F416701

General Info

Members Datasets Scaffolds Average Seq Length
346 187 693 363

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100141269|Ga0068864_1001412693
Length 396
Sequence MILCSRSSRSKGLATVLLPDKNGSAFFELFEYLASMQFLSAEKIFTGEEWLQNHAVVVNNNMIEDILPLSSITSSVKYFDNSFIAPAFIDLQIYGAAGKLLAVYPEKDSLVKLVEYCRYGGAAYCMPTVATHPYETFYECIDAVKEYWNGGGKGVPGLHIEGPWISYEKKGAHIAECIHIPTIGQVRQLLEYGKGVIKIITLAPEVCSKEIIDFILSYDIIISAGHSSATYDEATGAFNSGVTAATHLYNAMSPLQHRNPGMVGAIMDHSHVMASIIPDGYHVDYAAIRIAKQVMKERLFAITDAVTETGTGYYPHHLAGDKYESNGILSGSALTMVKAVKNLVEHCNIEPGEALRMCSLYPARVMGLQNRLGLIKKNYEASLVVMSNDLSTVSIL

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
134 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 2818991444 Filimonas endophytica 3197 Isolate Unclassified
182 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
183 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
184 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
185 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
186 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
187 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 0.87
Rhizosphere 93.64
Stem 0
Stem Tuber 0
Unclassified 21.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100141269 3300005618 Unclassified 2172
2 JGI25153J46596_10037263 3300003215 Bacteria 1549
3 rootH2_10004327 3300003320 Bacteria 11689
4 rootH2_10011035 3300003320 Bacteria 21460
5 rootH2_10099066 3300003320 Unclassified 2141
6 rootH2_10127001 3300003320 Bacteria 7405
7 rootL2_10016475 3300003322 Unclassified 2741
8 rootH1_10040303 3300003316 Bacteria 6010
9 rootH1_10040303 3300003323 Bacteria 6854
10 Ga0065704_10009511 3300005289 Bacteria 2453
11 Ga0065704_10181694 3300005289 Bacteria 1234
12 Ga0065712_10014389 3300005290 Bacteria 3282
13 Ga0065712_10068536 3300005290 Bacteria 10007
14 Ga0065715_10013863 3300005293 Unclassified 2012
15 Ga0065707_10176142 3300005295 Bacteria 1450
16 Ga0070676_10014348 3300005328 Unclassified 4354
17 Ga0070676_10155433 3300005328 Bacteria 1468
18 Ga0070683_100001974 3300005329 Bacteria 16065
19 Ga0070683_100013925 3300005329 Bacteria 7026
20 Ga0070683_100037362 3300005329 Bacteria 4446
21 Ga0070690_100014672 3300005330 Unclassified 4651
22 Ga0070670_100028700 3300005331 Unclassified 4789
23 Ga0070670_100100486 3300005331 Bacteria 2490
24 Ga0070670_100165581 3300005331 Unclassified 1917
25 Ga0070670_100182522 3300005331 Bacteria 1822
26 Ga0068869_100006296 3300005334 Bacteria 7514
27 Ga0068869_100031729 3300005334 Unclassified 3718
28 Ga0068869_100065472 3300005334 Unclassified 2675
29 Ga0068869_100073798 3300005334 Bacteria 2531
30 Ga0068869_100082307 3300005334 Bacteria 2405
31 Ga0070666_10002266 3300005335 Bacteria 11627
32 Ga0070666_10022858 3300005335 Bacteria 4065
33 Ga0070682_100017499 3300005337 Bacteria 4180
34 Ga0068868_100048054 3300005338 Bacteria 3347
35 Ga0070689_100007383 3300005340 Bacteria 7678
36 Ga0070689_100052469 3300005340 Unclassified 3154
37 Ga0070689_100069173 3300005340 Unclassified 2754
38 Ga0070689_100087605 3300005340 Unclassified 2450
39 Ga0070691_10012007 3300005341 Bacteria 3965
40 Ga0070661_100001789 3300005344 Bacteria 14905
41 Ga0070661_100122809 3300005344 Bacteria 1946
42 Ga0070668_100070052 3300005347 Unclassified 2729
43 Ga0070669_100007886 3300005353 Bacteria 7610
44 Ga0070675_100020154 3300005354 Bacteria 5321
45 Ga0070675_100022794 3300005354 Bacteria 5003
46 Ga0070675_100049701 3300005354 Bacteria 3442
47 Ga0070675_100326660 3300005354 Bacteria 1356
48 Ga0070673_100020795 3300005364 Bacteria 4741
49 Ga0070673_100149026 3300005364 Unclassified 1980
50 Ga0070688_100006727 3300005365 Bacteria 6161
51 Ga0070688_100047310 3300005365 Unclassified 2668
52 Ga0070688_100054092 3300005365 Unclassified 2513
53 Ga0070688_100069540 3300005365 Unclassified 2248
54 Ga0070659_100011103 3300005366 Bacteria 6654
55 Ga0070659_100028829 3300005366 Bacteria 4288
56 Ga0070701_10015464 3300005438 Unclassified 3526
57 Ga0070663_100117146 3300005455 Unclassified 2008
58 Ga0070678_100014132 3300005456 Bacteria 5027
59 Ga0070662_100002099 3300005457 Bacteria 12224
60 Ga0070662_100010756 3300005457 Bacteria 6023
61 Ga0070662_100041794 3300005457 Unclassified 3273
62 Ga0068867_100004729 3300005459 Bacteria 9582
63 Ga0068867_100042895 3300005459 Bacteria 3311
64 Ga0070685_10008428 3300005466 Bacteria 5295
65 Ga0070685_10012326 3300005466 Bacteria 4491
66 Ga0070685_10052076 3300005466 Unclassified 2368
67 Ga0070685_10062308 3300005466 Bacteria 2187
68 Ga0070685_10063248 3300005466 Unclassified 2172
69 Ga0070698_100001934 3300005471 Bacteria 23015
70 Ga0070698_100003667 3300005471 Bacteria 16868
71 Ga0070698_100011036 3300005471 Bacteria 9603
72 Ga0070699_100089446 3300005518 Bacteria 2690
73 Ga0070684_100002013 3300005535 Bacteria 14950
74 Ga0070684_100006052 3300005535 Bacteria 9321
75 Ga0068853_100000773 3300005539 Bacteria 22203
76 Ga0068853_100004150 3300005539 Bacteria 11165
77 Ga0068853_100007393 3300005539 Bacteria 8787
78 Ga0068853_100021303 3300005539 Bacteria 5403
79 Ga0068853_100275784 3300005539 Bacteria 1549
80 Ga0070686_100081836 3300005544 Bacteria 2140
81 Ga0070693_100150590 3300005547 Bacteria 1473
82 Ga0070665_100189474 3300005548 Bacteria 2058
83 Ga0068855_100000081 3300005563 Bacteria 115707
84 Ga0070664_100001372 3300005564 Bacteria 19398
85 Ga0070664_100171447 3300005564 Bacteria 1925
86 Ga0068857_100004492 3300005577 Bacteria 11788
87 Ga0068857_100005666 3300005577 Bacteria 10673
88 Ga0068857_100052936 3300005577 Bacteria 3601
89 Ga0068857_100056799 3300005577 Bacteria 3474
90 Ga0068857_100070576 3300005577 Bacteria 3112
91 Ga0068854_100051724 3300005578 Bacteria 2944
92 Ga0068854_100130022 3300005578 Unclassified 1921
93 Ga0068856_100030651 3300005614 Bacteria 5258
94 Ga0068852_100102802 3300005616 Bacteria 2583
95 Ga0068852_100109847 3300005616 Unclassified 2505
96 Ga0068859_100023011 3300005617 Bacteria 6249
97 Ga0068859_100125878 3300005617 Bacteria 2631
98 Ga0068859_100210528 3300005617 Unclassified 2030
99 Ga0068864_100001903 3300005618 Bacteria 17129
100 Ga0068864_100261496 3300005618 Unclassified 1610
101 Ga0068866_10013289 3300005718 Bacteria 3609
102 Ga0068866_10131467 3300005718 Unclassified 1424
103 Ga0068861_100001158 3300005719 Bacteria 16426
104 Ga0068861_100010534 3300005719 Bacteria 6419
105 Ga0068861_100389682 3300005719 Bacteria 1233
106 Ga0068870_10036006 3300005840 Bacteria 2544
107 Ga0068870_10131340 3300005840 Bacteria 1455
108 Ga0068863_100013208 3300005841 Bacteria 7965
109 Ga0068863_100033199 3300005841 Unclassified 4917
110 Ga0068863_100071027 3300005841 Bacteria 3293
111 Ga0068863_100207588 3300005841 Bacteria 1886
112 Ga0068858_100103349 3300005842 Bacteria 2658
113 Ga0068860_100000829 3300005843 Bacteria 34616
114 Ga0068860_100162432 3300005843 Bacteria 2154
115 Ga0068862_100032280 3300005844 Unclassified 4423
116 Ga0068862_100119220 3300005844 Bacteria 2324
117 Ga0097621_100228281 3300006237 Bacteria 1625
118 Ga0068871_100004781 3300006358 Bacteria 9468
119 Ga0068871_100027409 3300006358 Unclassified 4455
120 Ga0068871_100184498 3300006358 Bacteria 1794
121 Ga0075428_100235756 3300006844 Bacteria 1974
122 Ga0075430_100036702 3300006846 Bacteria 4155
123 Ga0097620_100023011 3300006931 Bacteria 6249
124 Ga0097620_100125875 3300006931 Bacteria 2631
125 Ga0097620_100210529 3300006931 Unclassified 2030
126 Ga0105240_10000597 3300009093 Bacteria 67036
127 Ga0105240_10001169 3300009093 Bacteria 46003
128 Ga0105240_10003084 3300009093 Bacteria 26189
129 Ga0105240_10373856 3300009093 Bacteria 1611
130 Ga0105240_10489904 3300009093 Bacteria 1369
131 Ga0111539_10000458 3300009094 Bacteria 51231
132 Ga0111539_10146119 3300009094 Bacteria 2768
133 Ga0111539_10571622 3300009094 Bacteria 1317
134 Ga0114129_10084381 3300009147 Bacteria 4410
135 Ga0114129_10127574 3300009147 Unclassified 3497
136 Ga0105241_10087288 3300009174 Bacteria 2455
137 Ga0105242_10038132 3300009176 Bacteria 3863
138 Ga0105242_10259335 3300009176 Bacteria 1570
139 Ga0105248_10256479 3300009177 Bacteria 1969
140 Ga0105238_10479452 3300009551 Bacteria 1243
141 Ga0105249_10002578 3300009553 Bacteria 15687
142 Ga0105249_10003210 3300009553 Bacteria 14149
143 Ga0105249_10003219 3300009553 Bacteria 14138
144 Ga0105249_10074886 3300009553 Bacteria 3134
145 Ga0105249_10077490 3300009553 Bacteria 3082
146 Ga0105249_10173585 3300009553 Bacteria 2092
147 Ga0105249_10195059 3300009553 Bacteria 1979
148 Ga0105249_10560330 3300009553 Bacteria 1194
149 Ga0105239_10001099 3300010375 Bacteria 37369
150 Ga0105239_10104797 3300010375 Bacteria 3131
151 Ga0157371_10058474 3300013102 Bacteria 2734
152 Ga0157370_10019993 3300013104 Bacteria 6698
153 Ga0157369_10072687 3300013105 Bacteria 3691
154 Ga0157374_10002019 3300013296 Bacteria 17033
155 Ga0157374_10007296 3300013296 Bacteria 9423
156 Ga0157374_10333218 3300013296 Bacteria 1505
157 Ga0157378_10331621 3300013297 Unclassified 1481
158 Ga0163162_10007503 3300013306 Bacteria 10617
159 Ga0163162_10010897 3300013306 Bacteria 8851
160 Ga0163162_10085955 3300013306 Bacteria 3222
161 Ga0163162_10140397 3300013306 Unclassified 2529
162 Ga0163162_10258448 3300013306 Bacteria 1873
163 Ga0157372_10317634 3300013307 Bacteria 1813
164 Ga0157372_10333623 3300013307 Bacteria 1766
165 Ga0157375_10005759 3300013308 Bacteria 10780
166 Ga0157375_10013374 3300013308 Bacteria 7300
167 Ga0157375_10032496 3300013308 Unclassified 4950
168 Ga0163163_10000899 3300014325 Bacteria 25214
169 Ga0163163_10066996 3300014325 Unclassified 3568
170 Ga0163163_10116644 3300014325 Bacteria 2701
171 Ga0163163_10273341 3300014325 Bacteria 1741
172 Ga0157380_10002400 3300014326 Bacteria 12600
173 Ga0157380_10470511 3300014326 Bacteria 1212
174 Ga0157377_10012235 3300014745 Bacteria 4310
175 Ga0157377_10023729 3300014745 Unclassified 3254
176 Ga0157377_10023828 3300014745 Unclassified 3248
177 Ga0157379_10308739 3300014968 Bacteria 1443
178 Ga0157376_10005742 3300014969 Bacteria 8692
179 Ga0157376_10049423 3300014969 Unclassified 3483
180 Ga0163161_10003712 3300017792 Bacteria 10697
181 Ga0163161_10052586 3300017792 Bacteria 2953
182 Ga0209436_100882 3300025208 Bacteria 11960
183 Ga0209130_1000871 3300025284 Bacteria 24706
184 Ga0207426_1000033 3300025302 Bacteria 455976
185 Ga0207697_10011277 3300025315 Unclassified 3785
186 Ga0207682_10009605 3300025893 Bacteria 3813
187 Ga0207680_10016527 3300025903 Bacteria 3876
188 Ga0207680_10173967 3300025903 Bacteria 1452
189 Ga0207647_10027426 3300025904 Bacteria 3712
190 Ga0207647_10140909 3300025904 Bacteria 1413
191 Ga0207645_10002627 3300025907 Bacteria 14014
192 Ga0207645_10025160 3300025907 Bacteria 3853
193 Ga0207643_10001490 3300025908 Bacteria 13411
194 Ga0207643_10008247 3300025908 Bacteria 5593
195 Ga0207643_10069407 3300025908 Unclassified 2026
196 Ga0207695_10000087 3300025913 Bacteria 276412
197 Ga0207695_10000299 3300025913 Bacteria 122118
198 Ga0207695_10000676 3300025913 Bacteria 67018
199 Ga0207695_10184131 3300025913 Bacteria 2009
200 Ga0207662_10064899 3300025918 Unclassified 2198
201 Ga0207649_10023822 3300025920 Bacteria 3550
202 Ga0207649_10049523 3300025920 Unclassified 2595
203 Ga0207681_10003119 3300025923 Bacteria 10425
204 Ga0207681_10014991 3300025923 Bacteria 4830
205 Ga0207681_10146067 3300025923 Unclassified 1767
206 Ga0207650_10291390 3300025925 Unclassified 1331
207 Ga0207659_10009731 3300025926 Bacteria 6012
208 Ga0207690_10086030 3300025932 Unclassified 2208
209 Ga0207706_10000763 3300025933 Bacteria 33452
210 Ga0207706_10013174 3300025933 Bacteria 7525
211 Ga0207706_10020335 3300025933 Bacteria 5967
212 Ga0207686_10001891 3300025934 Bacteria 11598
213 Ga0207686_10225581 3300025934 Bacteria 1355
214 Ga0207670_10006097 3300025936 Bacteria 6662
215 Ga0207670_10011005 3300025936 Bacteria 5231
216 Ga0207691_10049673 3300025940 Bacteria 3844
217 Ga0207691_10090318 3300025940 Bacteria 2746
218 Ga0207711_10432211 3300025941 Unclassified 1225
219 Ga0207689_10016454 3300025942 Bacteria 6260
220 Ga0207689_10031664 3300025942 Bacteria 4401
221 Ga0207689_10064459 3300025942 Bacteria 3015
222 Ga0207689_10102098 3300025942 Bacteria 2356
223 Ga0207689_10157170 3300025942 Unclassified 1874
224 Ga0207661_10012430 3300025944 Bacteria 6187
225 Ga0207679_10021430 3300025945 Unclassified 4381
226 Ga0207667_10000172 3300025949 Bacteria 95455
227 Ga0207651_10191148 3300025960 Unclassified 1633
228 Ga0207651_10235450 3300025960 Bacteria 1489
229 Ga0207712_10001267 3300025961 Bacteria 17398
230 Ga0207712_10010189 3300025961 Bacteria 5961
231 Ga0207712_10022789 3300025961 Bacteria 4127
232 Ga0207712_10043795 3300025961 Bacteria 3089
233 Ga0207712_10083880 3300025961 Unclassified 2327
234 Ga0207712_10105871 3300025961 Bacteria 2100
235 Ga0207668_10053404 3300025972 Unclassified 2800
236 Ga0207668_10263475 3300025972 Bacteria 1406
237 Ga0207640_10042737 3300025981 Bacteria 2892
238 Ga0207658_10068679 3300025986 Unclassified 2675
239 Ga0207658_10127661 3300025986 Bacteria 2038
240 Ga0207677_10001293 3300026023 Bacteria 13421
241 Ga0207677_10035171 3300026023 Bacteria 3250
242 Ga0207677_10315479 3300026023 Bacteria 1297
243 Ga0207703_10071185 3300026035 Unclassified 2872
244 Ga0207703_10163035 3300026035 Unclassified 1954
245 Ga0207639_10015240 3300026041 Bacteria 5418
246 Ga0207639_10021273 3300026041 Unclassified 4657
247 Ga0207639_10030877 3300026041 Bacteria 3933
248 Ga0207639_10112255 3300026041 Unclassified 2224
249 Ga0207678_10031768 3300026067 Bacteria 4603
250 Ga0207702_10022016 3300026078 Bacteria 5279
251 Ga0207641_10000088 3300026088 Bacteria 131959
252 Ga0207641_10010252 3300026088 Bacteria 7706
253 Ga0207641_10104446 3300026088 Unclassified 2501
254 Ga0207641_10117197 3300026088 Unclassified 2371
255 Ga0207641_10135800 3300026088 Bacteria 2214
256 Ga0207648_10006276 3300026089 Bacteria 11830
257 Ga0207648_10009884 3300026089 Bacteria 9094
258 Ga0207648_10066609 3300026089 Bacteria 3141
259 Ga0207648_10161635 3300026089 Bacteria 1978
260 Ga0207676_10033885 3300026095 Bacteria 3863
261 Ga0207676_10037432 3300026095 Unclassified 3697
262 Ga0207676_10348115 3300026095 Unclassified 1369
263 Ga0207674_10001740 3300026116 Bacteria 27826
264 Ga0207674_10033280 3300026116 Bacteria 5397
265 Ga0207674_10034254 3300026116 Bacteria 5312
266 Ga0207674_10035401 3300026116 Bacteria 5210
267 Ga0207674_10112289 3300026116 Bacteria 2699
268 Ga0207674_10223673 3300026116 Bacteria 1830
269 Ga0207675_100000332 3300026118 Bacteria 45114
270 Ga0207675_100002977 3300026118 Bacteria 16664
271 Ga0207675_100052797 3300026118 Bacteria 3792
272 Ga0207675_100454667 3300026118 Bacteria 1269
273 Ga0207683_10016150 3300026121 Bacteria 6354
274 Ga0207683_10251395 3300026121 Unclassified 1613
275 Ga0207698_10063178 3300026142 Bacteria 2896
276 Ga0207698_10066682 3300026142 Bacteria 2834
277 Ga0207698_10249860 3300026142 Bacteria 1622
278 Ga0207428_10119118 3300027907 Bacteria 2026
279 Ga0268266_10292299 3300028379 Bacteria 1518
280 Ga0268265_10006905 3300028380 Bacteria 7679
281 Ga0268265_10203894 3300028380 Bacteria 1718
282 Ga0268264_10010235 3300028381 Bacteria 7763
283 Ga0268264_10122176 3300028381 Bacteria 2296
284 Ga0265338_10095617 3300028800 Bacteria 2440
285 Ga0307406_10021405 3300031901 Bacteria 3824
286 Ga0373955_0045199 3300035172 Bacteria 2376
287 Ga0373935_0094665 3300035692 Unclassified 1961
288 Ga0439445_0043155 3300042004 Bacteria 1203
289 Ga0450923_006746 3300042125 Bacteria 1916
290 Ga0450898_002452 3300042134 Bacteria 2584
291 Ga0439434_0012964 3300042435 Bacteria 2471
292 Ga0466969_0021061 3300044656 Bacteria 3373
293 Ga0466961_0048369 3300044693 Bacteria 2718
294 Ga0466964_0008038 3300044706 Bacteria 3954
295 Ga0466971_0035320 3300044719 Bacteria 2240
296 Ga0466970_0079518 3300044765 Bacteria 1770
297 Ga0466959_0002115 3300045049 Bacteria 12564
298 Ga0466959_0008505 3300045049 Bacteria 7263
299 Ga0466959_0205507 3300045049 Bacteria 1370
300 Ga0466958_0095788 3300045836 Unclassified 1840
301 Ga0466967_0129334 3300045976 Bacteria 2343
302 Ga0495653_0066443 3300046463 Unclassified 2713
303 Ga0495650_0036861 3300046471 Bacteria 2135
304 Ga0495633_0029925 3300046558 Bacteria 2647
305 Ga0495667_0037524 3300046559 Unclassified 3229
306 Ga0495646_0092093 3300046680 Unclassified 1749
307 Ga0495674_0105473 3300047319 Bacteria 2395
308 Ga0495672_0026788 3300047320 Unclassified 3672
309 Ga0495686_0010160 3300047472 Bacteria 6715
310 Ga0496101_0159981 3300048904 Bacteria 1727
311 Ga0496110_0117212 3300048913 Unclassified 2398
312 Ga0496115_0090337 3300048918 Bacteria 2502
313 Ga0496124_0059093 3300048927 Bacteria 3222
314 Ga0501032_0065670 3300049569 Unclassified 2426
315 Ga0501034_0004888 3300049571 Bacteria 14781
316 Ga0501036_0000934 3300049572 Bacteria 21944
317 Ga0501037_0116648 3300049573 Bacteria 1921
318 Ga0501038_0007548 3300049574 Bacteria 10025
319 Ga0501039_0010296 3300049575 Bacteria 7133
320 Ga0501046_0005974 3300049580 Bacteria 10837
321 Ga0501047_0088735 3300049581 Bacteria 2969
322 Ga0501047_0172254 3300049581 Bacteria 2033
323 Ga0501048_0063639 3300049582 Bacteria 2608
324 Ga0501067_0087335 3300049583 Bacteria 1730
325 Ga0501068_0065989 3300049584 Bacteria 2204
326 Ga0501070_0003667 3300049586 Bacteria 13277
327 Ga0501072_0025187 3300049588 Bacteria 4633
328 Ga0501073_0012410 3300049589 Bacteria 6217
329 Ga0501080_0024066 3300049742 Bacteria 5644
330 Ga0501083_0000193 3300049744 Bacteria 39210
331 Ga0501035_0063734 3300049822 Unclassified 3277
332 Ga0501044_0005186 3300049823 Bacteria 14501
333 nmdc:mga0qj67_9535_c1 3300050509 Bacteria 7233
334 nmdc:mga08y16_18017_c1 3300050511 Bacteria 7439
335 Ga0500644_0011243 3300053088 Unclassified 2443
336 Ga0500616_0024453 3300053153 Unclassified 3356
337 Ga0500616_0025341 3300053153 Unclassified 3290
338 Ga0500611_000003 3300053727 Bacteria 333431
339 Ga0501084_0024958 3300054114 Bacteria 4988
340 Ga0466962_0024213 3300061719 Bacteria 2917
341 2819585898 2818991444 Bacteria 6968812
342 2819676600 2818991460 Bacteria 7595395
343 2902049648 2902048731 Bacteria 4976191
344 2929159343 2929154850 Bacteria 6753285
345 2929178022 2929177148 Bacteria 7883697
346 2945980381 2945977869 Bacteria 7777518
347 2946013755 2946013367 Bacteria 7766675
348 Ga0068864_100141269
349 JGI25153J46596_10037263
350 rootH2_10004327
351 rootH2_10011035
352 rootH2_10099066
353 rootH2_10127001
354 rootL2_10016475
355 rootH1_10040303
356 Ga0065704_10009511
357 Ga0065704_10181694
358 Ga0065712_10014389
359 Ga0065712_10068536
360 Ga0065715_10013863
361 Ga0065707_10176142
362 Ga0070676_10014348
363 Ga0070676_10155433
364 Ga0070683_100001974
365 Ga0070683_100013925
366 Ga0070683_100037362
367 Ga0070690_100014672
368 Ga0070670_100028700
369 Ga0070670_100100486
370 Ga0070670_100165581
371 Ga0070670_100182522
372 Ga0068869_100006296
373 Ga0068869_100031729
374 Ga0068869_100065472
375 Ga0068869_100073798
376 Ga0068869_100082307
377 Ga0070666_10002266
378 Ga0070666_10022858
379 Ga0070682_100017499
380 Ga0068868_100048054
381 Ga0070689_100007383
382 Ga0070689_100052469
383 Ga0070689_100069173
384 Ga0070689_100087605
385 Ga0070691_10012007
386 Ga0070661_100001789
387 Ga0070661_100122809
388 Ga0070668_100070052
389 Ga0070669_100007886
390 Ga0070675_100020154
391 Ga0070675_100022794
392 Ga0070675_100049701
393 Ga0070675_100326660
394 Ga0070673_100020795
395 Ga0070673_100149026
396 Ga0070688_100006727
397 Ga0070688_100047310
398 Ga0070688_100054092
399 Ga0070688_100069540
400 Ga0070659_100011103
401 Ga0070659_100028829
402 Ga0070701_10015464
403 Ga0070663_100117146
404 Ga0070678_100014132
405 Ga0070662_100002099
406 Ga0070662_100010756
407 Ga0070662_100041794
408 Ga0068867_100004729
409 Ga0068867_100042895
410 Ga0070685_10008428
411 Ga0070685_10012326
412 Ga0070685_10052076
413 Ga0070685_10062308
414 Ga0070685_10063248
415 Ga0070698_100001934
416 Ga0070698_100003667
417 Ga0070698_100011036
418 Ga0070699_100089446
419 Ga0070684_100002013
420 Ga0070684_100006052
421 Ga0068853_100000773
422 Ga0068853_100004150
423 Ga0068853_100007393
424 Ga0068853_100021303
425 Ga0068853_100275784
426 Ga0070686_100081836
427 Ga0070693_100150590
428 Ga0070665_100189474
429 Ga0068855_100000081
430 Ga0070664_100001372
431 Ga0070664_100171447
432 Ga0068857_100004492
433 Ga0068857_100005666
434 Ga0068857_100052936
435 Ga0068857_100056799
436 Ga0068857_100070576
437 Ga0068854_100051724
438 Ga0068854_100130022
439 Ga0068856_100030651
440 Ga0068852_100102802
441 Ga0068852_100109847
442 Ga0068859_100023011
443 Ga0068859_100125878
444 Ga0068859_100210528
445 Ga0068864_100001903
446 Ga0068864_100261496
447 Ga0068866_10013289
448 Ga0068866_10131467
449 Ga0068861_100001158
450 Ga0068861_100010534
451 Ga0068861_100389682
452 Ga0068870_10036006
453 Ga0068870_10131340
454 Ga0068863_100013208
455 Ga0068863_100033199
456 Ga0068863_100071027
457 Ga0068863_100207588
458 Ga0068858_100103349
459 Ga0068860_100000829
460 Ga0068860_100162432
461 Ga0068862_100032280
462 Ga0068862_100119220
463 Ga0097621_100228281
464 Ga0068871_100004781
465 Ga0068871_100027409
466 Ga0068871_100184498
467 Ga0075428_100235756
468 Ga0075430_100036702
469 Ga0097620_100023011
470 Ga0097620_100125875
471 Ga0097620_100210529
472 Ga0105240_10000597
473 Ga0105240_10001169
474 Ga0105240_10003084
475 Ga0105240_10373856
476 Ga0105240_10489904
477 Ga0111539_10000458
478 Ga0111539_10146119
479 Ga0111539_10571622
480 Ga0114129_10084381
481 Ga0114129_10127574
482 Ga0105241_10087288
483 Ga0105242_10038132
484 Ga0105242_10259335
485 Ga0105248_10256479
486 Ga0105238_10479452
487 Ga0105249_10002578
488 Ga0105249_10003210
489 Ga0105249_10003219
490 Ga0105249_10074886
491 Ga0105249_10077490
492 Ga0105249_10173585
493 Ga0105249_10195059
494 Ga0105249_10560330
495 Ga0105239_10001099
496 Ga0105239_10104797
497 Ga0157371_10058474
498 Ga0157370_10019993
499 Ga0157369_10072687
500 Ga0157374_10002019
501 Ga0157374_10007296
502 Ga0157374_10333218
503 Ga0157378_10331621
504 Ga0163162_10007503
505 Ga0163162_10010897
506 Ga0163162_10085955
507 Ga0163162_10140397
508 Ga0163162_10258448
509 Ga0157372_10317634
510 Ga0157372_10333623
511 Ga0157375_10005759
512 Ga0157375_10013374
513 Ga0157375_10032496
514 Ga0163163_10000899
515 Ga0163163_10066996
516 Ga0163163_10116644
517 Ga0163163_10273341
518 Ga0157380_10002400
519 Ga0157380_10470511
520 Ga0157377_10012235
521 Ga0157377_10023729
522 Ga0157377_10023828
523 Ga0157379_10308739
524 Ga0157376_10005742
525 Ga0157376_10049423
526 Ga0163161_10003712
527 Ga0163161_10052586
528 Ga0209436_100882
529 Ga0209130_1000871
530 Ga0207426_1000033
531 Ga0207697_10011277
532 Ga0207682_10009605
533 Ga0207680_10016527
534 Ga0207680_10173967
535 Ga0207647_10027426
536 Ga0207647_10140909
537 Ga0207645_10002627
538 Ga0207645_10025160
539 Ga0207643_10001490
540 Ga0207643_10008247
541 Ga0207643_10069407
542 Ga0207695_10000087
543 Ga0207695_10000299
544 Ga0207695_10000676
545 Ga0207695_10184131
546 Ga0207662_10064899
547 Ga0207649_10023822
548 Ga0207649_10049523
549 Ga0207681_10003119
550 Ga0207681_10014991
551 Ga0207681_10146067
552 Ga0207650_10291390
553 Ga0207659_10009731
554 Ga0207690_10086030
555 Ga0207706_10000763
556 Ga0207706_10013174
557 Ga0207706_10020335
558 Ga0207686_10001891
559 Ga0207686_10225581
560 Ga0207670_10006097
561 Ga0207670_10011005
562 Ga0207691_10049673
563 Ga0207691_10090318
564 Ga0207711_10432211
565 Ga0207689_10016454
566 Ga0207689_10031664
567 Ga0207689_10064459
568 Ga0207689_10102098
569 Ga0207689_10157170
570 Ga0207661_10012430
571 Ga0207679_10021430
572 Ga0207667_10000172
573 Ga0207651_10191148
574 Ga0207651_10235450
575 Ga0207712_10001267
576 Ga0207712_10010189
577 Ga0207712_10022789
578 Ga0207712_10043795
579 Ga0207712_10083880
580 Ga0207712_10105871
581 Ga0207668_10053404
582 Ga0207668_10263475
583 Ga0207640_10042737
584 Ga0207658_10068679
585 Ga0207658_10127661
586 Ga0207677_10001293
587 Ga0207677_10035171
588 Ga0207677_10315479
589 Ga0207703_10071185
590 Ga0207703_10163035
591 Ga0207639_10015240
592 Ga0207639_10021273
593 Ga0207639_10030877
594 Ga0207639_10112255
595 Ga0207678_10031768
596 Ga0207702_10022016
597 Ga0207641_10000088
598 Ga0207641_10010252
599 Ga0207641_10104446
600 Ga0207641_10117197
601 Ga0207641_10135800
602 Ga0207648_10006276
603 Ga0207648_10009884
604 Ga0207648_10066609
605 Ga0207648_10161635
606 Ga0207676_10033885
607 Ga0207676_10037432
608 Ga0207676_10348115
609 Ga0207674_10001740
610 Ga0207674_10033280
611 Ga0207674_10034254
612 Ga0207674_10035401
613 Ga0207674_10112289
614 Ga0207674_10223673
615 Ga0207675_100000332
616 Ga0207675_100002977
617 Ga0207675_100052797
618 Ga0207675_100454667
619 Ga0207683_10016150
620 Ga0207683_10251395
621 Ga0207698_10063178
622 Ga0207698_10066682
623 Ga0207698_10249860
624 Ga0207428_10119118
625 Ga0268266_10292299
626 Ga0268265_10006905
627 Ga0268265_10203894
628 Ga0268264_10010235
629 Ga0268264_10122176
630 Ga0265338_10095617
631 Ga0307406_10021405
632 Ga0373955_0045199
633 Ga0373935_0094665
634 Ga0439445_0043155
635 Ga0450923_006746
636 Ga0450898_002452
637 Ga0439434_0012964
638 Ga0466969_0021061
639 Ga0466961_0048369
640 Ga0466964_0008038
641 Ga0466971_0035320
642 Ga0466970_0079518
643 Ga0466959_0002115
644 Ga0466959_0008505
645 Ga0466959_0205507
646 Ga0466958_0095788
647 Ga0466967_0129334
648 Ga0495653_0066443
649 Ga0495650_0036861
650 Ga0495633_0029925
651 Ga0495667_0037524
652 Ga0495646_0092093
653 Ga0495674_0105473
654 Ga0495672_0026788
655 Ga0495686_0010160
656 Ga0496101_0159981
657 Ga0496110_0117212
658 Ga0496115_0090337
659 Ga0496124_0059093
660 Ga0501032_0065670
661 Ga0501034_0004888
662 Ga0501036_0000934
663 Ga0501037_0116648
664 Ga0501038_0007548
665 Ga0501039_0010296
666 Ga0501046_0005974
667 Ga0501047_0088735
668 Ga0501047_0172254
669 Ga0501048_0063639
670 Ga0501067_0087335
671 Ga0501068_0065989
672 Ga0501070_0003667
673 Ga0501072_0025187
674 Ga0501073_0012410
675 Ga0501080_0024066
676 Ga0501083_0000193
677 Ga0501035_0063734
678 Ga0501044_0005186
679 nmdc:mga0qj67_9535_c1
680 nmdc:mga08y16_18017_c1
681 Ga0500644_0011243
682 Ga0500616_0024453
683 Ga0500616_0025341
684 Ga0500611_000003
685 Ga0501084_0024958
686 Ga0466962_0024213
687 2819585898
688 2819676600
689 2902049648
690 2929159343
691 2929178022
692 2945980381
693 2946013755

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

83

394

0.93

PF22643

NagA_N

NagA composite domain

36

80

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p53-assembly1.cif.gz_B crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate 0.9707 3 368
6jku-assembly1.cif.gz_C crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida 0.9665 2 369
1ymy-assembly1.cif.gz_B crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 0.9638 3 368
2p50-assembly2.cif.gz_D crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.9619 3 368
3iv8-assembly2.cif.gz_D n-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate 0.9614 1 369
ID Description Score Start End Superfamily
3iv8D01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9516 1 54 2.30.40.10
1yrrB01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9494 4 54 2.30.40.10
2vhlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9442 56 342 3.20.20.140
af_P42906_1_128_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9415 215 333 3.20.20.140
af_O53382_52_348_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9408 56 336 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A1I5CSS3-F1-model_v4 N-acetylglucosamine 6-phosphate deacetylase 0.996 1 366 GO:0006046
GO:0008448
GO:0046872
AF-A0A2S5A4R6-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9919 3 369 GO:0006046
GO:0008448
GO:0046872
AF-A0A7G6YIM0-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) 0.9891 1 369 GO:0006046
GO:0008448
GO:0046872
AF-A0A1I5CSS3-F1-model_v4 N-acetylglucosamine 6-phosphate deacetylase 0.9879 1 366 GO:0006046
GO:0008448
GO:0046872
AF-A0A5B7ZZW1-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase (EC 3.5.1.25) 0.9876 1 366 GO:0006046
GO:0008448
GO:0046872

Map