga0268264_10161936
572 Ga0265337_1005382
573 Ga0265338_10032818
574 Ga0265339_10001186
575 Ga0265316_10022910
576 Ga0307408_100262753
577 Ga0265314_10000002
578 Ga0307516_10001826
579 Ga0307516_10002260
580 Ga0307516_10163136
581 Ga0307405_10083250
582 Ga0307410_10008765
583 Ga0307406_10069970
584 Ga0307407_10013048
585 Ga0307407_10098044
586 Ga0307412_10018377
587 Ga0307409_100244376
588 Ga0307409_100460406
589 Ga0307416_100001209
590 Ga0307414_10082199
591 Ga0307411_10011399
592 Ga0307411_10022672
593 Ga0307415_100088199
594 Ga0373937_0196761
595 Ga0373925_0003693
596 Ga0451835_0046063
597 Ga0451841_1309528
598 Ga0451853_0777360
599 Ga0439431_0006636
600 Ga0450920_000799
601 Ga0450920_002492
602 Ga0450920_023181
603 Ga0450923_000313
604 Ga0450923_001523
605 Ga0450895_000771
606 Ga0450898_007032
607 Ga0439446_0010396
608 Ga0439434_0022136
609 Ga0439435_0029002
610 Ga0450918_006520
611 Ga0495638_0030407
612 Ga0495642_0027654
613 Ga0495609_0097542
614 Ga0495649_0211851
615 Ga0495674_0527879
616 Ga0495675_0058724
617 Ga0496104_0572674
618 Ga0496108_0311860
619 Ga0496114_0050445
620 Ga0496114_0417016
621 Ga0496117_0012084
622 Ga0496120_0027179
623 Ga0496121_0000001
624 Ga0496121_0070916
625 Ga0496122_0057442
626 Ga0496123_0027294
627 Ga0496124_0134375
628 Ga0496125_0000001
629 Ga0501032_0086268
630 Ga0501034_0025741
631 Ga0501036_0119472
632 Ga0501037_0020291
633 Ga0501047_0032990
634 Ga0501067_0219221
635 Ga0501068_0008915
636 Ga0501070_0049291
637 Ga0501073_0029666
638 Ga0501075_0000923
639 Ga0501077_0002233
640 Ga0501080_0004041
641 Ga0501080_0005043
642 Ga0501081_0021148
643 Ga0501083_0052677
644 Ga0501044_0117360
645 nmdc:mga03683_129_c1
646 nmdc:mga03n38_2478_c1
647 nmdc:mga00v17_197315_c1
648 nmdc:mga00v17_31431_c1
649 nmdc:mga00v17_5527_c1
650 nmdc:mga0k408_40697_c1
651 nmdc:mga06z11_122_c1
652 nmdc:mga06z11_233963_c1
653 nmdc:mga06z11_67433_c1
654 nmdc:mga04h51_544_c1
655 nmdc:mga07m45_21619_c1
656 nmdc:mga07m45_32_c1
657 nmdc:mga07m45_50336_c1
658 nmdc:mga07m45_58943_c1
659 nmdc:mga05p37_193640_c1
660 nmdc:mga05p37_24070_c1
661 nmdc:mga05p37_5055_c1
662 nmdc:mga05p37_63120_c1
663 nmdc:mga05p37_798406_c1
664 nmdc:mga09592_121097_c1
665 nmdc:mga09592_8849_c1
666 nmdc:mga0qj67_7047_c1
667 nmdc:mga06r32_26226_c1
668 nmdc:mga06r32_30374_c1
669 nmdc:mga06r32_32081_c1
670 nmdc:mga06r32_47397_c1
671 nmdc:mga08y16_2_c1
672 nmdc:mga08y16_43936_c1
673 nmdc:mga08y16_505_c1
674 nmdc:mga0rr50_452429_c1
675 nmdc:mga0sz30_5603_c1
676 nmdc:mga0sz30_87766_c1
677 Ga0500635_0094975
678 Ga0500641_0024423
679 Ga0500595_021029
680 Ga0500595_039551
681 Ga0500607_000721
682 Ga0500626_085055
683 Ga0500652_000035
684 Ga0500616_0058852
685 Ga0500636_0008423
686 Ga0501082_0000991
687 2739310586
688 2840881553
689 2885317664
690 2929139661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

27

256

0.97

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

31

254

0.8

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

33

260

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.9763 1 276
7p0y-assembly1.cif.gz_A crystal structure of mtbmgl k74a (substrate analog complex) 0.9729 1 276
7p0y-assembly2.cif.gz_B crystal structure of mtbmgl k74a (substrate analog complex) 0.9704 5 276
6eic-assembly3.cif.gz_B crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.9695 1 276
6eic-assembly1.cif.gz_C crystal structure of rv0183, a monoglyceride lipase from mycobacterium tuberculosis 0.9662 1 276
ID Description Score Start End Superfamily
af_Q4CSM0_30_309_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9705 8 276 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9694 1 276 3.40.50.1820
af_O07427_2_279_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.966 1 276 3.40.50.1820
af_A4I6N9_26_311_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9648 8 275 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9539 5 134 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A529KHK2-F1-model_v4 Alpha/beta hydrolase 0.9898 5 204 GO:0016787
AF-A0A7W1S6N4-F1-model_v4 Alpha/beta hydrolase 0.9842 3 274 GO:0016787
AF-A0A3M1EJD1-F1-model_v4 Alpha/beta fold hydrolase 0.9795 3 129 GO:0016787
AF-A0A3L7XS69-F1-model_v4 Alpha/beta fold hydrolase 0.976 1 129 GO:0016020
GO:0016787
AF-A0A534IFS6-F1-model_v4 Lysophospholipase 0.9754 3 275

Map