F416705

General Info

Members Datasets Scaffolds Average Seq Length
346 258 690 441

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100099096|Ga0068863_1000990962
Length 471
Sequence VLQGGVGVDGPHARLSPERMNVMSEPTTPDLDPADGVRAVELDRAHVFHSWSAQGALQPFVIAGALGCEVWDFDGNRYLDFSSQLVNINIGHGHPKVVAAIQKQAATLPTVAPAHANLARGEAAKRILSKAGAPFTKVFFTNGGADANENAMRMARLVTGRDKILSQYRSYHGNTGAAIVATGDWRRVPNEFARGHVHFFGPFAYRSEFWSTTPEEESARALHSLERIIQAEGANSFAALIVEGVPGTAGVLVPPPGYFAGLRALADKYGFKLIVDEVMSGFGRTGDWFAWQNETINPEHVMPDLITFAKGVNSGYVPAGGVIISESIAKEFDDQVFPGGLTYSGHPLAMASIVASIDAMDEEGIVTNAATIGREVLGPGLVELASRHPMIGEVRGLGVFWALDLVMDAASREPVAPATIGLLKAELLKRGLLPFTADNRIHVVPPCTVTAEQVATALAIYDEAFTAVEAI

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
133 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
134 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
135 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
136 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
137 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
138 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
142 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
143 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
146 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
147 2547132181 Kosakonia sacchari SP1 Isolate Stem
148 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
149 2561511199 Enterobacter sp. R4-368 Isolate Nodule
150 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
151 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
152 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
153 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
154 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
155 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
156 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
157 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
158 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
159 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
160 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
161 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
162 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
163 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
164 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
165 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
166 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
167 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
168 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
169 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
170 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
171 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
172 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
173 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
174 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
175 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
176 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
177 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
178 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
179 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
180 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
181 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
182 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
183 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
184 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
185 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
186 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
187 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
188 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
189 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
190 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
191 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
192 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
193 2636415599 Klebsiella variicola DX120E Isolate Unclassified
194 2643221549 Agromyces sp. Root1464 Isolate Unclassified
195 2643221566 Microbacterium sp. Root166 Isolate Unclassified
196 2643221572 Leifsonia sp. Root60 Isolate Unclassified
197 2643221576 Nocardioides sp. Root614 Isolate Unclassified
198 2643221590 Nocardioides sp. Root682 Isolate Unclassified
199 2643221597 Microbacterium sp. Root180 Isolate Unclassified
200 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
201 2643221649 Leifsonia sp. Root4 Isolate Unclassified
202 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
203 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
204 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
205 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
206 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
207 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
208 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
209 2738541305 Nocardioides sp. CF167 Isolate Unclassified
210 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
211 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
212 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
213 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
214 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
215 2775507074 Klebsiella sp. D5A Isolate Unclassified
216 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
217 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
218 2808606372 Agromyces sp. 23-23 Isolate Unclassified
219 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
220 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
221 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
222 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
223 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
224 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
225 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
226 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
227 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
228 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
229 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
230 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
231 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
232 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
233 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
234 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
235 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
236 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
237 2919069694 Microbacterium sp. 1154 Isolate Unclassified
238 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
239 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
240 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
241 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
242 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
243 2952252522 Salinicola sp. DM10 Isolate Unclassified
244 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
245 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
246 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
247 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
248 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
249 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
250 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
251 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
252 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
253 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
254 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
255 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
256 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
257 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
258 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.05
Metatranscriptomes 0.29
Isolates 32.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.87
Bulb 0
Endosphere 13.01
Nodule 0.87
Rhizoplane 13.87
Rhizosphere 50.58
Stem 0.29
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100099096 3300005841 Bacteria 2768
2 RicEn_C4537 2010549000 Bacteria 4167
3 Ga0006562J51391_1064682 3300003578 Bacteria 3464
4 Ga0058692_1001419 3300003856 Bacteria 8824
5 Ga0070658_10000516 3300005327 Bacteria 33519
6 Ga0070658_10018666 3300005327 Bacteria 5554
7 Ga0070658_10030682 3300005327 Bacteria 4318
8 Ga0070660_100024333 3300005339 Bacteria 4493
9 Ga0070661_100140343 3300005344 Bacteria 1821
10 Ga0070659_100046495 3300005366 Bacteria 3402
11 Ga0070667_100011816 3300005367 Bacteria 7218
12 Ga0070663_100016183 3300005455 Bacteria 4835
13 Ga0070685_10005234 3300005466 Bacteria 6581
14 Ga0068853_100006163 3300005539 Bacteria 9499
15 Ga0070672_100053862 3300005543 Bacteria 3147
16 Ga0068855_100029547 3300005563 Bacteria 6551
17 Ga0068855_100214496 3300005563 Bacteria 2161
18 Ga0068857_100145773 3300005577 Bacteria 2142
19 Ga0068856_100019177 3300005614 Bacteria 6640
20 Ga0068856_100157479 3300005614 Bacteria 2281
21 Ga0068852_100131970 3300005616 Bacteria 2301
22 Ga0068852_100152037 3300005616 Bacteria 2153
23 Ga0068851_10000001 3300005834 Bacteria 495512
24 Ga0068858_100000276 3300005842 Bacteria 55258
25 Ga0075365_10023263 3300006038 Bacteria 3895
26 Ga0075364_10024788 3300006051 Bacteria 3812
27 Ga0075432_10026654 3300006058 Bacteria 1986
28 Ga0075367_10020095 3300006178 Bacteria 3714
29 Ga0075369_10011362 3300006186 Bacteria 3503
30 Ga0075369_10031867 3300006186 Bacteria 2228
31 Ga0075370_10007264 3300006353 Bacteria 5637
32 Ga0079104_1000136 3300006946 Bacteria 103342
33 Ga0105251_10000082 3300009011 Bacteria 90513
34 Ga0105251_10028274 3300009011 Bacteria 2834
35 Ga0105251_10096167 3300009011 Bacteria 1357
36 Ga0105244_10000082 3300009036 Bacteria 106218
37 Ga0105244_10025587 3300009036 Bacteria 3207
38 Ga0105244_10031673 3300009036 Bacteria 2806
39 Ga0105250_10000035 3300009092 Bacteria 153410
40 Ga0105240_10310473 3300009093 Bacteria 1801
41 Ga0105245_10080774 3300009098 Bacteria 2971
42 Ga0105243_10006629 3300009148 Bacteria 8940
43 Ga0105248_10000326 3300009177 Bacteria 56477
44 Ga0105237_10000341 3300009545 Bacteria 65672
45 Ga0105239_10009254 3300010375 Bacteria 11136
46 Ga0105239_10054716 3300010375 Bacteria 4378
47 Ga0157371_10000794 3300013102 Bacteria 36216
48 Ga0157370_10002942 3300013104 Bacteria 20276
49 Ga0171462_1001 3300013250 Bacteria 1135406
50 Ga0157379_10004212 3300014968 Bacteria 12284
51 Ga0182006_1006543 3300015261 Bacteria 5406
52 Ga0213876_10000368 3300021384 Bacteria 38187
53 Ga0209148_1000695 3300025254 Bacteria 27262
54 Ga0207656_10000002 3300025321 Bacteria 792178
55 Ga0207696_1000007 3300025711 Bacteria 578417
56 Ga0207655_1000105 3300025728 Bacteria 182927
57 Ga0207655_1005416 3300025728 Bacteria 8681
58 Ga0207655_1018899 3300025728 Bacteria 3631
59 Ga0207655_1043497 3300025728 Bacteria 1898
60 Ga0207713_1000005 3300025735 Bacteria 649958
61 Ga0207713_1000006 3300025735 Bacteria 586163
62 Ga0207647_10008756 3300025904 Bacteria 7224
63 Ga0207705_10000001 3300025909 Bacteria 2061880
64 Ga0207705_10024665 3300025909 Bacteria 4291
65 Ga0207705_10126100 3300025909 Bacteria 1903
66 Ga0207654_10000001 3300025911 Bacteria 1816198
67 Ga0207695_10009910 3300025913 Bacteria 11708
68 Ga0207695_10010927 3300025913 Bacteria 11043
69 Ga0207671_10000002 3300025914 Bacteria 1144816
70 Ga0207671_10092789 3300025914 Bacteria 2277
71 Ga0207657_10008837 3300025919 Bacteria 10190
72 Ga0207657_10029317 3300025919 Bacteria 5011
73 Ga0207694_10000395 3300025924 Bacteria 40665
74 Ga0207690_10001349 3300025932 Bacteria 15403
75 Ga0207690_10075375 3300025932 Bacteria 2339
76 Ga0207709_10005896 3300025935 Bacteria 6915
77 Ga0207691_10071543 3300025940 Bacteria 3130
78 Ga0207711_10001610 3300025941 Bacteria 20866
79 Ga0207667_10000384 3300025949 Bacteria 59816
80 Ga0207667_10135977 3300025949 Bacteria 2531
81 Ga0207658_10069792 3300025986 Bacteria 2656
82 Ga0207677_10148120 3300026023 Bacteria 1807
83 Ga0207703_10000141 3300026035 Bacteria 86068
84 Ga0207639_10005396 3300026041 Bacteria 8644
85 Ga0207639_10192665 3300026041 Bacteria 1742
86 Ga0207678_10011578 3300026067 Bacteria 7747
87 Ga0207702_10031914 3300026078 Bacteria 4394
88 Ga0207674_10055418 3300026116 Bacteria 4030
89 Ga0207674_10157122 3300026116 Bacteria 2229
90 Ga0207683_10192447 3300026121 Bacteria 1852
91 Ga0207698_10000297 3300026142 Bacteria 29970
92 Ga0207698_10116910 3300026142 Bacteria 2248
93 Ga0207698_10127632 3300026142 Bacteria 2166
94 Ga0209281_1000041 3300027111 Bacteria 347825
95 Ga0209371_1000050 3300027312 Bacteria 278645
96 Ga0209371_1000112 3300027312 Bacteria 139930
97 Ga0209371_1000147 3300027312 Bacteria 113313
98 Ga0209371_1000234 3300027312 Bacteria 70154
99 Ga0307515_10147602 3300028794 Bacteria 2481
100 Ga0268256_1000017 3300030500 Bacteria 600718
101 Ga0268256_1000121 3300030500 Bacteria 113313
102 Ga0268256_1000877 3300030500 Bacteria 20864
103 Ga0307408_100000002 3300031548 Bacteria 827227
104 Ga0436365_0117120 3300039437 Bacteria 67592
105 Ga0439442_000014 3300042002 Bacteria 47589
106 Ga0466965_0000016 3300044683 Bacteria 81402
107 Ga0466965_0021986 3300044683 Bacteria 3074
108 Ga0466970_0001281 3300044765 Bacteria 12165
109 Ga0466960_0011790 3300044901 Bacteria 3671
110 Ga0466960_0015707 3300044901 Bacteria 3270
111 Ga0466967_0080525 3300045976 Bacteria 2939
112 Ga0495627_000009 3300046453 Bacteria 463964
113 Ga0495590_0000891 3300046457 Bacteria 13373
114 Ga0495650_0003905 3300046471 Bacteria 10523
115 Ga0495650_0003922 3300046471 Bacteria 10490
116 Ga0495605_0000312 3300046474 Bacteria 50858
117 Ga0495605_0013759 3300046474 Bacteria 4447
118 Ga0495583_0000514 3300046506 Bacteria 55251
119 Ga0495606_0000293 3300046507 Bacteria 86455
120 Ga0495632_0000163 3300046519 Bacteria 69406
121 Ga0495643_0000148 3300046522 Bacteria 113969
122 Ga0495643_0006279 3300046522 Bacteria 7861
123 Ga0495668_0082364 3300046616 Bacteria 1765
124 Ga0495625_0148994 3300046660 Bacteria 1574
125 Ga0495661_0000814 3300046665 Bacteria 29298
126 Ga0495671_0005312 3300046692 Bacteria 7560
127 Ga0495649_0001818 3300046694 Bacteria 15668
128 Ga0495649_0018853 3300046694 Bacteria 3876
129 Ga0495660_0000095 3300046810 Bacteria 94795
130 Ga0495660_0105894 3300046810 Bacteria 1441
131 Ga0495673_0000561 3300047469 Bacteria 37888
132 Ga0495686_0045978 3300047472 Bacteria 2761
133 Ga0496111_0001803 3300048914 Bacteria 12568
134 Ga0496113_0079963 3300048916 Bacteria 2503
135 Ga0496114_0101511 3300048917 Bacteria 2456
136 Ga0496114_0279008 3300048917 Bacteria 1473
137 Ga0496115_0094727 3300048918 Bacteria 2443
138 Ga0496117_0007927 3300048920 Bacteria 10204
139 Ga0496119_0001402 3300048922 Bacteria 29193
140 Ga0496119_0005717 3300048922 Bacteria 11794
141 Ga0496119_0024831 3300048922 Bacteria 4203
142 Ga0496120_0000882 3300048923 Bacteria 42252
143 Ga0496120_0005757 3300048923 Bacteria 9745
144 Ga0496120_0012440 3300048923 Bacteria 5794
145 Ga0496122_0000116 3300048925 Bacteria 183371
146 Ga0496122_0000866 3300048925 Bacteria 57016
147 Ga0496122_0000995 3300048925 Bacteria 50459
148 Ga0496122_0005733 3300048925 Bacteria 14640
149 Ga0496122_0007542 3300048925 Bacteria 12055
150 Ga0496122_0023089 3300048925 Bacteria 5501
151 Ga0496123_0000009 3300048926 Bacteria 509486
152 Ga0496123_0000413 3300048926 Bacteria 78006
153 Ga0496123_0000533 3300048926 Bacteria 65458
154 Ga0496123_0001121 3300048926 Bacteria 39976
155 Ga0496123_0001148 3300048926 Bacteria 39511
156 Ga0496124_0001764 3300048927 Bacteria 30135
157 Ga0496124_0002284 3300048927 Bacteria 25355
158 Ga0496125_0000350 3300048928 Bacteria 87293
159 Ga0496125_0179937 3300048928 Bacteria 1410
160 Ga0496126_0043169 3300048929 Bacteria 4160
161 Ga0501032_0016384 3300049569 Bacteria 5214
162 Ga0501032_0114113 3300049569 Bacteria 1787
163 Ga0501033_0004644 3300049570 Bacteria 10994
164 Ga0501034_0020378 3300049571 Bacteria 6769
165 Ga0501034_0037337 3300049571 Bacteria 4918
166 Ga0501034_0076203 3300049571 Bacteria 3361
167 Ga0501034_0206178 3300049571 Bacteria 1922
168 Ga0501034_0263079 3300049571 Bacteria 1667
169 Ga0501034_0379074 3300049571 Bacteria 1339
170 Ga0501036_0003387 3300049572 Bacteria 12734
171 Ga0501037_0004703 3300049573 Bacteria 9921
172 Ga0501037_0218410 3300049573 Bacteria 1342
173 Ga0501038_0005129 3300049574 Bacteria 12167
174 Ga0501038_0111378 3300049574 Bacteria 2268
175 Ga0501039_0015177 3300049575 Bacteria 5894
176 Ga0501043_0001112 3300049579 Bacteria 23645
177 Ga0501043_0020111 3300049579 Bacteria 5239
178 Ga0501043_0134511 3300049579 Bacteria 1937
179 Ga0501046_0005960 3300049580 Bacteria 10844
180 Ga0501047_0014827 3300049581 Bacteria 7419
181 Ga0501047_0048221 3300049581 Bacteria 4113
182 Ga0501048_0007368 3300049582 Bacteria 8335
183 Ga0501068_0001377 3300049584 Bacteria 12927
184 Ga0501070_0000591 3300049586 Bacteria 33068
185 Ga0501070_0009647 3300049586 Bacteria 8160
186 Ga0501070_0013620 3300049586 Bacteria 6854
187 Ga0501070_0028118 3300049586 Bacteria 4715
188 Ga0501070_0037433 3300049586 Bacteria 4050
189 Ga0501070_0149604 3300049586 Bacteria 1926
190 Ga0501071_0001085 3300049587 Bacteria 15117
191 Ga0501073_0000028 3300049589 Bacteria 118187
192 Ga0501073_0009405 3300049589 Bacteria 7218
193 Ga0501080_0001558 3300049742 Bacteria 19389
194 Ga0501080_0140072 3300049742 Bacteria 2237
195 Ga0501044_0041029 3300049823 Bacteria 4818
196 Ga0501045_0004810 3300049824 Bacteria 9332
197 nmdc:mga00v17_75518_c1 3300050491 Bacteria 2096
198 nmdc:mga0yw44_17681_c1 3300050492 Bacteria 3886
199 nmdc:mga0yw44_6753_c1 3300050492 Bacteria 5573
200 nmdc:mga06z11_4064_c1 3300050494 Bacteria 5718
201 nmdc:mga04h51_12200_c1 3300050495 Bacteria 2406
202 nmdc:mga07m45_11811_c1 3300050496 Bacteria 4598
203 nmdc:mga0sz30_26819_c1 3300050516 Bacteria 2363
204 nmdc:mga0sz30_4835_c1 3300050516 Bacteria 3776
205 Ga0500635_0030588 3300053080 Bacteria 1737
206 Ga0500643_000072 3300053087 Bacteria 112810
207 Ga0500651_0000170 3300053093 Bacteria 42448
208 Ga0500556_0000001 3300053104 Bacteria 1135060
209 Ga0500556_0001108 3300053104 Bacteria 13401
210 Ga0500562_004656 3300053108 Bacteria 3461
211 Ga0500593_003993 3300053117 Bacteria 5661
212 Ga0500655_002234 3300053133 Bacteria 3558
213 Ga0500659_0000357 3300053135 Eukaryota 29138
214 Ga0500559_0000043 3300053136 Bacteria 100617
215 Ga0500559_0002927 3300053136 Bacteria 8586
216 Ga0500559_0006680 3300053136 Bacteria 5184
217 Ga0500559_0035326 3300053136 Bacteria 2158
218 Ga0500568_0000003 3300053139 Bacteria 863587
219 Ga0500568_0000028 3300053139 Bacteria 161589
220 Ga0500568_0006187 3300053139 Bacteria 6049
221 Ga0500568_0022144 3300053139 Bacteria 2724
222 Ga0500573_0000001 3300053140 Bacteria 436394
223 Ga0500573_0000471 3300053140 Bacteria 17342
224 Ga0500573_0015159 3300053140 Bacteria 4367
225 Ga0500573_0015531 3300053140 Bacteria 4317
226 Ga0500573_0061803 3300053140 Bacteria 2145
227 Ga0500577_0012976 3300053142 Bacteria 2533
228 Ga0500590_002157 3300053148 Bacteria 8559
229 Ga0500616_0000058 3300053153 Bacteria 266276
230 Ga0500616_0001433 3300053153 Bacteria 22893
231 Ga0500620_000035 3300053155 Bacteria 25684
232 Ga0500645_004187 3300053730 Bacteria 5613
233 2547694360 2547132181 Bacteria 4945084
234 2555259151 2554235234 Bacteria 5762085
235 2562466430 2561511199 Bacteria 5155034
236 2587861688 2585428094 Bacteria 3604039
237 2599413514 2599185169 Bacteria 5441380
238 2600443735 2600254954 Bacteria 5100516
239 2601526188 2600255254 Bacteria 5281859
240 2601531301 2600255255 Bacteria 5282785
241 2601531933 2600255256 Bacteria 5597742
242 2601537304 2600255257 Bacteria 5597196
243 2601618080 2600255280 Bacteria 5292309
244 2601623115 2600255281 Bacteria 5288753
245 2601646541 2600255287 Bacteria 5210468
246 2601651551 2600255288 Bacteria 5282738
247 2601656583 2600255289 Bacteria 5281907
248 2601661458 2600255290 Bacteria 5282218
249 2601666490 2600255291 Bacteria 5217298
250 2601699450 2600255298 Bacteria 5215185
251 2601704410 2600255299 Bacteria 5218662
252 2601709301 2600255300 Bacteria 5287774
253 2601714406 2600255301 Bacteria 5280532
254 2601719441 2600255302 Bacteria 5288235
255 2601724295 2600255303 Bacteria 5219315
256 2601729360 2600255304 Bacteria 5283973
257 2601734329 2600255305 Bacteria 5282329
258 2601739318 2600255306 Bacteria 5281613
259 2601744283 2600255307 Bacteria 5439064
260 2601754984 2600255309 Bacteria 5431045
261 2601755651 2600255310 Bacteria 5600903
262 2601761019 2600255311 Bacteria 5598766
263 2602008809 2600255389 Bacteria 5275336
264 2602022146 2600255392 Bacteria 5437392
265 2603638959 2602042046 Bacteria 5483348
266 2603661674 2602042052 Bacteria 5215873
267 2603666571 2602042053 Bacteria 5214361
268 2603836678 2602042103 Bacteria 5284714
269 2603841757 2602042104 Bacteria 5281639
270 2603846829 2602042105 Bacteria 5282303
271 2603851956 2602042106 Bacteria 5282744
272 2603869528 2602042110 Bacteria 5283285
273 2603877774 2602042111 Bacteria 5212080
274 2606046658 2603880178 Bacteria 5283018
275 2606071003 2603880184 Bacteria 5217896
276 2606144331 2603880202 Bacteria 5284684
277 2606174548 2603880211 Bacteria 5284226
278 2609913308 2609459761 Bacteria 5513740
279 2637226575 2636415599 Bacteria 5718434
280 2643769172 2643221549 Bacteria 4042819
281 2643847730 2643221566 Bacteria 3460379
282 2643876950 2643221572 Bacteria 3614809
283 2643890962 2643221576 Bacteria 5214352
284 2643960018 2643221590 Bacteria 5214697
285 2643994759 2643221597 Bacteria 3347721
286 2644198365 2643221635 Bacteria 2632343
287 2644278265 2643221649 Bacteria 3867359
288 2644384005 2643221669 Bacteria 3611286
289 2644506648 2643221690 Bacteria 4654705
290 2644526442 2643221694 Bacteria 4392972
291 2644671108 2643221722 Bacteria 4247614
292 2676407273 2675903046 Bacteria 5451247
293 2687580088 2687453129 Bacteria 4387428
294 2738692538 2738541272 Bacteria 6848551
295 2738868676 2738541305 Bacteria 4910150
296 2739289116 2738543020 Bacteria 5718238
297 2739294428 2738543021 Bacteria 5718241
298 2739323626 2738543027 Bacteria 6409078
299 2774379563 2773857758 Bacteria 3592392
300 2774400833 2773857763 Bacteria 4180068
301 2777022302 2775507074 Bacteria 5532402
302 2791925198 2791354903 Bacteria 4937680
303 2792312239 2791355010 Bacteria 4864581
304 2808900342 2808606372 Bacteria 4649509
305 2812324451 2811994872 Bacteria 4121241
306 2813730020 2811995292 Bacteria 5303342
307 2814697512 2814123068 Bacteria 5687681
308 2821268940 2821268502 Bacteria 3750023
309 2833709832 2833709550 Bacteria 4008291
310 2842809004 2842805378 Bacteria 5385175
311 2844856041 2844852863 Bacteria 3849151
312 2852646027 2852643534 Bacteria 3013378
313 2857485035 2857481737 Bacteria 4761446
314 2857739979 2857737099 Bacteria 3104305
315 2870624282 2870622029 Bacteria 3643329
316 2884089948 2884086401 Bacteria 5005459
317 2884994983 2884994152 Bacteria 4492978
318 2895662270 2895660088 Bacteria 3782833
319 2904512944 2904509784 Bacteria 3520416
320 2904514843 2904513164 Bacteria 5476410
321 2906801589 2906799679 Bacteria 4031749
322 2908679416 2908678064 Bacteria 3482747
323 2919070053 2919069694 Bacteria 3622919
324 2919109655 2919108558 Bacteria 5897419
325 2919444971 2919443155 Bacteria 4072969
326 2935413423 2935409751 Bacteria 4179611
327 2939658769 2939657138 Bacteria 3740283
328 2945879100 2945874760 Bacteria 5527237
329 2952253850 2952252522 Bacteria 4171745
330 2966922441 2966921586 Bacteria 3092803
331 2969083559 2969079654 Bacteria 5439582
332 2971824998 2971820967 Bacteria 5823634
333 2974295535 2974294766 Bacteria 3767688
334 2974295619 2974294766 Bacteria 3767688
335 2974324578 2974324384 Bacteria 3750535
336 2977238341 2977236895 Bacteria 3569373
337 2977264875 2977264416 Bacteria 3750737
338 2984543877 2984542743 Bacteria 3569378
339 2984560578 2984559226 Bacteria 5683096
340 2984598653 2984595703 Bacteria 5682994
341 3007254512 3007252601 Bacteria 4559114
342 8034963309 8034962539 Bacteria 4884839
343 8045832120 8045830549 Bacteria 4444727
344 8056039926 8056037122 Bacteria 3854319
345 8057348161 8057345674 Bacteria 4160394
346 Ga0068863_100099096
347 RicEn_C4537
348 Ga0006562J51391_1064682
349 Ga0058692_1001419
350 Ga0070658_10000516
351 Ga0070658_10018666
352 Ga0070658_10030682
353 Ga0070660_100024333
354 Ga0070661_100140343
355 Ga0070659_100046495
356 Ga0070667_100011816
357 Ga0070663_100016183
358 Ga0070685_10005234
359 Ga0068853_100006163
360 Ga0070672_100053862
361 Ga0068855_100029547
362 Ga0068855_100214496
363 Ga0068857_100145773
364 Ga0068856_100019177
365 Ga0068856_100157479
366 Ga0068852_100131970
367 Ga0068852_100152037
368 Ga0068851_10000001
369 Ga0068858_100000276
370 Ga0075365_10023263
371 Ga0075364_10024788
372 Ga0075432_10026654
373 Ga0075367_10020095
374 Ga0075369_10011362
375 Ga0075369_10031867
376 Ga0075370_10007264
377 Ga0079104_1000136
378 Ga0105251_10000082
379 Ga0105251_10028274
380 Ga0105251_10096167
381 Ga0105244_10000082
382 Ga0105244_10025587
383 Ga0105244_10031673
384 Ga0105250_10000035
385 Ga0105240_10310473
386 Ga0105245_10080774
387 Ga0105243_10006629
388 Ga0105248_10000326
389 Ga0105237_10000341
390 Ga0105239_10009254
391 Ga0105239_10054716
392 Ga0157371_10000794
393 Ga0157370_10002942
394 Ga0171462_1001
395 Ga0157379_10004212
396 Ga0182006_1006543
397 Ga0213876_10000368
398 Ga0209148_1000695
399 Ga0207656_10000002
400 Ga0207696_1000007
401 Ga0207655_1000105
402 Ga0207655_1005416
403 Ga0207655_1018899
404 Ga0207655_1043497
405 Ga0207713_1000005
406 Ga0207713_1000006
407 Ga0207647_10008756
408 Ga0207705_10000001
409 Ga0207705_10024665
410 Ga0207705_10126100
411 Ga0207654_10000001
412 Ga0207695_10009910
413 Ga0207695_10010927
414 Ga0207671_10000002
415 Ga0207671_10092789
416 Ga0207657_10008837
417 Ga0207657_10029317
418 Ga0207694_10000395
419 Ga0207690_10001349
420 Ga0207690_10075375
421 Ga0207709_10005896
422 Ga0207691_10071543
423 Ga0207711_10001610
424 Ga0207667_10000384
425 Ga0207667_10135977
426 Ga0207658_10069792
427 Ga0207677_10148120
428 Ga0207703_10000141
429 Ga0207639_10005396
430 Ga0207639_10192665
431 Ga0207678_10011578
432 Ga0207702_10031914
433 Ga0207674_10055418
434 Ga0207674_10157122
435 Ga0207683_10192447
436 Ga0207698_10000297
437 Ga0207698_10116910
438 Ga0207698_10127632
439 Ga0209281_1000041
440 Ga0209371_1000050
441 Ga0209371_1000112
442 Ga0209371_1000147
443 Ga0209371_1000234
444 Ga0307515_10147602
445 Ga0268256_1000017
446 Ga0268256_1000121
447 Ga0268256_1000877
448 Ga0307408_100000002
449 Ga0436365_0117120
450 Ga0439442_000014
451 Ga0466965_0000016
452 Ga0466965_0021986
453 Ga0466970_0001281
454 Ga0466960_0011790
455 Ga0466960_0015707
456 Ga0466967_0080525
457 Ga0495627_000009
458 Ga0495590_0000891
459 Ga0495650_0003905
460 Ga0495650_0003922
461 Ga0495605_0000312
462 Ga0495605_0013759
463 Ga0495583_0000514
464 Ga0495606_0000293
465 Ga0495632_0000163
466 Ga0495643_0000148
467 Ga0495643_0006279
468 Ga0495668_0082364
469 Ga0495625_0148994
470 Ga0495661_0000814
471 Ga0495671_0005312
472 Ga0495649_0001818
473 Ga0495649_0018853
474 Ga0495660_0000095
475 Ga0495660_0105894
476 Ga0495673_0000561
477 Ga0495686_0045978
478 Ga0496111_0001803
479 Ga0496113_0079963
480 Ga0496114_0101511
481 Ga0496114_0279008
482 Ga0496115_0094727
483 Ga0496117_0007927
484 Ga0496119_0001402
485 Ga0496119_0005717
486 Ga0496119_0024831
487 Ga0496120_0000882
488 Ga0496120_0005757
489 Ga0496120_0012440
490 Ga0496122_0000116
491 Ga0496122_0000866
492 Ga0496122_0000995
493 Ga0496122_0005733
494 Ga0496122_0007542
495 Ga0496122_0023089
496 Ga0496123_0000009
497 Ga0496123_0000413
498 Ga0496123_0000533
499 Ga0496123_0001121
500 Ga0496123_0001148
501 Ga0496124_0001764
502 Ga0496124_0002284
503 Ga0496125_0000350
504 Ga0496125_0179937
505 Ga0496126_0043169
506 Ga0501032_0016384
507 Ga0501032_0114113
508 Ga0501033_0004644
509 Ga0501034_0020378
510 Ga0501034_0037337
511 Ga0501034_0076203
512 Ga0501034_0206178
513 Ga0501034_0263079
514 Ga0501034_0379074
515 Ga0501036_0003387
516 Ga0501037_0004703
517 Ga0501037_0218410
518 Ga0501038_0005129
519 Ga0501038_0111378
520 Ga0501039_0015177
521 Ga0501043_0001112
522 Ga0501043_0020111
523 Ga0501043_0134511
524 Ga0501046_0005960
525 Ga0501047_0014827
526 Ga0501047_0048221
527 Ga0501048_0007368
528 Ga0501068_0001377
529 Ga0501070_0000591
530 Ga0501070_0009647
531 Ga0501070_0013620
532 Ga0501070_0028118
533 Ga0501070_0037433
534 Ga0501070_0149604
535 Ga0501071_0001085
536 Ga0501073_0000028
537 Ga0501073_0009405
538 Ga0501080_0001558
539 Ga0501080_0140072
540 Ga0501044_0041029
541 Ga0501045_0004810
542 nmdc:mga00v17_75518_c1
543 nmdc:mga0yw44_17681_c1
544 nmdc:mga0yw44_6753_c1
545 nmdc:mga06z11_4064_c1
546 nmdc:mga04h51_12200_c1
547 nmdc:mga07m45_11811_c1
548 nmdc:mga0sz30_26819_c1
549 nmdc:mga0sz30_4835_c1
550 Ga0500635_0030588
551 Ga0500643_000072
552 Ga0500651_0000170
553 Ga0500556_0000001
554 Ga0500556_0001108
555 Ga0500562_004656
556 Ga0500593_003993
557 Ga0500655_002234
558 Ga0500659_0000357
559 Ga0500559_0000043
560 Ga0500559_0002927
561 Ga0500559_0006680
562 Ga0500559_0035326
563 Ga0500568_0000003
564 Ga0500568_0000028
565 Ga0500568_0006187
566 Ga0500568_0022144
567 Ga0500573_0000001
568 Ga0500573_0000471
569 Ga0500573_0015159
570 Ga0500573_0015531
571 Ga0500573_0061803
572 Ga0500577_0012976
573 Ga0500590_002157
574 Ga0500616_0000058
575 Ga0500616_0001433
576 Ga0500620_000035
577 Ga0500645_004187
578 2547694360
579 2555259151
580 2562466430
581 2587861688
582 2599413514
583 2600443735
584 2601526188
585 2601531301
586 2601531933
587 2601537304
588 2601618080
589 2601623115
590 2601646541
591 2601651551
592 2601656583
593 2601661458
594 2601666490
595 2601699450
596 2601704410
597 2601709301
598 2601714406
599 2601719441
600 2601724295
601 2601729360
602 2601734329
603 2601739318
604 2601744283
605 2601754984
606 2601755651
607 2601761019
608 2602008809
609 2602022146
610 2603638959
611 2603661674
612 2603666571
613 2603836678
614 2603841757
615 2603846829
616 2603851956
617 2603869528
618 2603877774
619 2606046658
620 2606071003
621 2606144331
622 2606174548
623 2609913308
624 2637226575
625 2643769172
626 2643847730
627 2643876950
628 2643890962
629 2643960018
630 2643994759
631 2644198365
632 2644278265
633 2644384005
634 2644506648
635 2644526442
636 2644671108
637 2676407273
638 2687580088
639 2738692538
640 2738868676
641 2739289116
642 2739294428
643 2739323626
644 2774379563
645 2774400833
646 2777022302
647 2791925198
648 2792312239
649 2808900342
650 2812324451
651 2813730020
652 2814697512
653 2821268940
654 2833709832
655 2842809004
656 2844856041
657 2852646027
658 2857485035
659 2857739979
660 2870624282
661 2884089948
662 2884994983
663 2895662270
664 2904512944
665 2904514843
666 2906801589
667 2908679416
668 2919070053
669 2919109655
670 2919444971
671 2935413423
672 2939658769
673 2945879100
674 2952253850
675 2966922441
676 2969083559
677 2971824998
678 2974295535
679 2974295619
680 2974324578
681 2977238341
682 2977264875
683 2984543877
684 2984560578
685 2984598653
686 3007254512
687 8034963309
688 8045832120
689 8056039926
690 8057348161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00202

Aminotran_3

Aminotransferase class-III

51

465

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lh9-assembly1.cif.gz_A amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form 0.943 25 439
6s54-assembly1.cif.gz_C transaminase from pseudomonas fluorescens 0.9425 17 440
6g4e-assembly1.cif.gz_A crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) 0.9369 18 439
5ghf-assembly1.cif.gz_B transaminase with l-ala 0.9366 37 440
5kqu-assembly1.cif.gz_A directed evolution of transaminases by ancestral reconstruction. using old proteins for new chemistries 0.9357 14 442
ID Description Score Start End Superfamily
af_Q64565_403_502_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9657 340 435 3.90.1150.10
af_Q2FVJ6_359_446_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9644 352 438 3.90.1150.10
af_Q2FVJ6_341_444_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9609 333 436 3.90.1150.10
af_Q65WV6_290_384_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9442 341 432 3.90.1150.10
af_I1JL13_371_474_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9429 339 438 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A6B3I9R0-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9853 210 325 GO:0005829
GO:0008483
GO:0030170
AF-A0A6J6KBC4-F1-model_v4 Unannotated protein 0.9824 251 445 GO:0005829
GO:0008483
GO:0030170
AF-A0A6B3I9R0-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9688 210 325 GO:0005829
GO:0008483
GO:0030170
AF-A0A0N0I896-F1-model_v4 deleted 0.9661 210 315
AF-A0A528J0U6-F1-model_v4 Aminotransferase class III-fold pyridoxal phosphate-dependent enzyme 0.9653 349 439 GO:0008483
GO:0030170

Map