F416615

General Info

Members Datasets Scaffolds Average Seq Length
346 185 692 254

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10037549|rootH2_100375492
Length 293
Sequence MSKITVLSGIECEVTACAACLLRVYGDSSVHSKRQFGFMIPLRERLKNIRLVRKLIYAVVGIISYPGLTIVNRLKISGTENLRDLPKGNVLFVSNHQTYFADVITFLHIFCAVKWRKKNKLGLPYYLLNPFTNVYYVAAEETMRATWVSRLFTLGGALTVKRTWNTGSSEVRRGLDPSDTRKIYRALENNWVITFPQGTTKAFAPGRKGTAHIIKQTKPIVVPVVIGGFWRAFNKKGLKFKKKGTLLTVTFKKPLDIDYDAPVECILDQIMDAIEQSKKYMMKGPHHWIKEPI

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
172 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
173 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
174 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
175 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
184 2738541278 Niastella sp. CF465 Isolate Unclassified
185 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 0.58
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 19.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10037549 3300003320 Bacteria 4298
2 rootH2_10008746 3300003320 Bacteria 51850
3 rootL2_10166082 3300003322 Bacteria 3603
4 rootH1_10103233 3300003323 Bacteria 3552
5 rootH1_10210563 3300003323 Bacteria 3391
6 Ga0065715_10057358 3300005293 Bacteria 918
7 Ga0070658_10013517 3300005327 Bacteria 6551
8 Ga0070658_10016528 3300005327 Bacteria 5905
9 Ga0070658_10028155 3300005327 Bacteria 4509
10 Ga0070658_10034381 3300005327 Bacteria 4078
11 Ga0070658_10323278 3300005327 Bacteria 1318
12 Ga0070676_10039344 3300005328 Bacteria 2735
13 Ga0070683_100059732 3300005329 Bacteria 3543
14 Ga0070683_100083183 3300005329 Bacteria 2998
15 Ga0070683_100438860 3300005329 Bacteria 1246
16 Ga0070670_100123766 3300005331 Bacteria 2231
17 Ga0070670_100346242 3300005331 Bacteria 1305
18 Ga0070677_10005775 3300005333 Bacteria 4092
19 Ga0068869_100010056 3300005334 Bacteria 6154
20 Ga0068869_100015233 3300005334 Bacteria 5153
21 Ga0070666_10038624 3300005335 Bacteria 3178
22 Ga0070680_100005194 3300005336 Bacteria 9854
23 Ga0070680_100111747 3300005336 Bacteria 2275
24 Ga0070682_100090111 3300005337 Unclassified 2005
25 Ga0070682_100218505 3300005337 Unclassified 1355
26 Ga0068868_100021369 3300005338 Bacteria 4873
27 Ga0068868_100049396 3300005338 Unclassified 3301
28 Ga0068868_100083249 3300005338 Bacteria 2568
29 Ga0068868_100198327 3300005338 Bacteria 1672
30 Ga0070660_100003861 3300005339 Bacteria 10345
31 Ga0070689_100334344 3300005340 Bacteria 1268
32 Ga0070691_10141474 3300005341 Bacteria 1226
33 Ga0070661_100034646 3300005344 Bacteria 3662
34 Ga0070692_10235336 3300005345 Unclassified 1089
35 Ga0070668_100619992 3300005347 Unclassified 948
36 Ga0070668_100669815 3300005347 Bacteria 913
37 Ga0070668_100755994 3300005347 Unclassified 861
38 Ga0070669_100016654 3300005353 Bacteria 5246
39 Ga0070675_100040779 3300005354 Bacteria 3791
40 Ga0070674_100079865 3300005356 Bacteria 2334
41 Ga0070673_100043393 3300005364 Unclassified 3475
42 Ga0070673_100052494 3300005364 Bacteria 3199
43 Ga0070673_100130582 3300005364 Unclassified 2107
44 Ga0070673_100311123 3300005364 Bacteria 1389
45 Ga0070688_100095363 3300005365 Unclassified 1952
46 Ga0070667_100154966 3300005367 Unclassified 2015
47 Ga0070663_100041481 3300005455 Bacteria 3228
48 Ga0070663_100124683 3300005455 Bacteria 1950
49 Ga0070678_100202204 3300005456 Bacteria 1640
50 Ga0070662_100024255 3300005457 Bacteria 4176
51 Ga0070662_100043831 3300005457 Unclassified 3203
52 Ga0070662_100242182 3300005457 Unclassified 1447
53 Ga0070681_10004564 3300005458 Bacteria 13211
54 Ga0070681_10194791 3300005458 Bacteria 1946
55 Ga0068867_100059008 3300005459 Bacteria 2844
56 Ga0068867_100132968 3300005459 Bacteria 1936
57 Ga0068867_100166410 3300005459 Unclassified 1743
58 Ga0070679_100000261 3300005530 Bacteria 44142
59 Ga0070679_100009098 3300005530 Bacteria 9373
60 Ga0070679_100062261 3300005530 Bacteria 3719
61 Ga0070679_100306363 3300005530 Bacteria 1539
62 Ga0070679_100598643 3300005530 Bacteria 1046
63 Ga0070684_100008747 3300005535 Bacteria 7939
64 Ga0070684_100012168 3300005535 Bacteria 6882
65 Ga0070684_100206800 3300005535 Bacteria 1789
66 Ga0068853_100380158 3300005539 Bacteria 1319
67 Ga0068853_100706307 3300005539 Bacteria 962
68 Ga0070672_100239224 3300005543 Bacteria 1527
69 Ga0070665_101004034 3300005548 Bacteria 847
70 Ga0068855_100000133 3300005563 Bacteria 94906
71 Ga0068855_100003486 3300005563 Bacteria 19264
72 Ga0068855_100039976 3300005563 Bacteria 5567
73 Ga0068855_100131520 3300005563 Bacteria 2858
74 Ga0068855_100819482 3300005563 Unclassified 988
75 Ga0070664_100024674 3300005564 Bacteria 4977
76 Ga0070664_100177549 3300005564 Bacteria 1891
77 Ga0068857_100021480 3300005577 Bacteria 5680
78 Ga0068857_100120230 3300005577 Unclassified 2364
79 Ga0068854_100033071 3300005578 Bacteria 3603
80 Ga0068854_100082780 3300005578 Bacteria 2372
81 Ga0068854_100456219 3300005578 Bacteria 1069
82 Ga0068856_100009626 3300005614 Bacteria 9382
83 Ga0068856_100233357 3300005614 Unclassified 1855
84 Ga0070702_100004609 3300005615 Bacteria 6315
85 Ga0068852_100111941 3300005616 Bacteria 2483
86 Ga0068852_100120192 3300005616 Bacteria 2403
87 Ga0068852_100370672 3300005616 Bacteria 1403
88 Ga0068852_100431338 3300005616 Unclassified 1302
89 Ga0068852_100461255 3300005616 Unclassified 1260
90 Ga0068859_100059182 3300005617 Bacteria 3859
91 Ga0068859_100095338 3300005617 Bacteria 3028
92 Ga0068864_100009579 3300005618 Bacteria 7987
93 Ga0068864_100100436 3300005618 Bacteria 2565
94 Ga0068866_10080186 3300005718 Unclassified 1751
95 Ga0068861_100040421 3300005719 Bacteria 3488
96 Ga0068851_10066229 3300005834 Bacteria 1861
97 Ga0068851_10104674 3300005834 Bacteria 1505
98 Ga0068863_100565242 3300005841 Unclassified 1124
99 Ga0068858_100069820 3300005842 Bacteria 3256
100 Ga0081539_10017891 3300005985 Unclassified 4947
101 Ga0070715_10017977 3300006163 Unclassified 2686
102 Ga0075366_10355655 3300006195 Unclassified 899
103 Ga0097621_100394025 3300006237 Bacteria 1239
104 Ga0068871_100101079 3300006358 Bacteria 2416
105 Ga0068871_100288332 3300006358 Bacteria 1438
106 Ga0075434_100078349 3300006871 Bacteria 3300
107 Ga0068865_100132761 3300006881 Unclassified 1867
108 Ga0097620_100059181 3300006931 Bacteria 3859
109 Ga0097620_100095329 3300006931 Bacteria 3028
110 Ga0105240_10000398 3300009093 Bacteria 81045
111 Ga0111539_10098041 3300009094 Bacteria 3443
112 Ga0114129_10043562 3300009147 Bacteria 6314
113 Ga0105242_10390711 3300009176 Bacteria 1296
114 Ga0105237_10038989 3300009545 Bacteria 4797
115 Ga0105237_10040645 3300009545 Bacteria 4690
116 Ga0105237_10054705 3300009545 Bacteria 3999
117 Ga0105237_10130701 3300009545 Bacteria 2505
118 Ga0105238_10820286 3300009551 Bacteria 946
119 Ga0105249_10426335 3300009553 Bacteria 1361
120 Ga0105239_10000436 3300010375 Bacteria 61031
121 Ga0105239_10007449 3300010375 Bacteria 12560
122 Ga0105239_10039925 3300010375 Bacteria 5141
123 Ga0105239_10844747 3300010375 Unclassified 1050
124 Ga0105246_10400387 3300011119 Bacteria 1140
125 Ga0157373_10001316 3300013100 Bacteria 18999
126 Ga0157373_10010595 3300013100 Bacteria 6783
127 Ga0157373_10072736 3300013100 Bacteria 2426
128 Ga0157373_10195207 3300013100 Bacteria 1427
129 Ga0157371_10001082 3300013102 Bacteria 29495
130 Ga0157371_10008623 3300013102 Bacteria 8098
131 Ga0157371_10009339 3300013102 Bacteria 7731
132 Ga0157371_10049311 3300013102 Bacteria 2992
133 Ga0157370_10000878 3300013104 Bacteria 38164
134 Ga0157370_10308825 3300013104 Bacteria 1459
135 Ga0157370_10311558 3300013104 Bacteria 1452
136 Ga0157370_10402050 3300013104 Bacteria 1261
137 Ga0157369_10005162 3300013105 Bacteria 15281
138 Ga0157369_10012427 3300013105 Bacteria 9664
139 Ga0157369_10074426 3300013105 Bacteria 3642
140 Ga0157374_10000500 3300013296 Bacteria 35513
141 Ga0157374_10010154 3300013296 Bacteria 8090
142 Ga0157374_10066227 3300013296 Bacteria 3395
143 Ga0157374_10191662 3300013296 Unclassified 2000
144 Ga0157378_10002605 3300013297 Bacteria 16048
145 Ga0157378_10030927 3300013297 Bacteria 4726
146 Ga0157378_10241128 3300013297 Unclassified 1727
147 Ga0163162_10656638 3300013306 Bacteria 1172
148 Ga0157372_10011232 3300013307 Bacteria 9525
149 Ga0157372_10011890 3300013307 Bacteria 9274
150 Ga0157372_10038613 3300013307 Bacteria 5269
151 Ga0157372_10130666 3300013307 Bacteria 2889
152 Ga0157372_10137347 3300013307 Bacteria 2816
153 Ga0157372_10148644 3300013307 Unclassified 2703
154 Ga0157372_10217276 3300013307 Bacteria 2216
155 Ga0157372_10260067 3300013307 Bacteria 2016
156 Ga0157372_10281678 3300013307 Bacteria 1933
157 Ga0157372_10408673 3300013307 Bacteria 1582
158 Ga0157372_10431495 3300013307 Unclassified 1536
159 Ga0157372_10643544 3300013307 Unclassified 1235
160 Ga0157372_10752098 3300013307 Bacteria 1133
161 Ga0157375_10069257 3300013308 Bacteria 3533
162 Ga0157375_10120804 3300013308 Bacteria 2729
163 Ga0157375_10207699 3300013308 Unclassified 2115
164 Ga0157375_10336673 3300013308 Bacteria 1674
165 Ga0163163_10001732 3300014325 Bacteria 18387
166 Ga0163163_10021998 3300014325 Bacteria 6029
167 Ga0157380_10253711 3300014326 Bacteria 1594
168 Ga0157377_10016854 3300014745 Bacteria 3767
169 Ga0157377_10060645 3300014745 Bacteria 2160
170 Ga0157379_10096389 3300014968 Bacteria 2655
171 Ga0157376_10067379 3300014969 Unclassified 3028
172 Ga0163161_10074998 3300017792 Unclassified 2481
173 Ga0207682_10033560 3300025893 Bacteria 2067
174 Ga0207680_10430469 3300025903 Unclassified 935
175 Ga0207647_10056227 3300025904 Bacteria 2415
176 Ga0207685_10047217 3300025905 Unclassified 1642
177 Ga0207645_10003154 3300025907 Bacteria 12623
178 Ga0207705_10003765 3300025909 Bacteria 11554
179 Ga0207705_10005713 3300025909 Bacteria 9291
180 Ga0207705_10056327 3300025909 Unclassified 2834
181 Ga0207705_10296309 3300025909 Bacteria 1240
182 Ga0207654_10016756 3300025911 Bacteria 3819
183 Ga0207707_10007443 3300025912 Bacteria 9540
184 Ga0207707_10107770 3300025912 Bacteria 2436
185 Ga0207695_10000076 3300025913 Bacteria 307969
186 Ga0207695_10000090 3300025913 Bacteria 272143
187 Ga0207695_10004647 3300025913 Bacteria 18602
188 Ga0207671_10121335 3300025914 Bacteria 1998
189 Ga0207671_10132128 3300025914 Bacteria 1917
190 Ga0207671_10153662 3300025914 Unclassified 1779
191 Ga0207671_10264208 3300025914 Unclassified 1355
192 Ga0207660_10002827 3300025917 Bacteria 11380
193 Ga0207660_10012518 3300025917 Bacteria 5553
194 Ga0207657_10015899 3300025919 Bacteria 7269
195 Ga0207657_10019043 3300025919 Bacteria 6531
196 Ga0207657_10051731 3300025919 Bacteria 3569
197 Ga0207649_10082855 3300025920 Unclassified 2080
198 Ga0207652_10000011 3300025921 Bacteria 246742
199 Ga0207652_10000271 3300025921 Bacteria 53923
200 Ga0207652_10009908 3300025921 Bacteria 7668
201 Ga0207652_10082587 3300025921 Bacteria 2811
202 Ga0207681_10300312 3300025923 Bacteria 1270
203 Ga0207681_10457469 3300025923 Unclassified 1039
204 Ga0207694_10600448 3300025924 Bacteria 926
205 Ga0207650_10114691 3300025925 Bacteria 2090
206 Ga0207650_10404551 3300025925 Bacteria 1130
207 Ga0207650_10674164 3300025925 Bacteria 872
208 Ga0207659_10154202 3300025926 Bacteria 1797
209 Ga0207644_10517603 3300025931 Bacteria 985
210 Ga0207690_10021834 3300025932 Unclassified 3976
211 Ga0207690_10077427 3300025932 Bacteria 2312
212 Ga0207690_10193144 3300025932 Bacteria 1541
213 Ga0207706_10003434 3300025933 Bacteria 15130
214 Ga0207706_10017089 3300025933 Bacteria 6542
215 Ga0207686_10476629 3300025934 Unclassified 964
216 Ga0207670_10034767 3300025936 Unclassified 3261
217 Ga0207670_10102911 3300025936 Bacteria 2043
218 Ga0207670_10459165 3300025936 Unclassified 1028
219 Ga0207669_10027480 3300025937 Bacteria 3116
220 Ga0207691_10008663 3300025940 Bacteria 9761
221 Ga0207691_10008798 3300025940 Bacteria 9682
222 Ga0207689_10004902 3300025942 Bacteria 12069
223 Ga0207689_10030714 3300025942 Bacteria 4477
224 Ga0207689_10051051 3300025942 Bacteria 3409
225 Ga0207661_10005351 3300025944 Bacteria 9039
226 Ga0207661_10027163 3300025944 Bacteria 4370
227 Ga0207661_10380852 3300025944 Bacteria 1277
228 Ga0207679_10004088 3300025945 Bacteria 9054
229 Ga0207667_10000453 3300025949 Bacteria 54929
230 Ga0207667_10003372 3300025949 Bacteria 19712
231 Ga0207667_10100501 3300025949 Bacteria 2983
232 Ga0207651_10068405 3300025960 Unclassified 2504
233 Ga0207651_10096017 3300025960 Unclassified 2185
234 Ga0207712_10439778 3300025961 Unclassified 1104
235 Ga0207668_10520300 3300025972 Bacteria 1026
236 Ga0207640_10006764 3300025981 Bacteria 6308
237 Ga0207640_10295431 3300025981 Bacteria 1279
238 Ga0207640_10554257 3300025981 Unclassified 966
239 Ga0207658_10146003 3300025986 Bacteria 1921
240 Ga0207658_10193458 3300025986 Unclassified 1693
241 Ga0207677_10079853 3300026023 Bacteria 2341
242 Ga0207703_10048396 3300026035 Bacteria 3432
243 Ga0207639_10228519 3300026041 Bacteria 1611
244 Ga0207639_10260468 3300026041 Unclassified 1517
245 Ga0207639_10649353 3300026041 Bacteria 976
246 Ga0207678_10085311 3300026067 Bacteria 2700
247 Ga0207702_10177807 3300026078 Unclassified 1957
248 Ga0207648_10139584 3300026089 Unclassified 2136
249 Ga0207648_10195061 3300026089 Unclassified 1795
250 Ga0207648_10353880 3300026089 Unclassified 1324
251 Ga0207674_10010770 3300026116 Bacteria 10317
252 Ga0207674_10098710 3300026116 Bacteria 2904
253 Ga0207675_100056410 3300026118 Bacteria 3664
254 Ga0207675_100186637 3300026118 Unclassified 1988
255 Ga0207675_100808910 3300026118 Unclassified 951
256 Ga0207683_10008232 3300026121 Bacteria 8921
257 Ga0207698_10001211 3300026142 Bacteria 15062
258 Ga0207698_10115598 3300026142 Bacteria 2259
259 Ga0207698_10129134 3300026142 Bacteria 2156
260 Ga0207698_11062741 3300026142 Bacteria 821
261 Ga0207428_10453193 3300027907 Bacteria 935
262 Ga0307513_10059332 3300031456 Bacteria 4062
263 Ga0307405_10172668 3300031731 Unclassified 1543
264 Ga0307413_10022283 3300031824 Bacteria 3411
265 Ga0307415_100100114 3300032126 Bacteria 2123
266 Ga0373956_0126914 3300035119 Bacteria 1193
267 Ga0373955_0252458 3300035172 Bacteria 1057
268 Ga0373935_0369898 3300035692 Bacteria 1025
269 Ga0373933_0221116 3300035724 Unclassified 1215
270 Ga0373937_0034894 3300036401 Bacteria 4576
271 Ga0395899_0004236 3300037312 Bacteria 11236
272 Ga0395899_0052932 3300037312 Bacteria 3007
273 Ga0395899_0077979 3300037312 Bacteria 2415
274 Ga0395899_0224275 3300037312 Bacteria 1300
275 Ga0395899_0334035 3300037312 Bacteria 1018
276 Ga0395900_0044179 3300037418 Bacteria 4592
277 Ga0395900_0149506 3300037418 Bacteria 2386
278 Ga0395900_0253384 3300037418 Unclassified 1761
279 Ga0395900_0293490 3300037418 Bacteria 1614
280 Ga0395900_0409945 3300037418 Bacteria 1317
281 Ga0395900_0667139 3300037418 Unclassified 975
282 Ga0395900_0703850 3300037418 Bacteria 943
283 Ga0395898_0005952 3300037466 Bacteria 13090
284 Ga0395898_0066731 3300037466 Bacteria 3484
285 Ga0395898_0084797 3300037466 Bacteria 3053
286 Ga0395898_0091733 3300037466 Bacteria 2922
287 Ga0395905_0163673 3300037471 Bacteria 2090
288 Ga0395905_0246277 3300037471 Unclassified 1670
289 Ga0395905_0585763 3300037471 Bacteria 1017
290 Ga0395901_0076043 3300038443 Bacteria 3503
291 Ga0395901_0122997 3300038443 Bacteria 2727
292 Ga0395901_0176146 3300038443 Bacteria 2243
293 Ga0439436_0001857 3300041404 Bacteria 6238
294 Ga0439449_0003096 3300042007 Bacteria 6480
295 Ga0439457_002255 3300042014 Bacteria 5577
296 Ga0439457_017085 3300042014 Bacteria 1613
297 Ga0466972_0000003 3300044658 Bacteria 391452
298 Ga0466972_0000013 3300044658 Bacteria 229345
299 Ga0466972_0016355 3300044658 Bacteria 3709
300 Ga0453683_0177446 3300044673 Bacteria 1350
301 Ga0466961_0108163 3300044693 Bacteria 1750
302 Ga0453684_0035713 3300044712 Bacteria 6866
303 Ga0453684_0038934 3300044712 Bacteria 6487
304 Ga0453684_0102023 3300044712 Bacteria 3509
305 Ga0453684_0293872 3300044712 Bacteria 1849
306 Ga0466971_0005342 3300044719 Bacteria 5571
307 Ga0466970_0002494 3300044765 Bacteria 8875
308 Ga0466970_0123196 3300044765 Bacteria 1421
309 Ga0495592_0176200 3300046454 Unclassified 1460
310 Ga0495628_0009104 3300046516 Bacteria 8496
311 Ga0495630_0030872 3300046517 Bacteria 3988
312 Ga0495640_0104529 3300046533 Unclassified 1856
313 Ga0495587_0082412 3300046536 Unclassified 1864
314 Ga0495668_0000459 3300046616 Bacteria 52226
315 Ga0495668_0005253 3300046616 Bacteria 8868
316 Ga0495611_0001282 3300046648 Bacteria 12850
317 Ga0495635_0365578 3300046663 Unclassified 961
318 Ga0495657_0275638 3300046675 Bacteria 1008
319 Ga0495613_0173027 3300046689 Unclassified 1532
320 Ga0495649_0066904 3300046694 Unclassified 1928
321 Ga0495675_0377214 3300047444 Bacteria 830
322 Ga0495684_0042041 3300047471 Bacteria 3502
323 Ga0495686_0000004 3300047472 Bacteria 869019
324 Ga0496108_0059764 3300048911 Bacteria 3206
325 Ga0496110_0461527 3300048913 Unclassified 1157
326 Ga0496118_0154708 3300048921 Bacteria 1429
327 Ga0496124_0177215 3300048927 Bacteria 1644
328 Ga0501047_0194632 3300049581 Bacteria 1890
329 Ga0501202_001826 3300049652 Bacteria 3488
330 Ga0501207_006354 3300049654 Bacteria 1658
331 Ga0501252_005905 3300049682 Bacteria 1346
332 Ga0501257_066939 3300049686 Bacteria 913
333 Ga0501241_033298 3300049758 Bacteria 979
334 Ga0501279_009831 3300049775 Unclassified 1284
335 nmdc:mga05p37_36468_c1 3300050507 Bacteria 6032
336 nmdc:mga08y16_542311_c1 3300050511 Bacteria 1178
337 Ga0500583_0000127 3300053092 Bacteria 35082
338 Ga0500583_0192754 3300053092 Bacteria 1014
339 Ga0500556_0041604 3300053104 Bacteria 1621
340 Ga0500652_021014 3300053131 Bacteria 2452
341 Ga0500658_0047015 3300053134 Bacteria 1750
342 Ga0500616_0139827 3300053153 Bacteria 1133
343 Ga0466962_0037533 3300061719 Bacteria 2320
344 Ga0466962_0167423 3300061719 Bacteria 1070
345 2738726226 2738541278 Bacteria 9755573
346 2819590097 2818991444 Bacteria 6968812
347 rootH2_10037549
348 rootH2_10008746
349 rootL2_10166082
350 rootH1_10103233
351 rootH1_10210563
352 Ga0065715_10057358
353 Ga0070658_10013517
354 Ga0070658_10016528
355 Ga0070658_10028155
356 Ga0070658_10034381
357 Ga0070658_10323278
358 Ga0070676_10039344
359 Ga0070683_100059732
360 Ga0070683_100083183
361 Ga0070683_100438860
362 Ga0070670_100123766
363 Ga0070670_100346242
364 Ga0070677_10005775
365 Ga0068869_100010056
366 Ga0068869_100015233
367 Ga0070666_10038624
368 Ga0070680_100005194
369 Ga0070680_100111747
370 Ga0070682_100090111
371 Ga0070682_100218505
372 Ga0068868_100021369
373 Ga0068868_100049396
374 Ga0068868_100083249
375 Ga0068868_100198327
376 Ga0070660_100003861
377 Ga0070689_100334344
378 Ga0070691_10141474
379 Ga0070661_100034646
380 Ga0070692_10235336
381 Ga0070668_100619992
382 Ga0070668_100669815
383 Ga0070668_100755994
384 Ga0070669_100016654
385 Ga0070675_100040779
386 Ga0070674_100079865
387 Ga0070673_100043393
388 Ga0070673_100052494
389 Ga0070673_100130582
390 Ga0070673_100311123
391 Ga0070688_100095363
392 Ga0070667_100154966
393 Ga0070663_100041481
394 Ga0070663_100124683
395 Ga0070678_100202204
396 Ga0070662_100024255
397 Ga0070662_100043831
398 Ga0070662_100242182
399 Ga0070681_10004564
400 Ga0070681_10194791
401 Ga0068867_100059008
402 Ga0068867_100132968
403 Ga0068867_100166410
404 Ga0070679_100000261
405 Ga0070679_100009098
406 Ga0070679_100062261
407 Ga0070679_100306363
408 Ga0070679_100598643
409 Ga0070684_100008747
410 Ga0070684_100012168
411 Ga0070684_100206800
412 Ga0068853_100380158
413 Ga0068853_100706307
414 Ga0070672_100239224
415 Ga0070665_101004034
416 Ga0068855_100000133
417 Ga0068855_100003486
418 Ga0068855_100039976
419 Ga0068855_100131520
420 Ga0068855_100819482
421 Ga0070664_100024674
422 Ga0070664_100177549
423 Ga0068857_100021480
424 Ga0068857_100120230
425 Ga0068854_100033071
426 Ga0068854_100082780
427 Ga0068854_100456219
428 Ga0068856_100009626
429 Ga0068856_100233357
430 Ga0070702_100004609
431 Ga0068852_100111941
432 Ga0068852_100120192
433 Ga0068852_100370672
434 Ga0068852_100431338
435 Ga0068852_100461255
436 Ga0068859_100059182
437 Ga0068859_100095338
438 Ga0068864_100009579
439 Ga0068864_100100436
440 Ga0068866_10080186
441 Ga0068861_100040421
442 Ga0068851_10066229
443 Ga0068851_10104674
444 Ga0068863_100565242
445 Ga0068858_100069820
446 Ga0081539_10017891
447 Ga0070715_10017977
448 Ga0075366_10355655
449 Ga0097621_100394025
450 Ga0068871_100101079
451 Ga0068871_100288332
452 Ga0075434_100078349
453 Ga0068865_100132761
454 Ga0097620_100059181
455 Ga0097620_100095329
456 Ga0105240_10000398
457 Ga0111539_10098041
458 Ga0114129_10043562
459 Ga0105242_10390711
460 Ga0105237_10038989
461 Ga0105237_10040645
462 Ga0105237_10054705
463 Ga0105237_10130701
464 Ga0105238_10820286
465 Ga0105249_10426335
466 Ga0105239_10000436
467 Ga0105239_10007449
468 Ga0105239_10039925
469 Ga0105239_10844747
470 Ga0105246_10400387
471 Ga0157373_10001316
472 Ga0157373_10010595
473 Ga0157373_10072736
474 Ga0157373_10195207
475 Ga0157371_10001082
476 Ga0157371_10008623
477 Ga0157371_10009339
478 Ga0157371_10049311
479 Ga0157370_10000878
480 Ga0157370_10308825
481 Ga0157370_10311558
482 Ga0157370_10402050
483 Ga0157369_10005162
484 Ga0157369_10012427
485 Ga0157369_10074426
486 Ga0157374_10000500
487 Ga0157374_10010154
488 Ga0157374_10066227
489 Ga0157374_10191662
490 Ga0157378_10002605
491 Ga0157378_10030927
492 Ga0157378_10241128
493 Ga0163162_10656638
494 Ga0157372_10011232
495 Ga0157372_10011890
496 Ga0157372_10038613
497 Ga0157372_10130666
498 Ga0157372_10137347
499 Ga0157372_10148644
500 Ga0157372_10217276
501 Ga0157372_10260067
502 Ga0157372_10281678
503 Ga0157372_10408673
504 Ga0157372_10431495
505 Ga0157372_10643544
506 Ga0157372_10752098
507 Ga0157375_10069257
508 Ga0157375_10120804
509 Ga0157375_10207699
510 Ga0157375_10336673
511 Ga0163163_10001732
512 Ga0163163_10021998
513 Ga0157380_10253711
514 Ga0157377_10016854
515 Ga0157377_10060645
516 Ga0157379_10096389
517 Ga0157376_10067379
518 Ga0163161_10074998
519 Ga0207682_10033560
520 Ga0207680_10430469
521 Ga0207647_10056227
522 Ga0207685_10047217
523 Ga0207645_10003154
524 Ga0207705_10003765
525 Ga0207705_10005713
526 Ga0207705_10056327
527 Ga0207705_10296309
528 Ga0207654_10016756
529 Ga0207707_10007443
530 Ga0207707_10107770
531 Ga0207695_10000076
532 Ga0207695_10000090
533 Ga0207695_10004647
534 Ga0207671_10121335
535 Ga0207671_10132128
536 Ga0207671_10153662
537 Ga0207671_10264208
538 Ga0207660_10002827
539 Ga0207660_10012518
540 Ga0207657_10015899
541 Ga0207657_10019043
542 Ga0207657_10051731
543 Ga0207649_10082855
544 Ga0207652_10000011
545 Ga0207652_10000271
546 Ga0207652_10009908
547 Ga0207652_10082587
548 Ga0207681_10300312
549 Ga0207681_10457469
550 Ga0207694_10600448
551 Ga0207650_10114691
552 Ga0207650_10404551
553 Ga0207650_10674164
554 Ga0207659_10154202
555 Ga0207644_10517603
556 Ga0207690_10021834
557 Ga0207690_10077427
558 Ga0207690_10193144
559 Ga0207706_10003434
560 Ga0207706_10017089
561 Ga0207686_10476629
562 Ga0207670_10034767
563 Ga0207670_10102911
564 Ga0207670_10459165
565 Ga0207669_10027480
566 Ga0207691_10008663
567 Ga0207691_10008798
568 Ga0207689_10004902
569 Ga0207689_10030714
570 Ga0207689_10051051
571 Ga0207661_10005351
572 Ga0207661_10027163
573 Ga0207661_10380852
574 Ga0207679_10004088
575 Ga0207667_10000453
576 Ga0207667_10003372
577 Ga0207667_10100501
578 Ga0207651_10068405
579 Ga0207651_10096017
580 Ga0207712_10439778
581 Ga0207668_10520300
582 Ga0207640_10006764
583 Ga0207640_10295431
584 Ga0207640_10554257
585 Ga0207658_10146003
586 Ga0207658_10193458
587 Ga0207677_10079853
588 Ga0207703_10048396
589 Ga0207639_10228519
590 Ga0207639_10260468
591 Ga0207639_10649353
592 Ga0207678_10085311
593 Ga0207702_10177807
594 Ga0207648_10139584
595 Ga0207648_10195061
596 Ga0207648_10353880
597 Ga0207674_10010770
598 Ga0207674_10098710
599 Ga0207675_100056410
600 Ga0207675_100186637
601 Ga0207675_100808910
602 Ga0207683_10008232
603 Ga0207698_10001211
604 Ga0207698_10115598
605 Ga0207698_10129134
606 Ga0207698_11062741
607 Ga0207428_10453193
608 Ga0307513_10059332
609 Ga0307405_10172668
610 Ga0307413_10022283
611 Ga0307415_100100114
612 Ga0373956_0126914
613 Ga0373955_0252458
614 Ga0373935_0369898
615 Ga0373933_0221116
616 Ga0373937_0034894
617 Ga0395899_0004236
618 Ga0395899_0052932
619 Ga0395899_0077979
620 Ga0395899_0224275
621 Ga0395899_0334035
622 Ga0395900_0044179
623 Ga0395900_0149506
624 Ga0395900_0253384
625 Ga0395900_0293490
626 Ga0395900_0409945
627 Ga0395900_0667139
628 Ga0395900_0703850
629 Ga0395898_0005952
630 Ga0395898_0066731
631 Ga0395898_0084797
632 Ga0395898_0091733
633 Ga0395905_0163673
634 Ga0395905_0246277
635 Ga0395905_0585763
636 Ga0395901_0076043
637 Ga0395901_0122997
638 Ga0395901_0176146
639 Ga0439436_0001857
640 Ga0439449_0003096
641 Ga0439457_002255
642 Ga0439457_017085
643 Ga0466972_0000003
644 Ga0466972_0000013
645 Ga0466972_0016355
646 Ga0453683_0177446
647 Ga0466961_0108163
648 Ga0453684_0035713
649 Ga0453684_0038934
650 Ga0453684_0102023
651 Ga0453684_0293872
652 Ga0466971_0005342
653 Ga0466970_0002494
654 Ga0466970_0123196
655 Ga0495592_0176200
656 Ga0495628_0009104
657 Ga0495630_0030872
658 Ga0495640_0104529
659 Ga0495587_0082412
660 Ga0495668_0000459
661 Ga0495668_0005253
662 Ga0495611_0001282
663 Ga0495635_0365578
664 Ga0495657_0275638
665 Ga0495613_0173027
666 Ga0495649_0066904
667 Ga0495675_0377214
668 Ga0495684_0042041
669 Ga0495686_0000004
670 Ga0496108_0059764
671 Ga0496110_0461527
672 Ga0496118_0154708
673 Ga0496124_0177215
674 Ga0501047_0194632
675 Ga0501202_001826
676 Ga0501207_006354
677 Ga0501252_005905
678 Ga0501257_066939
679 Ga0501241_033298
680 Ga0501279_009831
681 nmdc:mga05p37_36468_c1
682 nmdc:mga08y16_542311_c1
683 Ga0500583_0000127
684 Ga0500583_0192754
685 Ga0500556_0041604
686 Ga0500652_021014
687 Ga0500658_0047015
688 Ga0500616_0139827
689 Ga0466962_0037533
690 Ga0466962_0167423
691 2738726226
692 2819590097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

73

227

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.654 1 246
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6403 1 246
4yra-assembly3.cif.gz_C mouse tdh in the apo form 0.6039 47 182
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6013 16 216
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.5845 18 242
ID Description Score Start End Superfamily
af_P33333_55_242_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.7033 28 235 3.40.1130.10
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6938 38 184 3.40.50.620
af_Q93841_73_201_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6916 47 184 3.40.50.620
af_I6XFY8_81_224_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.6845 43 160 3.40.50.620
af_P33333_55_242_3.40.1130.10 Alpha Beta;3-Layer(aba) Sandwich;Glycerol-3-phosphate (1)-acyltransferase;Glycerol-3-phosphate (1)-acyltransferase 0.6834 28 235 3.40.1130.10
ID Description Score Start End GO Terms
AF-A0A3B9P668-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9653 173 241 GO:0016746
AF-A0A4Q5V139-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.963 169 249 GO:0016746
AF-A0A327X7H2-F1-model_v4 Acyltransferase-like protein 0.947 14 157 GO:0016746
AF-A0A257WCY6-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9454 1 160 GO:0016020
GO:0016746
AF-A0A2G6F0G0-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.94 14 151 GO:0016746

Map