F416701
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 346 | 187 | 693 | 363 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100141269|Ga0068864_1001412693 |
| Length | 396 |
| Sequence | MILCSRSSRSKGLATVLLPDKNGSAFFELFEYLASMQFLSAEKIFTGEEWLQNHAVVVNNNMIEDILPLSSITSSVKYFDNSFIAPAFIDLQIYGAAGKLLAVYPEKDSLVKLVEYCRYGGAAYCMPTVATHPYETFYECIDAVKEYWNGGGKGVPGLHIEGPWISYEKKGAHIAECIHIPTIGQVRQLLEYGKGVIKIITLAPEVCSKEIIDFILSYDIIISAGHSSATYDEATGAFNSGVTAATHLYNAMSPLQHRNPGMVGAIMDHSHVMASIIPDGYHVDYAAIRIAKQVMKERLFAITDAVTETGTGYYPHHLAGDKYESNGILSGSALTMVKAVKNLVEHCNIEPGEALRMCSLYPARVMGLQNRLGLIKKNYEASLVVMSNDLSTVSIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 133 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 134 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 135 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 139 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 156 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 178 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 179 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 181 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 182 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 183 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 184 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 185 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 186 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 187 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.98 |
| Metatranscriptomes | 0 |
| Isolates | 2.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.31 |
| Nodule | 0 |
| Rhizoplane | 0.87 |
| Rhizosphere | 93.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068864_100141269 | 3300005618 | Unclassified | 2172 |
| 2 | JGI25153J46596_10037263 | 3300003215 | Bacteria | 1549 |
| 3 | rootH2_10004327 | 3300003320 | Bacteria | 11689 |
| 4 | rootH2_10011035 | 3300003320 | Bacteria | 21460 |
| 5 | rootH2_10099066 | 3300003320 | Unclassified | 2141 |
| 6 | rootH2_10127001 | 3300003320 | Bacteria | 7405 |
| 7 | rootL2_10016475 | 3300003322 | Unclassified | 2741 |
| 8 | rootH1_10040303 | 3300003316 | Bacteria | 6010 |
| 9 | rootH1_10040303 | 3300003323 | Bacteria | 6854 |
| 10 | Ga0065704_10009511 | 3300005289 | Bacteria | 2453 |
| 11 | Ga0065704_10181694 | 3300005289 | Bacteria | 1234 |
| 12 | Ga0065712_10014389 | 3300005290 | Bacteria | 3282 |
| 13 | Ga0065712_10068536 | 3300005290 | Bacteria | 10007 |
| 14 | Ga0065715_10013863 | 3300005293 | Unclassified | 2012 |
| 15 | Ga0065707_10176142 | 3300005295 | Bacteria | 1450 |
| 16 | Ga0070676_10014348 | 3300005328 | Unclassified | 4354 |
| 17 | Ga0070676_10155433 | 3300005328 | Bacteria | 1468 |
| 18 | Ga0070683_100001974 | 3300005329 | Bacteria | 16065 |
| 19 | Ga0070683_100013925 | 3300005329 | Bacteria | 7026 |
| 20 | Ga0070683_100037362 | 3300005329 | Bacteria | 4446 |
| 21 | Ga0070690_100014672 | 3300005330 | Unclassified | 4651 |
| 22 | Ga0070670_100028700 | 3300005331 | Unclassified | 4789 |
| 23 | Ga0070670_100100486 | 3300005331 | Bacteria | 2490 |
| 24 | Ga0070670_100165581 | 3300005331 | Unclassified | 1917 |
| 25 | Ga0070670_100182522 | 3300005331 | Bacteria | 1822 |
| 26 | Ga0068869_100006296 | 3300005334 | Bacteria | 7514 |
| 27 | Ga0068869_100031729 | 3300005334 | Unclassified | 3718 |
| 28 | Ga0068869_100065472 | 3300005334 | Unclassified | 2675 |
| 29 | Ga0068869_100073798 | 3300005334 | Bacteria | 2531 |
| 30 | Ga0068869_100082307 | 3300005334 | Bacteria | 2405 |
| 31 | Ga0070666_10002266 | 3300005335 | Bacteria | 11627 |
| 32 | Ga0070666_10022858 | 3300005335 | Bacteria | 4065 |
| 33 | Ga0070682_100017499 | 3300005337 | Bacteria | 4180 |
| 34 | Ga0068868_100048054 | 3300005338 | Bacteria | 3347 |
| 35 | Ga0070689_100007383 | 3300005340 | Bacteria | 7678 |
| 36 | Ga0070689_100052469 | 3300005340 | Unclassified | 3154 |
| 37 | Ga0070689_100069173 | 3300005340 | Unclassified | 2754 |
| 38 | Ga0070689_100087605 | 3300005340 | Unclassified | 2450 |
| 39 | Ga0070691_10012007 | 3300005341 | Bacteria | 3965 |
| 40 | Ga0070661_100001789 | 3300005344 | Bacteria | 14905 |
| 41 | Ga0070661_100122809 | 3300005344 | Bacteria | 1946 |
| 42 | Ga0070668_100070052 | 3300005347 | Unclassified | 2729 |
| 43 | Ga0070669_100007886 | 3300005353 | Bacteria | 7610 |
| 44 | Ga0070675_100020154 | 3300005354 | Bacteria | 5321 |
| 45 | Ga0070675_100022794 | 3300005354 | Bacteria | 5003 |
| 46 | Ga0070675_100049701 | 3300005354 | Bacteria | 3442 |
| 47 | Ga0070675_100326660 | 3300005354 | Bacteria | 1356 |
| 48 | Ga0070673_100020795 | 3300005364 | Bacteria | 4741 |
| 49 | Ga0070673_100149026 | 3300005364 | Unclassified | 1980 |
| 50 | Ga0070688_100006727 | 3300005365 | Bacteria | 6161 |
| 51 | Ga0070688_100047310 | 3300005365 | Unclassified | 2668 |
| 52 | Ga0070688_100054092 | 3300005365 | Unclassified | 2513 |
| 53 | Ga0070688_100069540 | 3300005365 | Unclassified | 2248 |
| 54 | Ga0070659_100011103 | 3300005366 | Bacteria | 6654 |
| 55 | Ga0070659_100028829 | 3300005366 | Bacteria | 4288 |
| 56 | Ga0070701_10015464 | 3300005438 | Unclassified | 3526 |
| 57 | Ga0070663_100117146 | 3300005455 | Unclassified | 2008 |
| 58 | Ga0070678_100014132 | 3300005456 | Bacteria | 5027 |
| 59 | Ga0070662_100002099 | 3300005457 | Bacteria | 12224 |
| 60 | Ga0070662_100010756 | 3300005457 | Bacteria | 6023 |
| 61 | Ga0070662_100041794 | 3300005457 | Unclassified | 3273 |
| 62 | Ga0068867_100004729 | 3300005459 | Bacteria | 9582 |
| 63 | Ga0068867_100042895 | 3300005459 | Bacteria | 3311 |
| 64 | Ga0070685_10008428 | 3300005466 | Bacteria | 5295 |
| 65 | Ga0070685_10012326 | 3300005466 | Bacteria | 4491 |
| 66 | Ga0070685_10052076 | 3300005466 | Unclassified | 2368 |
| 67 | Ga0070685_10062308 | 3300005466 | Bacteria | 2187 |
| 68 | Ga0070685_10063248 | 3300005466 | Unclassified | 2172 |
| 69 | Ga0070698_100001934 | 3300005471 | Bacteria | 23015 |
| 70 | Ga0070698_100003667 | 3300005471 | Bacteria | 16868 |
| 71 | Ga0070698_100011036 | 3300005471 | Bacteria | 9603 |
| 72 | Ga0070699_100089446 | 3300005518 | Bacteria | 2690 |
| 73 | Ga0070684_100002013 | 3300005535 | Bacteria | 14950 |
| 74 | Ga0070684_100006052 | 3300005535 | Bacteria | 9321 |
| 75 | Ga0068853_100000773 | 3300005539 | Bacteria | 22203 |
| 76 | Ga0068853_100004150 | 3300005539 | Bacteria | 11165 |
| 77 | Ga0068853_100007393 | 3300005539 | Bacteria | 8787 |
| 78 | Ga0068853_100021303 | 3300005539 | Bacteria | 5403 |
| 79 | Ga0068853_100275784 | 3300005539 | Bacteria | 1549 |
| 80 | Ga0070686_100081836 | 3300005544 | Bacteria | 2140 |
| 81 | Ga0070693_100150590 | 3300005547 | Bacteria | 1473 |
| 82 | Ga0070665_100189474 | 3300005548 | Bacteria | 2058 |
| 83 | Ga0068855_100000081 | 3300005563 | Bacteria | 115707 |
| 84 | Ga0070664_100001372 | 3300005564 | Bacteria | 19398 |
| 85 | Ga0070664_100171447 | 3300005564 | Bacteria | 1925 |
| 86 | Ga0068857_100004492 | 3300005577 | Bacteria | 11788 |
| 87 | Ga0068857_100005666 | 3300005577 | Bacteria | 10673 |
| 88 | Ga0068857_100052936 | 3300005577 | Bacteria | 3601 |
| 89 | Ga0068857_100056799 | 3300005577 | Bacteria | 3474 |
| 90 | Ga0068857_100070576 | 3300005577 | Bacteria | 3112 |
| 91 | Ga0068854_100051724 | 3300005578 | Bacteria | 2944 |
| 92 | Ga0068854_100130022 | 3300005578 | Unclassified | 1921 |
| 93 | Ga0068856_100030651 | 3300005614 | Bacteria | 5258 |
| 94 | Ga0068852_100102802 | 3300005616 | Bacteria | 2583 |
| 95 | Ga0068852_100109847 | 3300005616 | Unclassified | 2505 |
| 96 | Ga0068859_100023011 | 3300005617 | Bacteria | 6249 |
| 97 | Ga0068859_100125878 | 3300005617 | Bacteria | 2631 |
| 98 | Ga0068859_100210528 | 3300005617 | Unclassified | 2030 |
| 99 | Ga0068864_100001903 | 3300005618 | Bacteria | 17129 |
| 100 | Ga0068864_100261496 | 3300005618 | Unclassified | 1610 |
| 101 | Ga0068866_10013289 | 3300005718 | Bacteria | 3609 |
| 102 | Ga0068866_10131467 | 3300005718 | Unclassified | 1424 |
| 103 | Ga0068861_100001158 | 3300005719 | Bacteria | 16426 |
| 104 | Ga0068861_100010534 | 3300005719 | Bacteria | 6419 |
| 105 | Ga0068861_100389682 | 3300005719 | Bacteria | 1233 |
| 106 | Ga0068870_10036006 | 3300005840 | Bacteria | 2544 |
| 107 | Ga0068870_10131340 | 3300005840 | Bacteria | 1455 |
| 108 | Ga0068863_100013208 | 3300005841 | Bacteria | 7965 |
| 109 | Ga0068863_100033199 | 3300005841 | Unclassified | 4917 |
| 110 | Ga0068863_100071027 | 3300005841 | Bacteria | 3293 |
| 111 | Ga0068863_100207588 | 3300005841 | Bacteria | 1886 |
| 112 | Ga0068858_100103349 | 3300005842 | Bacteria | 2658 |
| 113 | Ga0068860_100000829 | 3300005843 | Bacteria | 34616 |
| 114 | Ga0068860_100162432 | 3300005843 | Bacteria | 2154 |
| 115 | Ga0068862_100032280 | 3300005844 | Unclassified | 4423 |
| 116 | Ga0068862_100119220 | 3300005844 | Bacteria | 2324 |
| 117 | Ga0097621_100228281 | 3300006237 | Bacteria | 1625 |
| 118 | Ga0068871_100004781 | 3300006358 | Bacteria | 9468 |
| 119 | Ga0068871_100027409 | 3300006358 | Unclassified | 4455 |
| 120 | Ga0068871_100184498 | 3300006358 | Bacteria | 1794 |
| 121 | Ga0075428_100235756 | 3300006844 | Bacteria | 1974 |
| 122 | Ga0075430_100036702 | 3300006846 | Bacteria | 4155 |
| 123 | Ga0097620_100023011 | 3300006931 | Bacteria | 6249 |
| 124 | Ga0097620_100125875 | 3300006931 | Bacteria | 2631 |
| 125 | Ga0097620_100210529 | 3300006931 | Unclassified | 2030 |
| 126 | Ga0105240_10000597 | 3300009093 | Bacteria | 67036 |
| 127 | Ga0105240_10001169 | 3300009093 | Bacteria | 46003 |
| 128 | Ga0105240_10003084 | 3300009093 | Bacteria | 26189 |
| 129 | Ga0105240_10373856 | 3300009093 | Bacteria | 1611 |
| 130 | Ga0105240_10489904 | 3300009093 | Bacteria | 1369 |
| 131 | Ga0111539_10000458 | 3300009094 | Bacteria | 51231 |
| 132 | Ga0111539_10146119 | 3300009094 | Bacteria | 2768 |
| 133 | Ga0111539_10571622 | 3300009094 | Bacteria | 1317 |
| 134 | Ga0114129_10084381 | 3300009147 | Bacteria | 4410 |
| 135 | Ga0114129_10127574 | 3300009147 | Unclassified | 3497 |
| 136 | Ga0105241_10087288 | 3300009174 | Bacteria | 2455 |
| 137 | Ga0105242_10038132 | 3300009176 | Bacteria | 3863 |
| 138 | Ga0105242_10259335 | 3300009176 | Bacteria | 1570 |
| 139 | Ga0105248_10256479 | 3300009177 | Bacteria | 1969 |
| 140 | Ga0105238_10479452 | 3300009551 | Bacteria | 1243 |
| 141 | Ga0105249_10002578 | 3300009553 | Bacteria | 15687 |
| 142 | Ga0105249_10003210 | 3300009553 | Bacteria | 14149 |
| 143 | Ga0105249_10003219 | 3300009553 | Bacteria | 14138 |
| 144 | Ga0105249_10074886 | 3300009553 | Bacteria | 3134 |
| 145 | Ga0105249_10077490 | 3300009553 | Bacteria | 3082 |
| 146 | Ga0105249_10173585 | 3300009553 | Bacteria | 2092 |
| 147 | Ga0105249_10195059 | 3300009553 | Bacteria | 1979 |
| 148 | Ga0105249_10560330 | 3300009553 | Bacteria | 1194 |
| 149 | Ga0105239_10001099 | 3300010375 | Bacteria | 37369 |
| 150 | Ga0105239_10104797 | 3300010375 | Bacteria | 3131 |
| 151 | Ga0157371_10058474 | 3300013102 | Bacteria | 2734 |
| 152 | Ga0157370_10019993 | 3300013104 | Bacteria | 6698 |
| 153 | Ga0157369_10072687 | 3300013105 | Bacteria | 3691 |
| 154 | Ga0157374_10002019 | 3300013296 | Bacteria | 17033 |
| 155 | Ga0157374_10007296 | 3300013296 | Bacteria | 9423 |
| 156 | Ga0157374_10333218 | 3300013296 | Bacteria | 1505 |
| 157 | Ga0157378_10331621 | 3300013297 | Unclassified | 1481 |
| 158 | Ga0163162_10007503 | 3300013306 | Bacteria | 10617 |
| 159 | Ga0163162_10010897 | 3300013306 | Bacteria | 8851 |
| 160 | Ga0163162_10085955 | 3300013306 | Bacteria | 3222 |
| 161 | Ga0163162_10140397 | 3300013306 | Unclassified | 2529 |
| 162 | Ga0163162_10258448 | 3300013306 | Bacteria | 1873 |
| 163 | Ga0157372_10317634 | 3300013307 | Bacteria | 1813 |
| 164 | Ga0157372_10333623 | 3300013307 | Bacteria | 1766 |
| 165 | Ga0157375_10005759 | 3300013308 | Bacteria | 10780 |
| 166 | Ga0157375_10013374 | 3300013308 | Bacteria | 7300 |
| 167 | Ga0157375_10032496 | 3300013308 | Unclassified | 4950 |
| 168 | Ga0163163_10000899 | 3300014325 | Bacteria | 25214 |
| 169 | Ga0163163_10066996 | 3300014325 | Unclassified | 3568 |
| 170 | Ga0163163_10116644 | 3300014325 | Bacteria | 2701 |
| 171 | Ga0163163_10273341 | 3300014325 | Bacteria | 1741 |
| 172 | Ga0157380_10002400 | 3300014326 | Bacteria | 12600 |
| 173 | Ga0157380_10470511 | 3300014326 | Bacteria | 1212 |
| 174 | Ga0157377_10012235 | 3300014745 | Bacteria | 4310 |
| 175 | Ga0157377_10023729 | 3300014745 | Unclassified | 3254 |
| 176 | Ga0157377_10023828 | 3300014745 | Unclassified | 3248 |
| 177 | Ga0157379_10308739 | 3300014968 | Bacteria | 1443 |
| 178 | Ga0157376_10005742 | 3300014969 | Bacteria | 8692 |
| 179 | Ga0157376_10049423 | 3300014969 | Unclassified | 3483 |
| 180 | Ga0163161_10003712 | 3300017792 | Bacteria | 10697 |
| 181 | Ga0163161_10052586 | 3300017792 | Bacteria | 2953 |
| 182 | Ga0209436_100882 | 3300025208 | Bacteria | 11960 |
| 183 | Ga0209130_1000871 | 3300025284 | Bacteria | 24706 |
| 184 | Ga0207426_1000033 | 3300025302 | Bacteria | 455976 |
| 185 | Ga0207697_10011277 | 3300025315 | Unclassified | 3785 |
| 186 | Ga0207682_10009605 | 3300025893 | Bacteria | 3813 |
| 187 | Ga0207680_10016527 | 3300025903 | Bacteria | 3876 |
| 188 | Ga0207680_10173967 | 3300025903 | Bacteria | 1452 |
| 189 | Ga0207647_10027426 | 3300025904 | Bacteria | 3712 |
| 190 | Ga0207647_10140909 | 3300025904 | Bacteria | 1413 |
| 191 | Ga0207645_10002627 | 3300025907 | Bacteria | 14014 |
| 192 | Ga0207645_10025160 | 3300025907 | Bacteria | 3853 |
| 193 | Ga0207643_10001490 | 3300025908 | Bacteria | 13411 |
| 194 | Ga0207643_10008247 | 3300025908 | Bacteria | 5593 |
| 195 | Ga0207643_10069407 | 3300025908 | Unclassified | 2026 |
| 196 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 197 | Ga0207695_10000299 | 3300025913 | Bacteria | 122118 |
| 198 | Ga0207695_10000676 | 3300025913 | Bacteria | 67018 |
| 199 | Ga0207695_10184131 | 3300025913 | Bacteria | 2009 |
| 200 | Ga0207662_10064899 | 3300025918 | Unclassified | 2198 |
| 201 | Ga0207649_10023822 | 3300025920 | Bacteria | 3550 |
| 202 | Ga0207649_10049523 | 3300025920 | Unclassified | 2595 |
| 203 | Ga0207681_10003119 | 3300025923 | Bacteria | 10425 |
| 204 | Ga0207681_10014991 | 3300025923 | Bacteria | 4830 |
| 205 | Ga0207681_10146067 | 3300025923 | Unclassified | 1767 |
| 206 | Ga0207650_10291390 | 3300025925 | Unclassified | 1331 |
| 207 | Ga0207659_10009731 | 3300025926 | Bacteria | 6012 |
| 208 | Ga0207690_10086030 | 3300025932 | Unclassified | 2208 |
| 209 | Ga0207706_10000763 | 3300025933 | Bacteria | 33452 |
| 210 | Ga0207706_10013174 | 3300025933 | Bacteria | 7525 |
| 211 | Ga0207706_10020335 | 3300025933 | Bacteria | 5967 |
| 212 | Ga0207686_10001891 | 3300025934 | Bacteria | 11598 |
| 213 | Ga0207686_10225581 | 3300025934 | Bacteria | 1355 |
| 214 | Ga0207670_10006097 | 3300025936 | Bacteria | 6662 |
| 215 | Ga0207670_10011005 | 3300025936 | Bacteria | 5231 |
| 216 | Ga0207691_10049673 | 3300025940 | Bacteria | 3844 |
| 217 | Ga0207691_10090318 | 3300025940 | Bacteria | 2746 |
| 218 | Ga0207711_10432211 | 3300025941 | Unclassified | 1225 |
| 219 | Ga0207689_10016454 | 3300025942 | Bacteria | 6260 |
| 220 | Ga0207689_10031664 | 3300025942 | Bacteria | 4401 |
| 221 | Ga0207689_10064459 | 3300025942 | Bacteria | 3015 |
| 222 | Ga0207689_10102098 | 3300025942 | Bacteria | 2356 |
| 223 | Ga0207689_10157170 | 3300025942 | Unclassified | 1874 |
| 224 | Ga0207661_10012430 | 3300025944 | Bacteria | 6187 |
| 225 | Ga0207679_10021430 | 3300025945 | Unclassified | 4381 |
| 226 | Ga0207667_10000172 | 3300025949 | Bacteria | 95455 |
| 227 | Ga0207651_10191148 | 3300025960 | Unclassified | 1633 |
| 228 | Ga0207651_10235450 | 3300025960 | Bacteria | 1489 |
| 229 | Ga0207712_10001267 | 3300025961 | Bacteria | 17398 |
| 230 | Ga0207712_10010189 | 3300025961 | Bacteria | 5961 |
| 231 | Ga0207712_10022789 | 3300025961 | Bacteria | 4127 |
| 232 | Ga0207712_10043795 | 3300025961 | Bacteria | 3089 |
| 233 | Ga0207712_10083880 | 3300025961 | Unclassified | 2327 |
| 234 | Ga0207712_10105871 | 3300025961 | Bacteria | 2100 |
| 235 | Ga0207668_10053404 | 3300025972 | Unclassified | 2800 |
| 236 | Ga0207668_10263475 | 3300025972 | Bacteria | 1406 |
| 237 | Ga0207640_10042737 | 3300025981 | Bacteria | 2892 |
| 238 | Ga0207658_10068679 | 3300025986 | Unclassified | 2675 |
| 239 | Ga0207658_10127661 | 3300025986 | Bacteria | 2038 |
| 240 | Ga0207677_10001293 | 3300026023 | Bacteria | 13421 |
| 241 | Ga0207677_10035171 | 3300026023 | Bacteria | 3250 |
| 242 | Ga0207677_10315479 | 3300026023 | Bacteria | 1297 |
| 243 | Ga0207703_10071185 | 3300026035 | Unclassified | 2872 |
| 244 | Ga0207703_10163035 | 3300026035 | Unclassified | 1954 |
| 245 | Ga0207639_10015240 | 3300026041 | Bacteria | 5418 |
| 246 | Ga0207639_10021273 | 3300026041 | Unclassified | 4657 |
| 247 | Ga0207639_10030877 | 3300026041 | Bacteria | 3933 |
| 248 | Ga0207639_10112255 | 3300026041 | Unclassified | 2224 |
| 249 | Ga0207678_10031768 | 3300026067 | Bacteria | 4603 |
| 250 | Ga0207702_10022016 | 3300026078 | Bacteria | 5279 |
| 251 | Ga0207641_10000088 | 3300026088 | Bacteria | 131959 |
| 252 | Ga0207641_10010252 | 3300026088 | Bacteria | 7706 |
| 253 | Ga0207641_10104446 | 3300026088 | Unclassified | 2501 |
| 254 | Ga0207641_10117197 | 3300026088 | Unclassified | 2371 |
| 255 | Ga0207641_10135800 | 3300026088 | Bacteria | 2214 |
| 256 | Ga0207648_10006276 | 3300026089 | Bacteria | 11830 |
| 257 | Ga0207648_10009884 | 3300026089 | Bacteria | 9094 |
| 258 | Ga0207648_10066609 | 3300026089 | Bacteria | 3141 |
| 259 | Ga0207648_10161635 | 3300026089 | Bacteria | 1978 |
| 260 | Ga0207676_10033885 | 3300026095 | Bacteria | 3863 |
| 261 | Ga0207676_10037432 | 3300026095 | Unclassified | 3697 |
| 262 | Ga0207676_10348115 | 3300026095 | Unclassified | 1369 |
| 263 | Ga0207674_10001740 | 3300026116 | Bacteria | 27826 |
| 264 | Ga0207674_10033280 | 3300026116 | Bacteria | 5397 |
| 265 | Ga0207674_10034254 | 3300026116 | Bacteria | 5312 |
| 266 | Ga0207674_10035401 | 3300026116 | Bacteria | 5210 |
| 267 | Ga0207674_10112289 | 3300026116 | Bacteria | 2699 |
| 268 | Ga0207674_10223673 | 3300026116 | Bacteria | 1830 |
| 269 | Ga0207675_100000332 | 3300026118 | Bacteria | 45114 |
| 270 | Ga0207675_100002977 | 3300026118 | Bacteria | 16664 |
| 271 | Ga0207675_100052797 | 3300026118 | Bacteria | 3792 |
| 272 | Ga0207675_100454667 | 3300026118 | Bacteria | 1269 |
| 273 | Ga0207683_10016150 | 3300026121 | Bacteria | 6354 |
| 274 | Ga0207683_10251395 | 3300026121 | Unclassified | 1613 |
| 275 | Ga0207698_10063178 | 3300026142 | Bacteria | 2896 |
| 276 | Ga0207698_10066682 | 3300026142 | Bacteria | 2834 |
| 277 | Ga0207698_10249860 | 3300026142 | Bacteria | 1622 |
| 278 | Ga0207428_10119118 | 3300027907 | Bacteria | 2026 |
| 279 | Ga0268266_10292299 | 3300028379 | Bacteria | 1518 |
| 280 | Ga0268265_10006905 | 3300028380 | Bacteria | 7679 |
| 281 | Ga0268265_10203894 | 3300028380 | Bacteria | 1718 |
| 282 | Ga0268264_10010235 | 3300028381 | Bacteria | 7763 |
| 283 | Ga0268264_10122176 | 3300028381 | Bacteria | 2296 |
| 284 | Ga0265338_10095617 | 3300028800 | Bacteria | 2440 |
| 285 | Ga0307406_10021405 | 3300031901 | Bacteria | 3824 |
| 286 | Ga0373955_0045199 | 3300035172 | Bacteria | 2376 |
| 287 | Ga0373935_0094665 | 3300035692 | Unclassified | 1961 |
| 288 | Ga0439445_0043155 | 3300042004 | Bacteria | 1203 |
| 289 | Ga0450923_006746 | 3300042125 | Bacteria | 1916 |
| 290 | Ga0450898_002452 | 3300042134 | Bacteria | 2584 |
| 291 | Ga0439434_0012964 | 3300042435 | Bacteria | 2471 |
| 292 | Ga0466969_0021061 | 3300044656 | Bacteria | 3373 |
| 293 | Ga0466961_0048369 | 3300044693 | Bacteria | 2718 |
| 294 | Ga0466964_0008038 | 3300044706 | Bacteria | 3954 |
| 295 | Ga0466971_0035320 | 3300044719 | Bacteria | 2240 |
| 296 | Ga0466970_0079518 | 3300044765 | Bacteria | 1770 |
| 297 | Ga0466959_0002115 | 3300045049 | Bacteria | 12564 |
| 298 | Ga0466959_0008505 | 3300045049 | Bacteria | 7263 |
| 299 | Ga0466959_0205507 | 3300045049 | Bacteria | 1370 |
| 300 | Ga0466958_0095788 | 3300045836 | Unclassified | 1840 |
| 301 | Ga0466967_0129334 | 3300045976 | Bacteria | 2343 |
| 302 | Ga0495653_0066443 | 3300046463 | Unclassified | 2713 |
| 303 | Ga0495650_0036861 | 3300046471 | Bacteria | 2135 |
| 304 | Ga0495633_0029925 | 3300046558 | Bacteria | 2647 |
| 305 | Ga0495667_0037524 | 3300046559 | Unclassified | 3229 |
| 306 | Ga0495646_0092093 | 3300046680 | Unclassified | 1749 |
| 307 | Ga0495674_0105473 | 3300047319 | Bacteria | 2395 |
| 308 | Ga0495672_0026788 | 3300047320 | Unclassified | 3672 |
| 309 | Ga0495686_0010160 | 3300047472 | Bacteria | 6715 |
| 310 | Ga0496101_0159981 | 3300048904 | Bacteria | 1727 |
| 311 | Ga0496110_0117212 | 3300048913 | Unclassified | 2398 |
| 312 | Ga0496115_0090337 | 3300048918 | Bacteria | 2502 |
| 313 | Ga0496124_0059093 | 3300048927 | Bacteria | 3222 |
| 314 | Ga0501032_0065670 | 3300049569 | Unclassified | 2426 |
| 315 | Ga0501034_0004888 | 3300049571 | Bacteria | 14781 |
| 316 | Ga0501036_0000934 | 3300049572 | Bacteria | 21944 |
| 317 | Ga0501037_0116648 | 3300049573 | Bacteria | 1921 |
| 318 | Ga0501038_0007548 | 3300049574 | Bacteria | 10025 |
| 319 | Ga0501039_0010296 | 3300049575 | Bacteria | 7133 |
| 320 | Ga0501046_0005974 | 3300049580 | Bacteria | 10837 |
| 321 | Ga0501047_0088735 | 3300049581 | Bacteria | 2969 |
| 322 | Ga0501047_0172254 | 3300049581 | Bacteria | 2033 |
| 323 | Ga0501048_0063639 | 3300049582 | Bacteria | 2608 |
| 324 | Ga0501067_0087335 | 3300049583 | Bacteria | 1730 |
| 325 | Ga0501068_0065989 | 3300049584 | Bacteria | 2204 |
| 326 | Ga0501070_0003667 | 3300049586 | Bacteria | 13277 |
| 327 | Ga0501072_0025187 | 3300049588 | Bacteria | 4633 |
| 328 | Ga0501073_0012410 | 3300049589 | Bacteria | 6217 |
| 329 | Ga0501080_0024066 | 3300049742 | Bacteria | 5644 |
| 330 | Ga0501083_0000193 | 3300049744 | Bacteria | 39210 |
| 331 | Ga0501035_0063734 | 3300049822 | Unclassified | 3277 |
| 332 | Ga0501044_0005186 | 3300049823 | Bacteria | 14501 |
| 333 | nmdc:mga0qj67_9535_c1 | 3300050509 | Bacteria | 7233 |
| 334 | nmdc:mga08y16_18017_c1 | 3300050511 | Bacteria | 7439 |
| 335 | Ga0500644_0011243 | 3300053088 | Unclassified | 2443 |
| 336 | Ga0500616_0024453 | 3300053153 | Unclassified | 3356 |
| 337 | Ga0500616_0025341 | 3300053153 | Unclassified | 3290 |
| 338 | Ga0500611_000003 | 3300053727 | Bacteria | 333431 |
| 339 | Ga0501084_0024958 | 3300054114 | Bacteria | 4988 |
| 340 | Ga0466962_0024213 | 3300061719 | Bacteria | 2917 |
| 341 | 2819585898 | 2818991444 | Bacteria | 6968812 |
| 342 | 2819676600 | 2818991460 | Bacteria | 7595395 |
| 343 | 2902049648 | 2902048731 | Bacteria | 4976191 |
| 344 | 2929159343 | 2929154850 | Bacteria | 6753285 |
| 345 | 2929178022 | 2929177148 | Bacteria | 7883697 |
| 346 | 2945980381 | 2945977869 | Bacteria | 7777518 |
| 347 | 2946013755 | 2946013367 | Bacteria | 7766675 |
| 348 | Ga0068864_100141269 | |||
| 349 | JGI25153J46596_10037263 | |||
| 350 | rootH2_10004327 | |||
| 351 | rootH2_10011035 | |||
| 352 | rootH2_10099066 | |||
| 353 | rootH2_10127001 | |||
| 354 | rootL2_10016475 | |||
| 355 | rootH1_10040303 | |||
| 356 | Ga0065704_10009511 | |||
| 357 | Ga0065704_10181694 | |||
| 358 | Ga0065712_10014389 | |||
| 359 | Ga0065712_10068536 | |||
| 360 | Ga0065715_10013863 | |||
| 361 | Ga0065707_10176142 | |||
| 362 | Ga0070676_10014348 | |||
| 363 | Ga0070676_10155433 | |||
| 364 | Ga0070683_100001974 | |||
| 365 | Ga0070683_100013925 | |||
| 366 | Ga0070683_100037362 | |||
| 367 | Ga0070690_100014672 | |||
| 368 | Ga0070670_100028700 | |||
| 369 | Ga0070670_100100486 | |||
| 370 | Ga0070670_100165581 | |||
| 371 | Ga0070670_100182522 | |||
| 372 | Ga0068869_100006296 | |||
| 373 | Ga0068869_100031729 | |||
| 374 | Ga0068869_100065472 | |||
| 375 | Ga0068869_100073798 | |||
| 376 | Ga0068869_100082307 | |||
| 377 | Ga0070666_10002266 | |||
| 378 | Ga0070666_10022858 | |||
| 379 | Ga0070682_100017499 | |||
| 380 | Ga0068868_100048054 | |||
| 381 | Ga0070689_100007383 | |||
| 382 | Ga0070689_100052469 | |||
| 383 | Ga0070689_100069173 | |||
| 384 | Ga0070689_100087605 | |||
| 385 | Ga0070691_10012007 | |||
| 386 | Ga0070661_100001789 | |||
| 387 | Ga0070661_100122809 | |||
| 388 | Ga0070668_100070052 | |||
| 389 | Ga0070669_100007886 | |||
| 390 | Ga0070675_100020154 | |||
| 391 | Ga0070675_100022794 | |||
| 392 | Ga0070675_100049701 | |||
| 393 | Ga0070675_100326660 | |||
| 394 | Ga0070673_100020795 | |||
| 395 | Ga0070673_100149026 | |||
| 396 | Ga0070688_100006727 | |||
| 397 | Ga0070688_100047310 | |||
| 398 | Ga0070688_100054092 | |||
| 399 | Ga0070688_100069540 | |||
| 400 | Ga0070659_100011103 | |||
| 401 | Ga0070659_100028829 | |||
| 402 | Ga0070701_10015464 | |||
| 403 | Ga0070663_100117146 | |||
| 404 | Ga0070678_100014132 | |||
| 405 | Ga0070662_100002099 | |||
| 406 | Ga0070662_100010756 | |||
| 407 | Ga0070662_100041794 | |||
| 408 | Ga0068867_100004729 | |||
| 409 | Ga0068867_100042895 | |||
| 410 | Ga0070685_10008428 | |||
| 411 | Ga0070685_10012326 | |||
| 412 | Ga0070685_10052076 | |||
| 413 | Ga0070685_10062308 | |||
| 414 | Ga0070685_10063248 | |||
| 415 | Ga0070698_100001934 | |||
| 416 | Ga0070698_100003667 | |||
| 417 | Ga0070698_100011036 | |||
| 418 | Ga0070699_100089446 | |||
| 419 | Ga0070684_100002013 | |||
| 420 | Ga0070684_100006052 | |||
| 421 | Ga0068853_100000773 | |||
| 422 | Ga0068853_100004150 | |||
| 423 | Ga0068853_100007393 | |||
| 424 | Ga0068853_100021303 | |||
| 425 | Ga0068853_100275784 | |||
| 426 | Ga0070686_100081836 | |||
| 427 | Ga0070693_100150590 | |||
| 428 | Ga0070665_100189474 | |||
| 429 | Ga0068855_100000081 | |||
| 430 | Ga0070664_100001372 | |||
| 431 | Ga0070664_100171447 | |||
| 432 | Ga0068857_100004492 | |||
| 433 | Ga0068857_100005666 | |||
| 434 | Ga0068857_100052936 | |||
| 435 | Ga0068857_100056799 | |||
| 436 | Ga0068857_100070576 | |||
| 437 | Ga0068854_100051724 | |||
| 438 | Ga0068854_100130022 | |||
| 439 | Ga0068856_100030651 | |||
| 440 | Ga0068852_100102802 | |||
| 441 | Ga0068852_100109847 | |||
| 442 | Ga0068859_100023011 | |||
| 443 | Ga0068859_100125878 | |||
| 444 | Ga0068859_100210528 | |||
| 445 | Ga0068864_100001903 | |||
| 446 | Ga0068864_100261496 | |||
| 447 | Ga0068866_10013289 | |||
| 448 | Ga0068866_10131467 | |||
| 449 | Ga0068861_100001158 | |||
| 450 | Ga0068861_100010534 | |||
| 451 | Ga0068861_100389682 | |||
| 452 | Ga0068870_10036006 | |||
| 453 | Ga0068870_10131340 | |||
| 454 | Ga0068863_100013208 | |||
| 455 | Ga0068863_100033199 | |||
| 456 | Ga0068863_100071027 | |||
| 457 | Ga0068863_100207588 | |||
| 458 | Ga0068858_100103349 | |||
| 459 | Ga0068860_100000829 | |||
| 460 | Ga0068860_100162432 | |||
| 461 | Ga0068862_100032280 | |||
| 462 | Ga0068862_100119220 | |||
| 463 | Ga0097621_100228281 | |||
| 464 | Ga0068871_100004781 | |||
| 465 | Ga0068871_100027409 | |||
| 466 | Ga0068871_100184498 | |||
| 467 | Ga0075428_100235756 | |||
| 468 | Ga0075430_100036702 | |||
| 469 | Ga0097620_100023011 | |||
| 470 | Ga0097620_100125875 | |||
| 471 | Ga0097620_100210529 | |||
| 472 | Ga0105240_10000597 | |||
| 473 | Ga0105240_10001169 | |||
| 474 | Ga0105240_10003084 | |||
| 475 | Ga0105240_10373856 | |||
| 476 | Ga0105240_10489904 | |||
| 477 | Ga0111539_10000458 | |||
| 478 | Ga0111539_10146119 | |||
| 479 | Ga0111539_10571622 | |||
| 480 | Ga0114129_10084381 | |||
| 481 | Ga0114129_10127574 | |||
| 482 | Ga0105241_10087288 | |||
| 483 | Ga0105242_10038132 | |||
| 484 | Ga0105242_10259335 | |||
| 485 | Ga0105248_10256479 | |||
| 486 | Ga0105238_10479452 | |||
| 487 | Ga0105249_10002578 | |||
| 488 | Ga0105249_10003210 | |||
| 489 | Ga0105249_10003219 | |||
| 490 | Ga0105249_10074886 | |||
| 491 | Ga0105249_10077490 | |||
| 492 | Ga0105249_10173585 | |||
| 493 | Ga0105249_10195059 | |||
| 494 | Ga0105249_10560330 | |||
| 495 | Ga0105239_10001099 | |||
| 496 | Ga0105239_10104797 | |||
| 497 | Ga0157371_10058474 | |||
| 498 | Ga0157370_10019993 | |||
| 499 | Ga0157369_10072687 | |||
| 500 | Ga0157374_10002019 | |||
| 501 | Ga0157374_10007296 | |||
| 502 | Ga0157374_10333218 | |||
| 503 | Ga0157378_10331621 | |||
| 504 | Ga0163162_10007503 | |||
| 505 | Ga0163162_10010897 | |||
| 506 | Ga0163162_10085955 | |||
| 507 | Ga0163162_10140397 | |||
| 508 | Ga0163162_10258448 | |||
| 509 | Ga0157372_10317634 | |||
| 510 | Ga0157372_10333623 | |||
| 511 | Ga0157375_10005759 | |||
| 512 | Ga0157375_10013374 | |||
| 513 | Ga0157375_10032496 | |||
| 514 | Ga0163163_10000899 | |||
| 515 | Ga0163163_10066996 | |||
| 516 | Ga0163163_10116644 | |||
| 517 | Ga0163163_10273341 | |||
| 518 | Ga0157380_10002400 | |||
| 519 | Ga0157380_10470511 | |||
| 520 | Ga0157377_10012235 | |||
| 521 | Ga0157377_10023729 | |||
| 522 | Ga0157377_10023828 | |||
| 523 | Ga0157379_10308739 | |||
| 524 | Ga0157376_10005742 | |||
| 525 | Ga0157376_10049423 | |||
| 526 | Ga0163161_10003712 | |||
| 527 | Ga0163161_10052586 | |||
| 528 | Ga0209436_100882 | |||
| 529 | Ga0209130_1000871 | |||
| 530 | Ga0207426_1000033 | |||
| 531 | Ga0207697_10011277 | |||
| 532 | Ga0207682_10009605 | |||
| 533 | Ga0207680_10016527 | |||
| 534 | Ga0207680_10173967 | |||
| 535 | Ga0207647_10027426 | |||
| 536 | Ga0207647_10140909 | |||
| 537 | Ga0207645_10002627 | |||
| 538 | Ga0207645_10025160 | |||
| 539 | Ga0207643_10001490 | |||
| 540 | Ga0207643_10008247 | |||
| 541 | Ga0207643_10069407 | |||
| 542 | Ga0207695_10000087 | |||
| 543 | Ga0207695_10000299 | |||
| 544 | Ga0207695_10000676 | |||
| 545 | Ga0207695_10184131 | |||
| 546 | Ga0207662_10064899 | |||
| 547 | Ga0207649_10023822 | |||
| 548 | Ga0207649_10049523 | |||
| 549 | Ga0207681_10003119 | |||
| 550 | Ga0207681_10014991 | |||
| 551 | Ga0207681_10146067 | |||
| 552 | Ga0207650_10291390 | |||
| 553 | Ga0207659_10009731 | |||
| 554 | Ga0207690_10086030 | |||
| 555 | Ga0207706_10000763 | |||
| 556 | Ga0207706_10013174 | |||
| 557 | Ga0207706_10020335 | |||
| 558 | Ga0207686_10001891 | |||
| 559 | Ga0207686_10225581 | |||
| 560 | Ga0207670_10006097 | |||
| 561 | Ga0207670_10011005 | |||
| 562 | Ga0207691_10049673 | |||
| 563 | Ga0207691_10090318 | |||
| 564 | Ga0207711_10432211 | |||
| 565 | Ga0207689_10016454 | |||
| 566 | Ga0207689_10031664 | |||
| 567 | Ga0207689_10064459 | |||
| 568 | Ga0207689_10102098 | |||
| 569 | Ga0207689_10157170 | |||
| 570 | Ga0207661_10012430 | |||
| 571 | Ga0207679_10021430 | |||
| 572 | Ga0207667_10000172 | |||
| 573 | Ga0207651_10191148 | |||
| 574 | Ga0207651_10235450 | |||
| 575 | Ga0207712_10001267 | |||
| 576 | Ga0207712_10010189 | |||
| 577 | Ga0207712_10022789 | |||
| 578 | Ga0207712_10043795 | |||
| 579 | Ga0207712_10083880 | |||
| 580 | Ga0207712_10105871 | |||
| 581 | Ga0207668_10053404 | |||
| 582 | Ga0207668_10263475 | |||
| 583 | Ga0207640_10042737 | |||
| 584 | Ga0207658_10068679 | |||
| 585 | Ga0207658_10127661 | |||
| 586 | Ga0207677_10001293 | |||
| 587 | Ga0207677_10035171 | |||
| 588 | Ga0207677_10315479 | |||
| 589 | Ga0207703_10071185 | |||
| 590 | Ga0207703_10163035 | |||
| 591 | Ga0207639_10015240 | |||
| 592 | Ga0207639_10021273 | |||
| 593 | Ga0207639_10030877 | |||
| 594 | Ga0207639_10112255 | |||
| 595 | Ga0207678_10031768 | |||
| 596 | Ga0207702_10022016 | |||
| 597 | Ga0207641_10000088 | |||
| 598 | Ga0207641_10010252 | |||
| 599 | Ga0207641_10104446 | |||
| 600 | Ga0207641_10117197 | |||
| 601 | Ga0207641_10135800 | |||
| 602 | Ga0207648_10006276 | |||
| 603 | Ga0207648_10009884 | |||
| 604 | Ga0207648_10066609 | |||
| 605 | Ga0207648_10161635 | |||
| 606 | Ga0207676_10033885 | |||
| 607 | Ga0207676_10037432 | |||
| 608 | Ga0207676_10348115 | |||
| 609 | Ga0207674_10001740 | |||
| 610 | Ga0207674_10033280 | |||
| 611 | Ga0207674_10034254 | |||
| 612 | Ga0207674_10035401 | |||
| 613 | Ga0207674_10112289 | |||
| 614 | Ga0207674_10223673 | |||
| 615 | Ga0207675_100000332 | |||
| 616 | Ga0207675_100002977 | |||
| 617 | Ga0207675_100052797 | |||
| 618 | Ga0207675_100454667 | |||
| 619 | Ga0207683_10016150 | |||
| 620 | Ga0207683_10251395 | |||
| 621 | Ga0207698_10063178 | |||
| 622 | Ga0207698_10066682 | |||
| 623 | Ga0207698_10249860 | |||
| 624 | Ga0207428_10119118 | |||
| 625 | Ga0268266_10292299 | |||
| 626 | Ga0268265_10006905 | |||
| 627 | Ga0268265_10203894 | |||
| 628 | Ga0268264_10010235 | |||
| 629 | Ga0268264_10122176 | |||
| 630 | Ga0265338_10095617 | |||
| 631 | Ga0307406_10021405 | |||
| 632 | Ga0373955_0045199 | |||
| 633 | Ga0373935_0094665 | |||
| 634 | Ga0439445_0043155 | |||
| 635 | Ga0450923_006746 | |||
| 636 | Ga0450898_002452 | |||
| 637 | Ga0439434_0012964 | |||
| 638 | Ga0466969_0021061 | |||
| 639 | Ga0466961_0048369 | |||
| 640 | Ga0466964_0008038 | |||
| 641 | Ga0466971_0035320 | |||
| 642 | Ga0466970_0079518 | |||
| 643 | Ga0466959_0002115 | |||
| 644 | Ga0466959_0008505 | |||
| 645 | Ga0466959_0205507 | |||
| 646 | Ga0466958_0095788 | |||
| 647 | Ga0466967_0129334 | |||
| 648 | Ga0495653_0066443 | |||
| 649 | Ga0495650_0036861 | |||
| 650 | Ga0495633_0029925 | |||
| 651 | Ga0495667_0037524 | |||
| 652 | Ga0495646_0092093 | |||
| 653 | Ga0495674_0105473 | |||
| 654 | Ga0495672_0026788 | |||
| 655 | Ga0495686_0010160 | |||
| 656 | Ga0496101_0159981 | |||
| 657 | Ga0496110_0117212 | |||
| 658 | Ga0496115_0090337 | |||
| 659 | Ga0496124_0059093 | |||
| 660 | Ga0501032_0065670 | |||
| 661 | Ga0501034_0004888 | |||
| 662 | Ga0501036_0000934 | |||
| 663 | Ga0501037_0116648 | |||
| 664 | Ga0501038_0007548 | |||
| 665 | Ga0501039_0010296 | |||
| 666 | Ga0501046_0005974 | |||
| 667 | Ga0501047_0088735 | |||
| 668 | Ga0501047_0172254 | |||
| 669 | Ga0501048_0063639 | |||
| 670 | Ga0501067_0087335 | |||
| 671 | Ga0501068_0065989 | |||
| 672 | Ga0501070_0003667 | |||
| 673 | Ga0501072_0025187 | |||
| 674 | Ga0501073_0012410 | |||
| 675 | Ga0501080_0024066 | |||
| 676 | Ga0501083_0000193 | |||
| 677 | Ga0501035_0063734 | |||
| 678 | Ga0501044_0005186 | |||
| 679 | nmdc:mga0qj67_9535_c1 | |||
| 680 | nmdc:mga08y16_18017_c1 | |||
| 681 | Ga0500644_0011243 | |||
| 682 | Ga0500616_0024453 | |||
| 683 | Ga0500616_0025341 | |||
| 684 | Ga0500611_000003 | |||
| 685 | Ga0501084_0024958 | |||
| 686 | Ga0466962_0024213 | |||
| 687 | 2819585898 | |||
| 688 | 2819676600 | |||
| 689 | 2902049648 | |||
| 690 | 2929159343 | |||
| 691 | 2929178022 | |||
| 692 | 2945980381 | |||
| 693 | 2946013755 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p53-assembly1.cif.gz_B | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate | 0.9707 | 3 | 368 |
| 6jku-assembly1.cif.gz_C | crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida | 0.9665 | 2 | 369 |
| 1ymy-assembly1.cif.gz_B | crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 | 0.9638 | 3 | 368 |
| 2p50-assembly2.cif.gz_D | crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn | 0.9619 | 3 | 368 |
| 3iv8-assembly2.cif.gz_D | n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate | 0.9614 | 1 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3iv8D01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9516 | 1 | 54 | 2.30.40.10 |
| 1yrrB01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9494 | 4 | 54 | 2.30.40.10 |
| 2vhlA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9442 | 56 | 342 | 3.20.20.140 |
| af_P42906_1_128_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9415 | 215 | 333 | 3.20.20.140 |
| af_O53382_52_348_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9408 | 56 | 336 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I5CSS3-F1-model_v4 | N-acetylglucosamine 6-phosphate deacetylase | 0.996 | 1 | 366 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A2S5A4R6-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase | 0.9919 | 3 | 369 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A7G6YIM0-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) | 0.9891 | 1 | 369 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A1I5CSS3-F1-model_v4 | N-acetylglucosamine 6-phosphate deacetylase | 0.9879 | 1 | 366 |
GO:0006046
GO:0008448 GO:0046872 |
| AF-A0A5B7ZZW1-F1-model_v4 | N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) | 0.9876 | 1 | 366 |
GO:0006046
GO:0008448 GO:0046872 |