F417006

General Info

Members Datasets Scaffolds Average Seq Length
347 177 694 369

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10152181|Ga0065707_101521812
Length 409
Sequence LASGRDDSWVENNIKSTKRPAGTLGAKSNDMDYPSIVPTEQKKNMPEAWYEIENINELDSPALVVFPERVKHNIQLAIDMIGDVDRLRPHIKTNKSPDVAKLMLKAGITKFKCATIAEAEMLAQSNAPDVLLAYQPLGPKLNRFVSLIKKYPSTKFSCLTDNIDAANEQAAIFNSNDLIVPVFIDLNVGMNRTGIAPGGKAIELGRHCSTLKGITLAGLHAYDGHIRDVDFEMKKQKCDEAFASVEKLNEKLKLPTIVMGGSPAFSVHCKRKNIECSPGTFVYWDKGYTDLCPEQKFLPAIVLVTRVISLPAENKICTDLGHKSVAAENEITRRVFFLNAEGLKPTGQSEEHLVLETPGGHPYKVGDIFYGLPYHVCPTVALYERVFTIEKGKVTGEWRNVSRDRKINV

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
174 2738541284 Pedobacter sp. YR016 Isolate Unclassified
175 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
176 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
177 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 0.86
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10152181 3300005295 Bacteria 1646
2 JGI24751J29686_10003315 3300002459 Bacteria 3245
3 rootH2_10047367 3300003320 Bacteria 14620
4 rootH2_10180496 3300003320 Unclassified 3856
5 rootH2_10269447 3300003320 Unclassified 1493
6 rootL2_10202735 3300003322 Bacteria 1665
7 rootH1_10002605 3300003323 Bacteria 51064
8 rootH1_10092614 3300003323 Bacteria 1708
9 rootH1_10135801 3300003323 Bacteria 1663
10 rootH1_10161483 3300003323 Bacteria 2764
11 rootH1_10213052 3300003323 Bacteria 3599
12 Ga0055531_10000015 3300003794 Bacteria 182104
13 Ga0065712_10110553 3300005290 Bacteria 1832
14 Ga0065712_10152907 3300005290 Bacteria 1356
15 Ga0070658_10003878 3300005327 Bacteria 12262
16 Ga0070676_10001416 3300005328 Bacteria 12103
17 Ga0070676_10012084 3300005328 Bacteria 4708
18 Ga0070676_10031879 3300005328 Unclassified 3016
19 Ga0070683_100016801 3300005329 Bacteria 6456
20 Ga0070683_100025716 3300005329 Bacteria 5291
21 Ga0070690_100012007 3300005330 Bacteria 5083
22 Ga0070670_100021514 3300005331 Bacteria 5548
23 Ga0070670_100111446 3300005331 Unclassified 2358
24 Ga0070670_100182210 3300005331 Bacteria 1824
25 Ga0070670_100192077 3300005331 Bacteria 1774
26 Ga0070670_100209502 3300005331 Bacteria 1695
27 Ga0070677_10003226 3300005333 Bacteria 5249
28 Ga0068869_100010618 3300005334 Bacteria 6011
29 Ga0068869_100013547 3300005334 Bacteria 5427
30 Ga0068869_100028928 3300005334 Bacteria 3876
31 Ga0070666_10000432 3300005335 Bacteria 25632
32 Ga0070666_10007578 3300005335 Bacteria 6697
33 Ga0070666_10023695 3300005335 Bacteria 3997
34 Ga0070666_10027612 3300005335 Bacteria 3718
35 Ga0070682_100006801 3300005337 Bacteria 6419
36 Ga0068868_100057067 3300005338 Bacteria 3084
37 Ga0068868_100091182 3300005338 Bacteria 2455
38 Ga0068868_100128701 3300005338 Bacteria 2070
39 Ga0068868_100257576 3300005338 Bacteria 1470
40 Ga0070689_100009628 3300005340 Bacteria 6858
41 Ga0070691_10010073 3300005341 Bacteria 4307
42 Ga0070661_100001488 3300005344 Bacteria 16275
43 Ga0070668_100033130 3300005347 Bacteria 3933
44 Ga0070668_100141576 3300005347 Bacteria 1938
45 Ga0070669_100025538 3300005353 Bacteria 4244
46 Ga0070675_100009851 3300005354 Bacteria 7447
47 Ga0070671_100004338 3300005355 Bacteria 11224
48 Ga0070671_100056876 3300005355 Bacteria 3254
49 Ga0070671_100093925 3300005355 Bacteria 2513
50 Ga0070673_100008337 3300005364 Bacteria 6885
51 Ga0070673_100067226 3300005364 Unclassified 2865
52 Ga0070673_100085598 3300005364 Unclassified 2567
53 Ga0070673_100258285 3300005364 Bacteria 1521
54 Ga0070688_100041216 3300005365 Bacteria 2833
55 Ga0070659_100020065 3300005366 Bacteria 5075
56 Ga0070667_100012516 3300005367 Bacteria 7017
57 Ga0070667_100272804 3300005367 Bacteria 1517
58 Ga0070667_100284164 3300005367 Bacteria 1486
59 Ga0070678_100039020 3300005456 Bacteria 3347
60 Ga0070678_100075415 3300005456 Bacteria 2537
61 Ga0070662_100018711 3300005457 Bacteria 4691
62 Ga0070662_100239378 3300005457 Unclassified 1455
63 Ga0068867_100008699 3300005459 Bacteria 7167
64 Ga0068867_100105874 3300005459 Bacteria 2154
65 Ga0068867_100160965 3300005459 Bacteria 1770
66 Ga0068867_100271051 3300005459 Bacteria 1388
67 Ga0070685_10011934 3300005466 Bacteria 4555
68 Ga0070685_10180809 3300005466 Bacteria 1357
69 Ga0070698_100002592 3300005471 Bacteria 19910
70 Ga0070698_100140005 3300005471 Bacteria 2371
71 Ga0070684_100105807 3300005535 Bacteria 2518
72 Ga0070684_100238439 3300005535 Bacteria 1661
73 Ga0068853_100001327 3300005539 Bacteria 17802
74 Ga0068853_100209995 3300005539 Unclassified 1774
75 Ga0070672_100215699 3300005543 Bacteria 1608
76 Ga0070665_100180952 3300005548 Bacteria 2109
77 Ga0070665_100446872 3300005548 Bacteria 1302
78 Ga0070664_100000360 3300005564 Bacteria 33570
79 Ga0070664_100087796 3300005564 Bacteria 2689
80 Ga0070664_100129397 3300005564 Bacteria 2217
81 Ga0070664_100148723 3300005564 Bacteria 2067
82 Ga0070664_100269983 3300005564 Bacteria 1532
83 Ga0068857_100000323 3300005577 Bacteria 32881
84 Ga0068857_100046398 3300005577 Bacteria 3856
85 Ga0068857_100103239 3300005577 Bacteria 2560
86 Ga0068854_100068865 3300005578 Bacteria 2582
87 Ga0068856_100000941 3300005614 Bacteria 31199
88 Ga0068852_100163706 3300005616 Bacteria 2079
89 Ga0068859_100000242 3300005617 Bacteria 53646
90 Ga0068859_100067032 3300005617 Unclassified 3624
91 Ga0068859_100108806 3300005617 Bacteria 2833
92 Ga0068859_100150335 3300005617 Bacteria 2404
93 Ga0068864_100035435 3300005618 Bacteria 4248
94 Ga0068864_100109758 3300005618 Bacteria 2456
95 Ga0068864_100389910 3300005618 Bacteria 1322
96 Ga0068861_100008433 3300005719 Bacteria 7096
97 Ga0068861_100152974 3300005719 Bacteria 1895
98 Ga0068851_10071161 3300005834 Bacteria 1799
99 Ga0068870_10026020 3300005840 Bacteria 2912
100 Ga0068863_100038897 3300005841 Bacteria 4526
101 Ga0068863_100090579 3300005841 Bacteria 2900
102 Ga0068863_100184102 3300005841 Bacteria 2006
103 Ga0068858_100007612 3300005842 Bacteria 10461
104 Ga0068858_100056495 3300005842 Bacteria 3628
105 Ga0068860_100014886 3300005843 Bacteria 7605
106 Ga0068860_100104246 3300005843 Bacteria 2708
107 Ga0075366_10012210 3300006195 Bacteria 4869
108 Ga0097621_100000277 3300006237 Bacteria 34682
109 Ga0097621_100028780 3300006237 Bacteria 4382
110 Ga0097621_100035010 3300006237 Bacteria 4009
111 Ga0097621_100380654 3300006237 Bacteria 1260
112 Ga0068871_100000455 3300006358 Bacteria 28102
113 Ga0068871_100125600 3300006358 Bacteria 2171
114 Ga0075430_100006665 3300006846 Bacteria 9743
115 Ga0075430_100098108 3300006846 Bacteria 2448
116 Ga0075431_100055131 3300006847 Bacteria 4100
117 Ga0075431_100180404 3300006847 Bacteria 2167
118 Ga0075434_100043533 3300006871 Bacteria 4453
119 Ga0075429_100000793 3300006880 Bacteria 24884
120 Ga0068865_100088120 3300006881 Bacteria 2245
121 Ga0097620_100000242 3300006931 Bacteria 53646
122 Ga0097620_100067030 3300006931 Unclassified 3624
123 Ga0097620_100108801 3300006931 Bacteria 2833
124 Ga0097620_100150333 3300006931 Bacteria 2404
125 Ga0105240_10082247 3300009093 Bacteria 3955
126 Ga0111539_10007577 3300009094 Bacteria 13873
127 Ga0111539_10107608 3300009094 Bacteria 3272
128 Ga0111539_10238452 3300009094 Unclassified 2117
129 Ga0105245_10179011 3300009098 Bacteria 2024
130 Ga0105247_10003524 3300009101 Bacteria 10175
131 Ga0114129_10289866 3300009147 Bacteria 2185
132 Ga0105243_10088806 3300009148 Unclassified 2540
133 Ga0105243_10284180 3300009148 Unclassified 1492
134 Ga0105241_10000293 3300009174 Bacteria 37284
135 Ga0105241_10009923 3300009174 Bacteria 6998
136 Ga0105242_10003020 3300009176 Bacteria 13154
137 Ga0105242_10027586 3300009176 Bacteria 4512
138 Ga0105242_10046173 3300009176 Bacteria 3533
139 Ga0105242_10052704 3300009176 Bacteria 3321
140 Ga0105242_10070913 3300009176 Bacteria 2890
141 Ga0105248_10007416 3300009177 Bacteria 12034
142 Ga0105248_10022538 3300009177 Bacteria 6986
143 Ga0105237_10002329 3300009545 Bacteria 23581
144 Ga0105238_10406558 3300009551 Bacteria 1355
145 Ga0105249_10001136 3300009553 Bacteria 23551
146 Ga0105249_10005742 3300009553 Bacteria 10731
147 Ga0105249_10012377 3300009553 Bacteria 7518
148 Ga0105249_10020765 3300009553 Bacteria 5873
149 Ga0105249_10065902 3300009553 Bacteria 3333
150 Ga0105249_10127134 3300009553 Bacteria 2428
151 Ga0105249_10319490 3300009553 Bacteria 1563
152 Ga0105239_10000079 3300010375 Bacteria 135513
153 Ga0105239_10061421 3300010375 Bacteria 4124
154 Ga0105239_10102634 3300010375 Bacteria 3165
155 Ga0105239_10123480 3300010375 Unclassified 2877
156 Ga0105246_10019233 3300011119 Bacteria 4361
157 Ga0105246_10071122 3300011119 Bacteria 2449
158 Ga0105246_10093342 3300011119 Unclassified 2174
159 Ga0105246_10210520 3300011119 Bacteria 1517
160 Ga0105246_10362096 3300011119 Unclassified 1192
161 Ga0157371_10037905 3300013102 Bacteria 3449
162 Ga0157370_10320111 3300013104 Bacteria 1430
163 Ga0157374_10024086 3300013296 Bacteria 5452
164 Ga0157378_10006001 3300013297 Bacteria 10643
165 Ga0157378_10007614 3300013297 Bacteria 9453
166 Ga0157378_10009360 3300013297 Bacteria 8535
167 Ga0157378_10028034 3300013297 Bacteria 4967
168 Ga0157378_10131194 3300013297 Bacteria 2319
169 Ga0157378_10187399 3300013297 Unclassified 1949
170 Ga0163162_10001851 3300013306 Bacteria 19914
171 Ga0163162_10001857 3300013306 Bacteria 19899
172 Ga0163162_10004892 3300013306 Bacteria 12916
173 Ga0163162_10005520 3300013306 Bacteria 12225
174 Ga0163162_10012253 3300013306 Bacteria 8367
175 Ga0163162_10232162 3300013306 Bacteria 1975
176 Ga0157372_10361599 3300013307 Bacteria 1691
177 Ga0157375_10000166 3300013308 Bacteria 61836
178 Ga0157375_10005531 3300013308 Bacteria 10994
179 Ga0157375_10008136 3300013308 Bacteria 9176
180 Ga0157375_10031558 3300013308 Bacteria 5011
181 Ga0157375_10061564 3300013308 Bacteria 3727
182 Ga0157375_10104838 3300013308 Bacteria 2917
183 Ga0157375_10144571 3300013308 Bacteria 2508
184 Ga0157375_10237715 3300013308 Bacteria 1981
185 Ga0163163_10000266 3300014325 Bacteria 52427
186 Ga0157380_10018718 3300014326 Bacteria 5147
187 Ga0157380_10020489 3300014326 Bacteria 4942
188 Ga0157380_10104915 3300014326 Bacteria 2362
189 Ga0157380_10166890 3300014326 Bacteria 1919
190 Ga0182008_10000004 3300014497 Bacteria 436804
191 Ga0157377_10010180 3300014745 Bacteria 4642
192 Ga0157379_10032213 3300014968 Bacteria 4672
193 Ga0157379_10053287 3300014968 Unclassified 3614
194 Ga0157379_10244461 3300014968 Bacteria 1628
195 Ga0157379_10309802 3300014968 Bacteria 1440
196 Ga0157376_10007428 3300014969 Bacteria 7824
197 Ga0157376_10028322 3300014969 Bacteria 4452
198 Ga0157376_10036846 3300014969 Bacteria 3965
199 Ga0157376_10258458 3300014969 Bacteria 1630
200 Ga0163161_10008140 3300017792 Bacteria 7249
201 Ga0163161_10026240 3300017792 Bacteria 4127
202 Ga0163161_10034121 3300017792 Bacteria 3638
203 Ga0209050_1003005 3300025298 Bacteria 13094
204 Ga0209257_1000005 3300025304 Bacteria 1592528
205 Ga0207642_10010221 3300025899 Unclassified 3297
206 Ga0207688_10031748 3300025901 Bacteria 2917
207 Ga0207680_10000268 3300025903 Bacteria 24842
208 Ga0207680_10066841 3300025903 Bacteria 2212
209 Ga0207645_10000088 3300025907 Bacteria 65894
210 Ga0207645_10005936 3300025907 Bacteria 8797
211 Ga0207645_10025938 3300025907 Bacteria 3790
212 Ga0207645_10042494 3300025907 Archaea 2908
213 Ga0207643_10002199 3300025908 Bacteria 10637
214 Ga0207654_10030391 3300025911 Bacteria 2965
215 Ga0207671_10005165 3300025914 Bacteria 12144
216 Ga0207671_10078088 3300025914 Bacteria 2479
217 Ga0207649_10004427 3300025920 Bacteria 7626
218 Ga0207694_10160606 3300025924 Bacteria 1815
219 Ga0207650_10043996 3300025925 Bacteria 3280
220 Ga0207650_10188624 3300025925 Bacteria 1646
221 Ga0207659_10006017 3300025926 Bacteria 7401
222 Ga0207659_10345478 3300025926 Bacteria 1233
223 Ga0207644_10015759 3300025931 Bacteria 5080
224 Ga0207644_10042550 3300025931 Bacteria 3220
225 Ga0207690_10007938 3300025932 Bacteria 6301
226 Ga0207706_10006646 3300025933 Bacteria 10694
227 Ga0207706_10084421 3300025933 Bacteria 2792
228 Ga0207686_10004607 3300025934 Bacteria 7391
229 Ga0207670_10014259 3300025936 Bacteria 4712
230 Ga0207670_10016979 3300025936 Bacteria 4389
231 Ga0207669_10185659 3300025937 Bacteria 1495
232 Ga0207704_10030140 3300025938 Bacteria 3038
233 Ga0207691_10022756 3300025940 Bacteria 5908
234 Ga0207691_10025785 3300025940 Bacteria 5517
235 Ga0207691_10129562 3300025940 Unclassified 2229
236 Ga0207711_10313282 3300025941 Bacteria 1449
237 Ga0207689_10002594 3300025942 Bacteria 16721
238 Ga0207689_10007598 3300025942 Bacteria 9496
239 Ga0207689_10014794 3300025942 Bacteria 6623
240 Ga0207689_10047765 3300025942 Bacteria 3531
241 Ga0207689_10050329 3300025942 Bacteria 3436
242 Ga0207661_10100535 3300025944 Unclassified 2427
243 Ga0207679_10000575 3300025945 Bacteria 24610
244 Ga0207651_10046293 3300025960 Bacteria 2924
245 Ga0207651_10090247 3300025960 Bacteria 2240
246 Ga0207712_10007034 3300025961 Bacteria 7098
247 Ga0207712_10007090 3300025961 Bacteria 7068
248 Ga0207712_10008141 3300025961 Bacteria 6631
249 Ga0207712_10023530 3300025961 Bacteria 4067
250 Ga0207668_10092898 3300025972 Bacteria 2222
251 Ga0207640_10048507 3300025981 Bacteria 2746
252 Ga0207658_10007214 3300025986 Bacteria 7577
253 Ga0207658_10008446 3300025986 Bacteria 7009
254 Ga0207658_10051669 3300025986 Bacteria 3030
255 Ga0207677_10082855 3300026023 Bacteria 2306
256 Ga0207677_10215513 3300026023 Bacteria 1536
257 Ga0207677_10252399 3300026023 Bacteria 1433
258 Ga0207703_10058341 3300026035 Bacteria 3150
259 Ga0207703_10071566 3300026035 Bacteria 2864
260 Ga0207703_10078424 3300026035 Unclassified 2744
261 Ga0207639_10005654 3300026041 Bacteria 8459
262 Ga0207639_10160484 3300026041 Unclassified 1894
263 Ga0207639_10280052 3300026041 Bacteria 1466
264 Ga0207702_10000348 3300026078 Bacteria 53003
265 Ga0207641_10000053 3300026088 Bacteria 173468
266 Ga0207641_10000783 3300026088 Bacteria 33947
267 Ga0207641_10053863 3300026088 Bacteria 3412
268 Ga0207641_10084579 3300026088 Bacteria 2762
269 Ga0207648_10001628 3300026089 Bacteria 24592
270 Ga0207648_10040263 3300026089 Unclassified 4107
271 Ga0207648_10101611 3300026089 Bacteria 2520
272 Ga0207648_10162195 3300026089 Unclassified 1974
273 Ga0207676_10029340 3300026095 Bacteria 4117
274 Ga0207676_10040922 3300026095 Bacteria 3554
275 Ga0207676_10194404 3300026095 Bacteria 1788
276 Ga0207676_10248067 3300026095 Bacteria 1601
277 Ga0207674_10001817 3300026116 Bacteria 27232
278 Ga0207674_10271882 3300026116 Unclassified 1642
279 Ga0207675_100016662 3300026118 Bacteria 6863
280 Ga0207675_100216705 3300026118 Bacteria 1843
281 Ga0207675_100256020 3300026118 Bacteria 1695
282 Ga0207683_10000198 3300026121 Bacteria 51725
283 Ga0207683_10128585 3300026121 Bacteria 2278
284 Ga0207683_10220101 3300026121 Bacteria 1730
285 Ga0207698_10270792 3300026142 Bacteria 1565
286 Ga0268264_10004390 3300028381 Bacteria 12032
287 Ga0268264_10055610 3300028381 Bacteria 3308
288 Ga0307515_10000001 3300028794 Bacteria 4259510
289 Ga0307515_10000190 3300028794 Bacteria 150300
290 Ga0307511_10000367 3300030521 Bacteria 48024
291 Ga0307513_10110816 3300031456 Bacteria 2739
292 Ga0265313_10032942 3300031595 Bacteria 2639
293 Ga0307516_10001688 3300031730 Bacteria 30411
294 Ga0307516_10113323 3300031730 Bacteria 2510
295 Ga0307414_10025031 3300032004 Bacteria 3815
296 Ga0307414_10190143 3300032004 Unclassified 1660
297 Ga0373937_0058896 3300036401 Unclassified 3529
298 Ga0373937_0478601 3300036401 Unclassified 1183
299 Ga0395899_0001442 3300037312 Bacteria 20302
300 Ga0395900_0036608 3300037418 Bacteria 5059
301 Ga0395898_0008170 3300037466 Bacteria 11078
302 Ga0395905_0008935 3300037471 Bacteria 9838
303 Ga0395901_0001035 3300038443 Bacteria 30039
304 Ga0451798_0399127 3300041458 Bacteria 1368
305 Ga0439441_001565 3300042001 Unclassified 3037
306 Ga0451577_0008110 3300042876 Bacteria 10251
307 Ga0451577_0074268 3300042876 Bacteria 3033
308 Ga0466972_0000950 3300044658 Bacteria 13952
309 Ga0453683_0095672 3300044673 Bacteria 1863
310 Ga0453683_0184812 3300044673 Bacteria 1322
311 Ga0453684_0000440 3300044712 Bacteria 169397
312 Ga0453684_0139171 3300044712 Bacteria 2901
313 Ga0453684_0580963 3300044712 Bacteria 1231
314 Ga0466957_0002431 3300044842 Bacteria 10001
315 Ga0451576_0104041 3300045051 Bacteria 2953
316 Ga0495638_0000026 3300046460 Bacteria 347061
317 Ga0495650_0028127 3300046471 Bacteria 2587
318 Ga0495642_0068982 3300046528 Bacteria 1476
319 Ga0495667_0074341 3300046559 Unclassified 2213
320 Ga0495635_0151878 3300046663 Bacteria 1577
321 Ga0495661_0052305 3300046665 Bacteria 2462
322 Ga0495599_0140067 3300046678 Bacteria 1501
323 Ga0495600_0046254 3300046809 Unclassified 2840
324 Ga0495672_0018034 3300047320 Bacteria 4701
325 Ga0495672_0018613 3300047320 Unclassified 4604
326 Ga0495672_0020291 3300047320 Bacteria 4361
327 Ga0495672_0038279 3300047320 Bacteria 2927
328 Ga0495687_000942 3300047443 Bacteria 30043
329 Ga0495686_0014900 3300047472 Bacteria 5334
330 Ga0495686_0063600 3300047472 Unclassified 2286
331 Ga0496104_0335506 3300048907 Bacteria 1425
332 Ga0496114_0256727 3300048917 Bacteria 1538
333 Ga0501043_0007723 3300049579 Bacteria 8513
334 Ga0501266_002382 3300049763 Bacteria 2374
335 nmdc:mga05p37_322883_c1 3300050507 Bacteria 1826
336 nmdc:mga0qj67_61723_c1 3300050509 Bacteria 2976
337 nmdc:mga06r32_353045_c1 3300050510 Unclassified 1455
338 nmdc:mga08y16_4579_c1 3300050511 Bacteria 14414
339 nmdc:mga0n895_54968_c1 3300050512 Unclassified 3917
340 Ga0500583_0053601 3300053092 Unclassified 1881
341 Ga0500568_0046633 3300053139 Bacteria 1719
342 Ga0500616_0000068 3300053153 Bacteria 235628
343 Ga0500611_000138 3300053727 Bacteria 13267
344 2738762671 2738541284 Bacteria 5199923
345 2890740944 2890737413 Bacteria 4269751
346 2898713799 2898713307 Bacteria 4110805
347 2929155467 2929154850 Bacteria 6753285
348 Ga0065707_10152181
349 JGI24751J29686_10003315
350 rootH2_10047367
351 rootH2_10180496
352 rootH2_10269447
353 rootL2_10202735
354 rootH1_10002605
355 rootH1_10092614
356 rootH1_10135801
357 rootH1_10161483
358 rootH1_10213052
359 Ga0055531_10000015
360 Ga0065712_10110553
361 Ga0065712_10152907
362 Ga0070658_10003878
363 Ga0070676_10001416
364 Ga0070676_10012084
365 Ga0070676_10031879
366 Ga0070683_100016801
367 Ga0070683_100025716
368 Ga0070690_100012007
369 Ga0070670_100021514
370 Ga0070670_100111446
371 Ga0070670_100182210
372 Ga0070670_100192077
373 Ga0070670_100209502
374 Ga0070677_10003226
375 Ga0068869_100010618
376 Ga0068869_100013547
377 Ga0068869_100028928
378 Ga0070666_10000432
379 Ga0070666_10007578
380 Ga0070666_10023695
381 Ga0070666_10027612
382 Ga0070682_100006801
383 Ga0068868_100057067
384 Ga0068868_100091182
385 Ga0068868_100128701
386 Ga0068868_100257576
387 Ga0070689_100009628
388 Ga0070691_10010073
389 Ga0070661_100001488
390 Ga0070668_100033130
391 Ga0070668_100141576
392 Ga0070669_100025538
393 Ga0070675_100009851
394 Ga0070671_100004338
395 Ga0070671_100056876
396 Ga0070671_100093925
397 Ga0070673_100008337
398 Ga0070673_100067226
399 Ga0070673_100085598
400 Ga0070673_100258285
401 Ga0070688_100041216
402 Ga0070659_100020065
403 Ga0070667_100012516
404 Ga0070667_100272804
405 Ga0070667_100284164
406 Ga0070678_100039020
407 Ga0070678_100075415
408 Ga0070662_100018711
409 Ga0070662_100239378
410 Ga0068867_100008699
411 Ga0068867_100105874
412 Ga0068867_100160965
413 Ga0068867_100271051
414 Ga0070685_10011934
415 Ga0070685_10180809
416 Ga0070698_100002592
417 Ga0070698_100140005
418 Ga0070684_100105807
419 Ga0070684_100238439
420 Ga0068853_100001327
421 Ga0068853_100209995
422 Ga0070672_100215699
423 Ga0070665_100180952
424 Ga0070665_100446872
425 Ga0070664_100000360
426 Ga0070664_100087796
427 Ga0070664_100129397
428 Ga0070664_100148723
429 Ga0070664_100269983
430 Ga0068857_100000323
431 Ga0068857_100046398
432 Ga0068857_100103239
433 Ga0068854_100068865
434 Ga0068856_100000941
435 Ga0068852_100163706
436 Ga0068859_100000242
437 Ga0068859_100067032
438 Ga0068859_100108806
439 Ga0068859_100150335
440 Ga0068864_100035435
441 Ga0068864_100109758
442 Ga0068864_100389910
443 Ga0068861_100008433
444 Ga0068861_100152974
445 Ga0068851_10071161
446 Ga0068870_10026020
447 Ga0068863_100038897
448 Ga0068863_100090579
449 Ga0068863_100184102
450 Ga0068858_100007612
451 Ga0068858_100056495
452 Ga0068860_100014886
453 Ga0068860_100104246
454 Ga0075366_10012210
455 Ga0097621_100000277
456 Ga0097621_100028780
457 Ga0097621_100035010
458 Ga0097621_100380654
459 Ga0068871_100000455
460 Ga0068871_100125600
461 Ga0075430_100006665
462 Ga0075430_100098108
463 Ga0075431_100055131
464 Ga0075431_100180404
465 Ga0075434_100043533
466 Ga0075429_100000793
467 Ga0068865_100088120
468 Ga0097620_100000242
469 Ga0097620_100067030
470 Ga0097620_100108801
471 Ga0097620_100150333
472 Ga0105240_10082247
473 Ga0111539_10007577
474 Ga0111539_10107608
475 Ga0111539_10238452
476 Ga0105245_10179011
477 Ga0105247_10003524
478 Ga0114129_10289866
479 Ga0105243_10088806
480 Ga0105243_10284180
481 Ga0105241_10000293
482 Ga0105241_10009923
483 Ga0105242_10003020
484 Ga0105242_10027586
485 Ga0105242_10046173
486 Ga0105242_10052704
487 Ga0105242_10070913
488 Ga0105248_10007416
489 Ga0105248_10022538
490 Ga0105237_10002329
491 Ga0105238_10406558
492 Ga0105249_10001136
493 Ga0105249_10005742
494 Ga0105249_10012377
495 Ga0105249_10020765
496 Ga0105249_10065902
497 Ga0105249_10127134
498 Ga0105249_10319490
499 Ga0105239_10000079
500 Ga0105239_10061421
501 Ga0105239_10102634
502 Ga0105239_10123480
503 Ga0105246_10019233
504 Ga0105246_10071122
505 Ga0105246_10093342
506 Ga0105246_10210520
507 Ga0105246_10362096
508 Ga0157371_10037905
509 Ga0157370_10320111
510 Ga0157374_10024086
511 Ga0157378_10006001
512 Ga0157378_10007614
513 Ga0157378_10009360
514 Ga0157378_10028034
515 Ga0157378_10131194
516 Ga0157378_10187399
517 Ga0163162_10001851
518 Ga0163162_10001857
519 Ga0163162_10004892
520 Ga0163162_10005520
521 Ga0163162_10012253
522 Ga0163162_10232162
523 Ga0157372_10361599
524 Ga0157375_10000166
525 Ga0157375_10005531
526 Ga0157375_10008136
527 Ga0157375_10031558
528 Ga0157375_10061564
529 Ga0157375_10104838
530 Ga0157375_10144571
531 Ga0157375_10237715
532 Ga0163163_10000266
533 Ga0157380_10018718
534 Ga0157380_10020489
535 Ga0157380_10104915
536 Ga0157380_10166890
537 Ga0182008_10000004
538 Ga0157377_10010180
539 Ga0157379_10032213
540 Ga0157379_10053287
541 Ga0157379_10244461
542 Ga0157379_10309802
543 Ga0157376_10007428
544 Ga0157376_10028322
545 Ga0157376_10036846
546 Ga0157376_10258458
547 Ga0163161_10008140
548 Ga0163161_10026240
549 Ga0163161_10034121
550 Ga0209050_1003005
551 Ga0209257_1000005
552 Ga0207642_10010221
553 Ga0207688_10031748
554 Ga0207680_10000268
555 Ga0207680_10066841
556 Ga0207645_10000088
557 Ga0207645_10005936
558 Ga0207645_10025938
559 Ga0207645_10042494
560 Ga0207643_10002199
561 Ga0207654_10030391
562 Ga0207671_10005165
563 Ga0207671_10078088
564 Ga0207649_10004427
565 Ga0207694_10160606
566 Ga0207650_10043996
567 Ga0207650_10188624
568 Ga0207659_10006017
569 Ga0207659_10345478
570 Ga0207644_10015759
571 Ga0207644_10042550
572 Ga0207690_10007938
573 Ga0207706_10006646
574 Ga0207706_10084421
575 Ga0207686_10004607
576 Ga0207670_10014259
577 Ga0207670_10016979
578 Ga0207669_10185659
579 Ga0207704_10030140
580 Ga0207691_10022756
581 Ga0207691_10025785
582 Ga0207691_10129562
583 Ga0207711_10313282
584 Ga0207689_10002594
585 Ga0207689_10007598
586 Ga0207689_10014794
587 Ga0207689_10047765
588 Ga0207689_10050329
589 Ga0207661_10100535
590 Ga0207679_10000575
591 Ga0207651_10046293
592 Ga0207651_10090247
593 Ga0207712_10007034
594 Ga0207712_10007090
595 Ga0207712_10008141
596 Ga0207712_10023530
597 Ga0207668_10092898
598 Ga0207640_10048507
599 Ga0207658_10007214
600 Ga0207658_10008446
601 Ga0207658_10051669
602 Ga0207677_10082855
603 Ga0207677_10215513
604 Ga0207677_10252399
605 Ga0207703_10058341
606 Ga0207703_10071566
607 Ga0207703_10078424
608 Ga0207639_10005654
609 Ga0207639_10160484
610 Ga0207639_10280052
611 Ga0207702_10000348
612 Ga0207641_10000053
613 Ga0207641_10000783
614 Ga0207641_10053863
615 Ga0207641_10084579
616 Ga0207648_10001628
617 Ga0207648_10040263
618 Ga0207648_10101611
619 Ga0207648_10162195
620 Ga0207676_10029340
621 Ga0207676_10040922
622 Ga0207676_10194404
623 Ga0207676_10248067
624 Ga0207674_10001817
625 Ga0207674_10271882
626 Ga0207675_100016662
627 Ga0207675_100216705
628 Ga0207675_100256020
629 Ga0207683_10000198
630 Ga0207683_10128585
631 Ga0207683_10220101
632 Ga0207698_10270792
633 Ga0268264_10004390
634 Ga0268264_10055610
635 Ga0307515_10000001
636 Ga0307515_10000190
637 Ga0307511_10000367
638 Ga0307513_10110816
639 Ga0265313_10032942
640 Ga0307516_10001688
641 Ga0307516_10113323
642 Ga0307414_10025031
643 Ga0307414_10190143
644 Ga0373937_0058896
645 Ga0373937_0478601
646 Ga0395899_0001442
647 Ga0395900_0036608
648 Ga0395898_0008170
649 Ga0395905_0008935
650 Ga0395901_0001035
651 Ga0451798_0399127
652 Ga0439441_001565
653 Ga0451577_0008110
654 Ga0451577_0074268
655 Ga0466972_0000950
656 Ga0453683_0095672
657 Ga0453683_0184812
658 Ga0453684_0000440
659 Ga0453684_0139171
660 Ga0453684_0580963
661 Ga0466957_0002431
662 Ga0451576_0104041
663 Ga0495638_0000026
664 Ga0495650_0028127
665 Ga0495642_0068982
666 Ga0495667_0074341
667 Ga0495635_0151878
668 Ga0495661_0052305
669 Ga0495599_0140067
670 Ga0495600_0046254
671 Ga0495672_0018034
672 Ga0495672_0018613
673 Ga0495672_0020291
674 Ga0495672_0038279
675 Ga0495687_000942
676 Ga0495686_0014900
677 Ga0495686_0063600
678 Ga0496104_0335506
679 Ga0496114_0256727
680 Ga0501043_0007723
681 Ga0501266_002382
682 nmdc:mga05p37_322883_c1
683 nmdc:mga0qj67_61723_c1
684 nmdc:mga06r32_353045_c1
685 nmdc:mga08y16_4579_c1
686 nmdc:mga0n895_54968_c1
687 Ga0500583_0053601
688 Ga0500568_0046633
689 Ga0500616_0000068
690 Ga0500611_000138
691 2738762671
692 2890740944
693 2898713799
694 2929155467

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14031

D-ser_dehydrat

Putative serine dehydratase domain

300

389

0.84

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

66

286

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.9115 6 359
7yqa-assembly2.cif.gz_D crystal structure of d-threonine aldolase from chlamydomonas reinhardtii 0.9008 5 358
7yqa-assembly1.cif.gz_A crystal structure of d-threonine aldolase from chlamydomonas reinhardtii 0.891 6 360
7dib-assembly1.cif.gz_A crystal structure of d-threonine aldolase from filomicrobium marinum 0.8897 14 358
3anv-assembly1.cif.gz_A-2 crystal structure of d-serine dehydratase from chicken kidney (2,3-dap complex) 0.8895 5 355
ID Description Score Start End Superfamily
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9195 23 238 3.20.20.10
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.888 23 238 3.20.20.10
4v15B01 Mainly Beta;Beta Barrel;Lyase, Ornithine Decarboxylase; Chain A, domain 1;D-serine dehydratase-like domain 0.8846 252 359 2.40.37.20
3anuA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8672 23 234 3.20.20.10
3wqcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8487 23 234 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A537JU95-F1-model_v4 D-TA family PLP-dependent enzyme 0.9905 1 235 GO:0008721
GO:0036088
AF-A0A3N7HB83-F1-model_v4 D-TA family PLP-dependent enzyme 0.9879 1 161 GO:0008721
GO:0036088
AF-A0A3D4B3C6-F1-model_v4 Threonine aldolase 0.9873 115 216 GO:0008721
GO:0036088
AF-A0A7Y2VPP0-F1-model_v4 D-TA family PLP-dependent enzyme 0.9842 1 235 GO:0008721
GO:0036088
AF-A0A3M1ML19-F1-model_v4 D-TA family PLP-dependent enzyme 0.9834 8 104 GO:0008721
GO:0036088

Map