F417096

General Info

Members Datasets Scaffolds Average Seq Length
347 191 694 295

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10150114|Ga0075362_101501141
Length 349
Sequence MSSAATRLSPHPKTTAVGFCASARLARCSIPWLGCSGSPATNRSLPSLSAFHAVTGLVLGMTDIVPQLLDWYRSAQRDLAWRRPGVSPWQILVSEFMLQQTPVARVEPIWLAWIERWPTPSATAAASAADVLRAWGKLGYPRRAKRLHECATVIATEHGDVVPSDVETLLTLPGVGAYTARAIACFAYRQRVPVVDTNVRRVVARVVHGRADSPASVRDLDDVAALLPDSADAPTFSVALMELGATVCTARSPRCGLCPLSACAWRSRGYPEAAAPVRRVQRYAGTDRQVRGRLLDVLRGNDSPVARAQLDVAWLTDTAQRDRALDSLLVDGLVEQTADGRFALAGEGD

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
125 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
168 2547132424 Nocardia nova SH22a Isolate Unclassified
169 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
170 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
171 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
172 2643221692 Nocardia sp. Root136 Isolate Unclassified
173 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
174 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
175 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
176 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
177 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
178 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
179 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
180 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
181 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
182 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
183 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
184 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
185 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
186 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
187 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
188 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
189 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
190 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
191 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.8
Metatranscriptomes 0
Isolates 7.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.73
Nodule 0.29
Rhizoplane 10.66
Rhizosphere 50.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10150114 3300006177 Bacteria 1118
2 rootH2_10046879 3300003320 Bacteria 5376
3 Ga0055540_1000332 3300003792 Bacteria 41197
4 Ga0055540_1002529 3300003792 Bacteria 9551
5 Ga0070668_100005687 3300005347 Bacteria 9243
6 Ga0070669_100000974 3300005353 Bacteria 20904
7 Ga0070671_100000602 3300005355 Bacteria 25682
8 Ga0070667_100000054 3300005367 Bacteria 151864
9 Ga0070667_100001778 3300005367 Bacteria 19197
10 Ga0070667_100228046 3300005367 Bacteria 1660
11 Ga0070667_100348867 3300005367 Bacteria 1339
12 Ga0070709_10015661 3300005434 Bacteria 4318
13 Ga0070714_100005110 3300005435 Bacteria 9981
14 Ga0070714_100092064 3300005435 Bacteria 2657
15 Ga0070713_100045622 3300005436 Bacteria 3593
16 Ga0070713_100194501 3300005436 Bacteria 1829
17 Ga0070663_100049857 3300005455 Bacteria 2975
18 Ga0068853_100011949 3300005539 Bacteria 7063
19 Ga0070665_100022520 3300005548 Bacteria 6341
20 Ga0070702_100077061 3300005615 Bacteria 1986
21 Ga0068859_100097300 3300005617 Bacteria 2996
22 Ga0068859_100206370 3300005617 Bacteria 2050
23 Ga0068864_100049190 3300005618 Bacteria 3627
24 Ga0068863_100002719 3300005841 Bacteria 17470
25 Ga0068858_100046904 3300005842 Bacteria 4006
26 Ga0068860_100000150 3300005843 Bacteria 113021
27 Ga0068862_100000078 3300005844 Bacteria 114008
28 Ga0081455_10000037 3300005937 Bacteria 136059
29 Ga0081539_10000015 3300005985 Bacteria 395781
30 Ga0075365_10003851 3300006038 Bacteria 7835
31 Ga0075365_10019100 3300006038 Bacteria 4224
32 Ga0075365_10089935 3300006038 Bacteria 2090
33 Ga0075368_10043822 3300006042 Bacteria 1764
34 Ga0075363_100000566 3300006048 Bacteria 12112
35 Ga0075363_100000896 3300006048 Bacteria 10485
36 Ga0075363_100002428 3300006048 Bacteria 7610
37 Ga0075363_100003708 3300006048 Bacteria 6569
38 Ga0075364_10001623 3300006051 Bacteria 12322
39 Ga0075364_10002440 3300006051 Bacteria 10414
40 Ga0075364_10005134 3300006051 Bacteria 7591
41 Ga0075364_10008312 3300006051 Bacteria 6197
42 Ga0075364_10039683 3300006051 Bacteria 3052
43 Ga0075362_10109529 3300006177 Bacteria 1299
44 Ga0075367_10058233 3300006178 Bacteria 2299
45 Ga0075369_10002512 3300006186 Bacteria 6556
46 Ga0075369_10015071 3300006186 Bacteria 3098
47 Ga0075369_10040263 3300006186 Bacteria 1997
48 Ga0075369_10189536 3300006186 Bacteria 947
49 Ga0075370_10001615 3300006353 Bacteria 9954
50 Ga0075370_10022218 3300006353 Bacteria 3482
51 Ga0075370_10025534 3300006353 Bacteria 3270
52 Ga0075370_10054948 3300006353 Bacteria 2262
53 Ga0075370_10059246 3300006353 Bacteria 2179
54 Ga0075370_10096531 3300006353 Bacteria 1708
55 Ga0097620_100097296 3300006931 Bacteria 2996
56 Ga0097620_100206384 3300006931 Bacteria 2050
57 Ga0105245_10001364 3300009098 Bacteria 22114
58 Ga0105247_10000074 3300009101 Bacteria 113207
59 Ga0105248_10000077 3300009177 Bacteria 113148
60 Ga0105237_10003350 3300009545 Bacteria 19075
61 Ga0105237_10049696 3300009545 Bacteria 4214
62 Ga0105237_10496204 3300009545 Bacteria 1227
63 Ga0105249_10000111 3300009553 Bacteria 109164
64 Ga0105239_10001924 3300010375 Bacteria 27070
65 Ga0105239_10009269 3300010375 Bacteria 11129
66 Ga0105239_10567385 3300010375 Bacteria 1293
67 Ga0163162_10122755 3300013306 Bacteria 2702
68 Ga0163163_10079974 3300014325 Bacteria 3268
69 Ga0163163_10206430 3300014325 Bacteria 2013
70 Ga0213873_10000128 3300021358 Bacteria 14438
71 Ga0213876_10000970 3300021384 Bacteria 18866
72 Ga0213876_10018879 3300021384 Bacteria 3641
73 Ga0213876_10019446 3300021384 Bacteria 3589
74 Ga0213876_10033260 3300021384 Bacteria 2718
75 Ga0213876_10039682 3300021384 Bacteria 2487
76 Ga0213875_10000123 3300021388 Bacteria 86889
77 Ga0213875_10002412 3300021388 Bacteria 11234
78 Ga0213875_10002566 3300021388 Bacteria 10819
79 Ga0209673_1007450 3300025273 Bacteria 5041
80 Ga0209051_1000149 3300025303 Bacteria 132185
81 Ga0209051_1000728 3300025303 Bacteria 35703
82 Ga0209051_1002308 3300025303 Bacteria 13885
83 Ga0209051_1003470 3300025303 Bacteria 10324
84 Ga0209051_1072130 3300025303 Bacteria 1034
85 Ga0207710_10000086 3300025900 Bacteria 129918
86 Ga0207671_10007003 3300025914 Bacteria 9885
87 Ga0207671_10026474 3300025914 Bacteria 4344
88 Ga0207681_10000755 3300025923 Bacteria 21272
89 Ga0207700_10162278 3300025928 Bacteria 1857
90 Ga0207664_10002066 3300025929 Bacteria 13221
91 Ga0207664_10042033 3300025929 Bacteria 3565
92 Ga0207664_10047806 3300025929 Bacteria 3363
93 Ga0207711_10000391 3300025941 Bacteria 46492
94 Ga0207679_10131922 3300025945 Bacteria 2006
95 Ga0207712_10000162 3300025961 Bacteria 69049
96 Ga0207668_10003146 3300025972 Bacteria 9660
97 Ga0207658_10000290 3300025986 Bacteria 52606
98 Ga0207658_10004836 3300025986 Bacteria 9312
99 Ga0207703_10033812 3300026035 Bacteria 4055
100 Ga0207703_10630323 3300026035 Bacteria 1016
101 Ga0207639_10030008 3300026041 Bacteria 3985
102 Ga0207678_10018674 3300026067 Bacteria 6088
103 Ga0207641_10002143 3300026088 Bacteria 18645
104 Ga0207676_10101691 3300026095 Bacteria 2384
105 Ga0268265_10000012 3300028380 Bacteria 343132
106 Ga0268264_10000104 3300028381 Bacteria 217837
107 Ga0307511_10136200 3300030521 Bacteria 1461
108 Ga0265327_10001502 3300031251 Bacteria 28921
109 Ga0307413_10008952 3300031824 Bacteria 4761
110 Ga0307518_10000242 3300031838 Bacteria 41098
111 Ga0307518_10015446 3300031838 Bacteria 5473
112 Ga0307410_10076243 3300031852 Bacteria 2340
113 Ga0307411_10234467 3300032005 Bacteria 1433
114 Ga0316582_0053903 3300036647 Bacteria 2559
115 Ga0395898_0302399 3300037466 Bacteria 1526
116 Ga0436364_0088767 3300037853 Bacteria 6602
117 Ga0436364_0207977 3300037853 Bacteria 46460
118 Ga0436364_0369844 3300037853 Bacteria 8190
119 Ga0436364_0661798 3300037853 Bacteria 86818
120 Ga0436364_0997683 3300037853 Bacteria 6609
121 Ga0395901_0231959 3300038443 Bacteria 1927
122 Ga0436365_0123515 3300039437 Bacteria 51393
123 Ga0436365_0133945 3300039437 Bacteria 5853
124 Ga0436365_0351391 3300039437 Bacteria 6871
125 Ga0436365_1148961 3300039437 Bacteria 22755
126 Ga0436365_1215690 3300039437 Bacteria 17274
127 Ga0436365_1861291 3300039437 Bacteria 1413
128 Ga0436365_1875952 3300039437 Bacteria 53998
129 Ga0436363_0577177 3300039450 Bacteria 1191
130 Ga0436363_1274443 3300039450 Bacteria 3073
131 Ga0436362_0665629 3300039453 Bacteria 14531
132 Ga0439466_0004709 3300041411 Bacteria 5245
133 Ga0439466_0009574 3300041411 Bacteria 3621
134 Ga0439466_0026610 3300041411 Bacteria 2009
135 Ga0439465_0019176 3300041413 Bacteria 2138
136 Ga0451793_1711977 3300041452 Bacteria 2483
137 Ga0439431_0002878 3300041997 Bacteria 3787
138 Ga0439431_0007321 3300041997 Bacteria 2460
139 Ga0439449_0017106 3300042007 Bacteria 2721
140 Ga0466969_0035119 3300044656 Bacteria 2537
141 Ga0466972_0032470 3300044658 Bacteria 2563
142 Ga0466972_0034357 3300044658 Bacteria 2485
143 Ga0466972_0042270 3300044658 Bacteria 2217
144 Ga0466965_0009090 3300044683 Bacteria 4611
145 Ga0466965_0061851 3300044683 Bacteria 1872
146 Ga0466966_0000310 3300044684 Bacteria 31446
147 Ga0466966_0002005 3300044684 Bacteria 13211
148 Ga0466966_0029353 3300044684 Bacteria 3579
149 Ga0466966_0060663 3300044684 Bacteria 2387
150 Ga0466961_0010021 3300044693 Bacteria 6037
151 Ga0466961_0099867 3300044693 Bacteria 1829
152 Ga0466963_0011373 3300044694 Bacteria 5417
153 Ga0466963_0011748 3300044694 Bacteria 5339
154 Ga0466963_0023172 3300044694 Bacteria 3939
155 Ga0466971_0007687 3300044719 Bacteria 4700
156 Ga0466968_0002729 3300044735 Bacteria 6524
157 Ga0466968_0005319 3300044735 Bacteria 4817
158 Ga0466968_0040455 3300044735 Bacteria 1965
159 Ga0466968_0128431 3300044735 Bacteria 1152
160 Ga0466970_0021822 3300044765 Bacteria 3339
161 Ga0466970_0058013 3300044765 Bacteria 2071
162 Ga0466957_0004660 3300044842 Bacteria 7663
163 Ga0466957_0008138 3300044842 Bacteria 5952
164 Ga0466957_0015871 3300044842 Bacteria 4401
165 Ga0466957_0036495 3300044842 Bacteria 2955
166 Ga0466957_0105806 3300044842 Bacteria 1779
167 Ga0466960_0000399 3300044901 Bacteria 14825
168 Ga0466959_0012255 3300045049 Bacteria 6188
169 Ga0466959_0058494 3300045049 Bacteria 2807
170 Ga0466959_0090273 3300045049 Bacteria 2201
171 Ga0466958_0000081 3300045836 Bacteria 29136
172 Ga0466958_0019784 3300045836 Bacteria 3920
173 Ga0466958_0060382 3300045836 Bacteria 2308
174 Ga0466958_0285407 3300045836 Bacteria 1058
175 Ga0466967_0011280 3300045976 Bacteria 6756
176 Ga0466967_0019527 3300045976 Bacteria 5452
177 Ga0466967_0026697 3300045976 Bacteria 4788
178 Ga0466967_0268063 3300045976 Bacteria 1635
179 Ga0466967_0313665 3300045976 Bacteria 1511
180 Ga0466967_0339717 3300045976 Bacteria 1452
181 Ga0466967_0380991 3300045976 Bacteria 1369
182 Ga0466967_0809979 3300045976 Bacteria 930
183 Ga0495638_0001520 3300046460 Bacteria 20883
184 Ga0495639_0069883 3300046475 Bacteria 1620
185 Ga0495607_0053194 3300046501 Bacteria 2341
186 Ga0495583_0030226 3300046506 Bacteria 2641
187 Ga0495648_0005926 3300046524 Bacteria 10056
188 Ga0495665_0030253 3300046531 Bacteria 2898
189 Ga0495634_0179352 3300046642 Bacteria 1327
190 Ga0495624_0132691 3300046690 Bacteria 1527
191 Ga0495674_0046385 3300047319 Bacteria 3857
192 Ga0495672_0086908 3300047320 Bacteria 1728
193 Ga0495683_0001563 3300047323 Bacteria 14824
194 Ga0495683_0056221 3300047323 Bacteria 1958
195 Ga0495673_0001676 3300047469 Bacteria 17037
196 Ga0495686_0001525 3300047472 Bacteria 24906
197 Ga0495593_0038707 3300047673 Bacteria 2574
198 Ga0496100_0000021 3300048903 Bacteria 140074
199 Ga0496100_0002331 3300048903 Bacteria 9603
200 Ga0496100_0002965 3300048903 Bacteria 8730
201 Ga0496101_0000037 3300048904 Bacteria 166198
202 Ga0496101_0000088 3300048904 Bacteria 101493
203 Ga0496101_0001048 3300048904 Bacteria 16336
204 Ga0496102_0000083 3300048905 Bacteria 138102
205 Ga0496102_0000214 3300048905 Bacteria 76691
206 Ga0496102_0016870 3300048905 Bacteria 6389
207 Ga0496102_0027991 3300048905 Bacteria 5035
208 Ga0496103_0000060 3300048906 Bacteria 138526
209 Ga0496103_0000962 3300048906 Bacteria 20448
210 Ga0496103_0002919 3300048906 Bacteria 10604
211 Ga0496103_0064064 3300048906 Bacteria 2291
212 Ga0496104_0024773 3300048907 Bacteria 5525
213 Ga0496105_0044103 3300048908 Bacteria 3677
214 Ga0496106_0004664 3300048909 Bacteria 10162
215 Ga0496106_0012285 3300048909 Bacteria 6319
216 Ga0496106_0474775 3300048909 Bacteria 1005
217 Ga0496107_0001058 3300048910 Bacteria 16477
218 Ga0496107_0019530 3300048910 Bacteria 4782
219 Ga0496107_0020430 3300048910 Bacteria 4678
220 Ga0496108_0000616 3300048911 Bacteria 27935
221 Ga0496108_0045302 3300048911 Bacteria 3674
222 Ga0496108_0389318 3300048911 Bacteria 1217
223 Ga0496109_0000042 3300048912 Bacteria 138654
224 Ga0496109_0050832 3300048912 Bacteria 3774
225 Ga0496109_0068282 3300048912 Bacteria 3259
226 Ga0496110_0275111 3300048913 Bacteria 1533
227 Ga0496111_0052919 3300048914 Bacteria 2932
228 Ga0496112_0245001 3300048915 Bacteria 1744
229 Ga0496113_0008730 3300048916 Bacteria 6617
230 Ga0496114_0000620 3300048917 Bacteria 26246
231 Ga0496114_0009610 3300048917 Bacteria 7681
232 Ga0496115_0006706 3300048918 Bacteria 8444
233 Ga0496115_0018760 3300048918 Bacteria 5317
234 Ga0496116_0000159 3300048919 Bacteria 138102
235 Ga0496116_0005139 3300048919 Bacteria 12285
236 Ga0496116_0014418 3300048919 Bacteria 6313
237 Ga0496117_0000167 3300048920 Bacteria 138102
238 Ga0496117_0001209 3300048920 Bacteria 38718
239 Ga0496117_0059758 3300048920 Bacteria 2630
240 Ga0496117_0080173 3300048920 Bacteria 2148
241 Ga0496118_0000121 3300048921 Bacteria 138102
242 Ga0496118_0000160 3300048921 Bacteria 120349
243 Ga0496118_0000331 3300048921 Bacteria 80747
244 Ga0496119_0003922 3300048922 Bacteria 15091
245 Ga0496119_0003977 3300048922 Bacteria 14954
246 Ga0496121_0000002 3300048924 Bacteria 1494588
247 Ga0496121_0000062 3300048924 Bacteria 274819
248 Ga0496121_0012304 3300048924 Bacteria 9360
249 Ga0496122_0000048 3300048925 Bacteria 269532
250 Ga0496123_0007636 3300048926 Bacteria 10122
251 Ga0496124_0000002 3300048927 Bacteria 1494588
252 Ga0496124_0051315 3300048927 Bacteria 3510
253 Ga0496125_0000002 3300048928 Bacteria 1480920
254 Ga0496125_0173603 3300048928 Bacteria 1445
255 Ga0496126_0000009 3300048929 Bacteria 750350
256 Ga0496126_0000368 3300048929 Bacteria 92918
257 Ga0496126_0020285 3300048929 Bacteria 6523
258 Ga0496126_0044873 3300048929 Bacteria 4067
259 Ga0496126_0101291 3300048929 Bacteria 2519
260 Ga0501032_0001469 3300049569 Bacteria 18772
261 Ga0501032_0011650 3300049569 Bacteria 6305
262 Ga0501032_0026564 3300049569 Bacteria 3980
263 Ga0501033_0013834 3300049570 Bacteria 6140
264 Ga0501033_0317821 3300049570 Bacteria 1094
265 Ga0501034_0001433 3300049571 Bacteria 31790
266 Ga0501034_0083987 3300049571 Bacteria 3186
267 Ga0501036_0088191 3300049572 Bacteria 2622
268 Ga0501037_0000252 3300049573 Bacteria 45847
269 Ga0501038_0001347 3300049574 Bacteria 22359
270 Ga0501039_0000433 3300049575 Bacteria 30193
271 Ga0501040_0388636 3300049576 Bacteria 1001
272 Ga0501043_0003819 3300049579 Bacteria 12392
273 Ga0501047_0043853 3300049581 Bacteria 4320
274 Ga0501047_0087804 3300049581 Bacteria 2987
275 Ga0501047_0272166 3300049581 Bacteria 1540
276 Ga0501067_0027881 3300049583 Bacteria 3130
277 Ga0501069_0075918 3300049585 Bacteria 1889
278 Ga0501070_0001055 3300049586 Bacteria 24784
279 Ga0501070_0098743 3300049586 Bacteria 2415
280 Ga0501073_0032963 3300049589 Bacteria 3691
281 Ga0501080_0162470 3300049742 Bacteria 2062
282 Ga0501035_0005367 3300049822 Bacteria 12119
283 Ga0501044_0000410 3300049823 Bacteria 52916
284 Ga0501044_0006749 3300049823 Bacteria 12655
285 Ga0501044_0018689 3300049823 Bacteria 7423
286 Ga0501044_0137598 3300049823 Bacteria 2433
287 Ga0501044_0211334 3300049823 Bacteria 1894
288 nmdc:mga03683_90480_c1 3300050489 Bacteria 1333
289 nmdc:mga03n38_144068_c1 3300050490 Bacteria 1193
290 nmdc:mga03n38_4719_c1 3300050490 Bacteria 4553
291 nmdc:mga03n38_48_c1 3300050490 Bacteria 25875
292 nmdc:mga03n38_98691_c1 3300050490 Bacteria 1405
293 nmdc:mga00v17_13603_c1 3300050491 Bacteria 4521
294 nmdc:mga00v17_18386_c1 3300050491 Bacteria 3969
295 nmdc:mga00v17_203105_c1 3300050491 Bacteria 1281
296 nmdc:mga00v17_2186_c1 3300050491 Bacteria 10044
297 nmdc:mga00v17_234921_c1 3300050491 Bacteria 1188
298 nmdc:mga00v17_66640_c1 3300050491 Bacteria 2223
299 nmdc:mga0yw44_104057_c1 3300050492 Bacteria 1811
300 nmdc:mga0yw44_13434_c1 3300050492 Bacteria 4312
301 nmdc:mga0yw44_31137_c1 3300050492 Bacteria 3099
302 nmdc:mga0yw44_54375_c1 3300050492 Bacteria 1761
303 nmdc:mga06z11_29319_c1 3300050494 Bacteria 2650
304 nmdc:mga04h51_11660_c1 3300050495 Bacteria 2446
305 nmdc:mga07m45_1405_c1 3300050496 Bacteria 11012
306 nmdc:mga07m45_51211_c1 3300050496 Bacteria 2328
307 nmdc:mga07m45_77299_c1 3300050496 Bacteria 1898
308 nmdc:mga06r32_105640_c1 3300050510 Bacteria 2766
309 nmdc:mga0sz30_10922_c1 3300050516 Bacteria 3492
310 nmdc:mga0sz30_3802_c1 3300050516 Bacteria 5437
311 nmdc:mga0sz30_44742_c1 3300050516 Bacteria 1866
312 Ga0500610_0001537 3300053079 Bacteria 7934
313 Ga0500643_004780 3300053087 Bacteria 6000
314 Ga0500643_011984 3300053087 Bacteria 3128
315 Ga0500562_008167 3300053108 Bacteria 2641
316 Ga0500652_093382 3300053131 Bacteria 1256
317 Ga0500559_0016062 3300053136 Bacteria 3161
318 Ga0500568_0002380 3300053139 Bacteria 11121
319 Ga0500645_000082 3300053730 Bacteria 76473
320 Ga0466962_0002860 3300061719 Bacteria 8228
321 Ga0466962_0021678 3300061719 Bacteria 3084
322 Ga0466962_0047664 3300061719 Bacteria 2048
323 2523384968 2523231044 Bacteria 6434991
324 2548692733 2547132424 Bacteria 8348532
325 2552105299 2551306166 Bacteria 9731570
326 2586065086 2585427649 Bacteria 9053857
327 2644488678 2643221687 Bacteria 6500351
328 2644515745 2643221692 Bacteria 7282860
329 2644639623 2643221715 Bacteria 6671032
330 2738668959 2738541264 Bacteria 5935393
331 2739148251 2738541356 Bacteria 5935017
332 2753075816 2751185734 Bacteria 8863695
333 2809593484 2808606522 Bacteria 9488490
334 2842136466 2842134933 Bacteria 5847019
335 2863069453 2863067949 Bacteria 8541735
336 2866557429 2866552031 Bacteria 5824618
337 2866612543 2866612099 Bacteria 7543886
338 2870728581 2870721527 Bacteria 9689237
339 2899366155 2899359706 Bacteria 10940472
340 2902795637 2902792274 Bacteria 7270173
341 2902800857 2902799365 Bacteria 5419524
342 2902814261 2902810491 Bacteria 6794147
343 2902842614 2902837492 Bacteria 6697721
344 2915769368 2915768154 Bacteria 8424322
345 2919718039 2919713450 Bacteria 7431245
346 2929218129 2929212328 Bacteria 7708288
347 2939584022 2939582691 Bacteria 7088898
348 Ga0075362_10150114
349 rootH2_10046879
350 Ga0055540_1000332
351 Ga0055540_1002529
352 Ga0070668_100005687
353 Ga0070669_100000974
354 Ga0070671_100000602
355 Ga0070667_100000054
356 Ga0070667_100001778
357 Ga0070667_100228046
358 Ga0070667_100348867
359 Ga0070709_10015661
360 Ga0070714_100005110
361 Ga0070714_100092064
362 Ga0070713_100045622
363 Ga0070713_100194501
364 Ga0070663_100049857
365 Ga0068853_100011949
366 Ga0070665_100022520
367 Ga0070702_100077061
368 Ga0068859_100097300
369 Ga0068859_100206370
370 Ga0068864_100049190
371 Ga0068863_100002719
372 Ga0068858_100046904
373 Ga0068860_100000150
374 Ga0068862_100000078
375 Ga0081455_10000037
376 Ga0081539_10000015
377 Ga0075365_10003851
378 Ga0075365_10019100
379 Ga0075365_10089935
380 Ga0075368_10043822
381 Ga0075363_100000566
382 Ga0075363_100000896
383 Ga0075363_100002428
384 Ga0075363_100003708
385 Ga0075364_10001623
386 Ga0075364_10002440
387 Ga0075364_10005134
388 Ga0075364_10008312
389 Ga0075364_10039683
390 Ga0075362_10109529
391 Ga0075367_10058233
392 Ga0075369_10002512
393 Ga0075369_10015071
394 Ga0075369_10040263
395 Ga0075369_10189536
396 Ga0075370_10001615
397 Ga0075370_10022218
398 Ga0075370_10025534
399 Ga0075370_10054948
400 Ga0075370_10059246
401 Ga0075370_10096531
402 Ga0097620_100097296
403 Ga0097620_100206384
404 Ga0105245_10001364
405 Ga0105247_10000074
406 Ga0105248_10000077
407 Ga0105237_10003350
408 Ga0105237_10049696
409 Ga0105237_10496204
410 Ga0105249_10000111
411 Ga0105239_10001924
412 Ga0105239_10009269
413 Ga0105239_10567385
414 Ga0163162_10122755
415 Ga0163163_10079974
416 Ga0163163_10206430
417 Ga0213873_10000128
418 Ga0213876_10000970
419 Ga0213876_10018879
420 Ga0213876_10019446
421 Ga0213876_10033260
422 Ga0213876_10039682
423 Ga0213875_10000123
424 Ga0213875_10002412
425 Ga0213875_10002566
426 Ga0209673_1007450
427 Ga0209051_1000149
428 Ga0209051_1000728
429 Ga0209051_1002308
430 Ga0209051_1003470
431 Ga0209051_1072130
432 Ga0207710_10000086
433 Ga0207671_10007003
434 Ga0207671_10026474
435 Ga0207681_10000755
436 Ga0207700_10162278
437 Ga0207664_10002066
438 Ga0207664_10042033
439 Ga0207664_10047806
440 Ga0207711_10000391
441 Ga0207679_10131922
442 Ga0207712_10000162
443 Ga0207668_10003146
444 Ga0207658_10000290
445 Ga0207658_10004836
446 Ga0207703_10033812
447 Ga0207703_10630323
448 Ga0207639_10030008
449 Ga0207678_10018674
450 Ga0207641_10002143
451 Ga0207676_10101691
452 Ga0268265_10000012
453 Ga0268264_10000104
454 Ga0307511_10136200
455 Ga0265327_10001502
456 Ga0307413_10008952
457 Ga0307518_10000242
458 Ga0307518_10015446
459 Ga0307410_10076243
460 Ga0307411_10234467
461 Ga0316582_0053903
462 Ga0395898_0302399
463 Ga0436364_0088767
464 Ga0436364_0207977
465 Ga0436364_0369844
466 Ga0436364_0661798
467 Ga0436364_0997683
468 Ga0395901_0231959
469 Ga0436365_0123515
470 Ga0436365_0133945
471 Ga0436365_0351391
472 Ga0436365_1148961
473 Ga0436365_1215690
474 Ga0436365_1861291
475 Ga0436365_1875952
476 Ga0436363_0577177
477 Ga0436363_1274443
478 Ga0436362_0665629
479 Ga0439466_0004709
480 Ga0439466_0009574
481 Ga0439466_0026610
482 Ga0439465_0019176
483 Ga0451793_1711977
484 Ga0439431_0002878
485 Ga0439431_0007321
486 Ga0439449_0017106
487 Ga0466969_0035119
488 Ga0466972_0032470
489 Ga0466972_0034357
490 Ga0466972_0042270
491 Ga0466965_0009090
492 Ga0466965_0061851
493 Ga0466966_0000310
494 Ga0466966_0002005
495 Ga0466966_0029353
496 Ga0466966_0060663
497 Ga0466961_0010021
498 Ga0466961_0099867
499 Ga0466963_0011373
500 Ga0466963_0011748
501 Ga0466963_0023172
502 Ga0466971_0007687
503 Ga0466968_0002729
504 Ga0466968_0005319
505 Ga0466968_0040455
506 Ga0466968_0128431
507 Ga0466970_0021822
508 Ga0466970_0058013
509 Ga0466957_0004660
510 Ga0466957_0008138
511 Ga0466957_0015871
512 Ga0466957_0036495
513 Ga0466957_0105806
514 Ga0466960_0000399
515 Ga0466959_0012255
516 Ga0466959_0058494
517 Ga0466959_0090273
518 Ga0466958_0000081
519 Ga0466958_0019784
520 Ga0466958_0060382
521 Ga0466958_0285407
522 Ga0466967_0011280
523 Ga0466967_0019527
524 Ga0466967_0026697
525 Ga0466967_0268063
526 Ga0466967_0313665
527 Ga0466967_0339717
528 Ga0466967_0380991
529 Ga0466967_0809979
530 Ga0495638_0001520
531 Ga0495639_0069883
532 Ga0495607_0053194
533 Ga0495583_0030226
534 Ga0495648_0005926
535 Ga0495665_0030253
536 Ga0495634_0179352
537 Ga0495624_0132691
538 Ga0495674_0046385
539 Ga0495672_0086908
540 Ga0495683_0001563
541 Ga0495683_0056221
542 Ga0495673_0001676
543 Ga0495686_0001525
544 Ga0495593_0038707
545 Ga0496100_0000021
546 Ga0496100_0002331
547 Ga0496100_0002965
548 Ga0496101_0000037
549 Ga0496101_0000088
550 Ga0496101_0001048
551 Ga0496102_0000083
552 Ga0496102_0000214
553 Ga0496102_0016870
554 Ga0496102_0027991
555 Ga0496103_0000060
556 Ga0496103_0000962
557 Ga0496103_0002919
558 Ga0496103_0064064
559 Ga0496104_0024773
560 Ga0496105_0044103
561 Ga0496106_0004664
562 Ga0496106_0012285
563 Ga0496106_0474775
564 Ga0496107_0001058
565 Ga0496107_0019530
566 Ga0496107_0020430
567 Ga0496108_0000616
568 Ga0496108_0045302
569 Ga0496108_0389318
570 Ga0496109_0000042
571 Ga0496109_0050832
572 Ga0496109_0068282
573 Ga0496110_0275111
574 Ga0496111_0052919
575 Ga0496112_0245001
576 Ga0496113_0008730
577 Ga0496114_0000620
578 Ga0496114_0009610
579 Ga0496115_0006706
580 Ga0496115_0018760
581 Ga0496116_0000159
582 Ga0496116_0005139
583 Ga0496116_0014418
584 Ga0496117_0000167
585 Ga0496117_0001209
586 Ga0496117_0059758
587 Ga0496117_0080173
588 Ga0496118_0000121
589 Ga0496118_0000160
590 Ga0496118_0000331
591 Ga0496119_0003922
592 Ga0496119_0003977
593 Ga0496121_0000002
594 Ga0496121_0000062
595 Ga0496121_0012304
596 Ga0496122_0000048
597 Ga0496123_0007636
598 Ga0496124_0000002
599 Ga0496124_0051315
600 Ga0496125_0000002
601 Ga0496125_0173603
602 Ga0496126_0000009
603 Ga0496126_0000368
604 Ga0496126_0020285
605 Ga0496126_0044873
606 Ga0496126_0101291
607 Ga0501032_0001469
608 Ga0501032_0011650
609 Ga0501032_0026564
610 Ga0501033_0013834
611 Ga0501033_0317821
612 Ga0501034_0001433
613 Ga0501034_0083987
614 Ga0501036_0088191
615 Ga0501037_0000252
616 Ga0501038_0001347
617 Ga0501039_0000433
618 Ga0501040_0388636
619 Ga0501043_0003819
620 Ga0501047_0043853
621 Ga0501047_0087804
622 Ga0501047_0272166
623 Ga0501067_0027881
624 Ga0501069_0075918
625 Ga0501070_0001055
626 Ga0501070_0098743
627 Ga0501073_0032963
628 Ga0501080_0162470
629 Ga0501035_0005367
630 Ga0501044_0000410
631 Ga0501044_0006749
632 Ga0501044_0018689
633 Ga0501044_0137598
634 Ga0501044_0211334
635 nmdc:mga03683_90480_c1
636 nmdc:mga03n38_144068_c1
637 nmdc:mga03n38_4719_c1
638 nmdc:mga03n38_48_c1
639 nmdc:mga03n38_98691_c1
640 nmdc:mga00v17_13603_c1
641 nmdc:mga00v17_18386_c1
642 nmdc:mga00v17_203105_c1
643 nmdc:mga00v17_2186_c1
644 nmdc:mga00v17_234921_c1
645 nmdc:mga00v17_66640_c1
646 nmdc:mga0yw44_104057_c1
647 nmdc:mga0yw44_13434_c1
648 nmdc:mga0yw44_31137_c1
649 nmdc:mga0yw44_54375_c1
650 nmdc:mga06z11_29319_c1
651 nmdc:mga04h51_11660_c1
652 nmdc:mga07m45_1405_c1
653 nmdc:mga07m45_51211_c1
654 nmdc:mga07m45_77299_c1
655 nmdc:mga06r32_105640_c1
656 nmdc:mga0sz30_10922_c1
657 nmdc:mga0sz30_3802_c1
658 nmdc:mga0sz30_44742_c1
659 Ga0500610_0001537
660 Ga0500643_004780
661 Ga0500643_011984
662 Ga0500562_008167
663 Ga0500652_093382
664 Ga0500559_0016062
665 Ga0500568_0002380
666 Ga0500645_000082
667 Ga0466962_0002860
668 Ga0466962_0021678
669 Ga0466962_0047664
670 2523384968
671 2548692733
672 2552105299
673 2586065086
674 2644488678
675 2644515745
676 2644639623
677 2738668959
678 2739148251
679 2753075816
680 2809593484
681 2842136466
682 2863069453
683 2866557429
684 2866612543
685 2870728581
686 2899366155
687 2902795637
688 2902800857
689 2902814261
690 2902842614
691 2915769368
692 2919718039
693 2929218129
694 2939584022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10576

EndIII_4Fe-2S

Iron-sulfur binding domain of endonuclease III

248

262

0.95

PF00633

HHH

Helix-hairpin-helix motif

157

186

0.94

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

93

220

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yph-assembly1.cif.gz_A crystal structure of muty bound to its anti-substrate with the disulfide cross-linker reduced 0.9266 3 213
1rrq-assembly1.cif.gz_A muty adenine glycosylase in complex with dna containing an a:oxog pair 0.9194 3 219
1rrs-assembly1.cif.gz_A muty adenine glycosylase in complex with dna containing an abasic site 0.9175 3 219
5kn9-assembly1.cif.gz_A muty n-terminal domain in complex with dna containing an intrahelical oxog:a base-pair 0.9095 1 218
8dvy-assembly1.cif.gz_A dna glycosylase muty variant n146s in complex with dna containing d(8-oxo-g) paired with an enzyme-generated abasic site product (ap) and crystalized with calcium acetate 0.9069 3 225
ID Description Score Start End Superfamily
af_P9WQ09_31_141_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9947 20 130 1.10.340.30
af_P9WQ09_31_141_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9859 20 130 1.10.340.30
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9642 20 132 1.10.340.30
af_A0A1D6IX31_1_95_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9632 39 135 1.10.1670.10
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9588 20 132 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A2S8N6M2-F1-model_v4 deleted 0.9968 35 117
AF-A0A7V9PF85-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9867 39 140 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A7X8VL02-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9842 1 144 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A1Q9TKW9-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.983 7 290 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-Q0S8A2-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9827 1 293 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536

Map