F417158

General Info

Members Datasets Scaffolds Average Seq Length
347 196 346 452

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10026994|Ga0157379_100269944
Length 515
Sequence MSDLFDLPFEEDDDVGPPLVADVPASGAGRQRPAVDRQPSTVDTPRSTVPPQPPGASARRAPGDERPVAPVVTRRVFSVTELTLGIRDLLETEFFEVWVEGEISNCKVWNTGHLYFTLKDSGAQVRSVIFRSALRYLKFKPADGLRVVARGRVSVYEPKGEYQLVCEHMEPHGLGALQLAFDQLKKRLQQEGLFDAARKRPLPALPRKIGIVTSLDGAAIRDIIKVLSRRYTNAHLVIRPARVQGDGAALDIARGLRAIARLPGVDVIIVGRGGGSIEDLWAFNEEIVARAIVGSPVPVISAVGHESDVTIADFVADLRAPTPSAAAEMVVVRKDEFAARIDRLAGRLVATTRARVHALSRAVHLISGRPALAGVPGRVAMRGRHVAELTHTLAREIRSALTLRHRRLQQLQRQLDAFDPGRCLGGVRTRLVTADSRLTAATRRAHHQADARLRGCASRLDSLSPLAVLGRGYAVCWTADGARILRASTDVSVGEPVRVTLASGELDCIVRRTTN

Samples

Sample ID Description Type Environment
1 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
140 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 2.59
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10085306 3300005295 Bacteria 6268
2 Ga0070676_10001436 3300005328 Bacteria 12032
3 Ga0070676_10048646 3300005328 Bacteria 2479
4 Ga0070690_100020851 3300005330 Bacteria 3996
5 Ga0070690_100026105 3300005330 Bacteria 3600
6 Ga0070670_100004731 3300005331 Bacteria 11423
7 Ga0070670_100155880 3300005331 Bacteria 1978
8 Ga0068869_100103482 3300005334 Bacteria 2157
9 Ga0068869_100220671 3300005334 Bacteria 1502
10 Ga0070666_10060375 3300005335 Bacteria 2566
11 Ga0070680_100065511 3300005336 Bacteria 2977
12 Ga0068868_100008101 3300005338 Bacteria 7516
13 Ga0068868_100013300 3300005338 Bacteria 6031
14 Ga0068868_100066063 3300005338 Bacteria 2875
15 Ga0070660_100084783 3300005339 Bacteria 2491
16 Ga0070689_100004875 3300005340 Bacteria 9111
17 Ga0070689_100011650 3300005340 Bacteria 6305
18 Ga0070691_10066880 3300005341 Bacteria 1738
19 Ga0070687_100016036 3300005343 Bacteria 3404
20 Ga0070668_100152382 3300005347 Bacteria 1870
21 Ga0070669_100007108 3300005353 Bacteria 8043
22 Ga0070669_100087623 3300005353 Bacteria 2328
23 Ga0070669_100152861 3300005353 Bacteria 1788
24 Ga0070671_100007176 3300005355 Bacteria 8908
25 Ga0070674_100001500 3300005356 Bacteria 12440
26 Ga0070674_100005863 3300005356 Bacteria 7145
27 Ga0070673_100001513 3300005364 Bacteria 13666
28 Ga0070673_100007858 3300005364 Bacteria 7065
29 Ga0070673_100067941 3300005364 Bacteria 2852
30 Ga0070688_100008035 3300005365 Bacteria 5709
31 Ga0070688_100020794 3300005365 Bacteria 3823
32 Ga0070659_100041428 3300005366 Bacteria 3600
33 Ga0070667_100010567 3300005367 Bacteria 7620
34 Ga0070667_100028673 3300005367 Bacteria 4635
35 Ga0070714_100009663 3300005435 Bacteria 7595
36 Ga0070701_10002082 3300005438 Bacteria 7593
37 Ga0070701_10003091 3300005438 Bacteria 6522
38 Ga0070701_10008615 3300005438 Bacteria 4423
39 Ga0070705_100056891 3300005440 Bacteria 2305
40 Ga0070705_100094391 3300005440 Bacteria 1873
41 Ga0070700_100004777 3300005441 Bacteria 7109
42 Ga0070700_100010283 3300005441 Bacteria 5163
43 Ga0070700_100044865 3300005441 Bacteria 2725
44 Ga0070694_100007724 3300005444 Bacteria 6561
45 Ga0070694_100032804 3300005444 Bacteria 3412
46 Ga0070678_100022786 3300005456 Bacteria 4159
47 Ga0070678_100039934 3300005456 Bacteria 3316
48 Ga0070678_100106710 3300005456 Bacteria 2183
49 Ga0070678_100114816 3300005456 Bacteria 2113
50 Ga0070662_100105371 3300005457 Bacteria 2140
51 Ga0070681_10068998 3300005458 Bacteria 3502
52 Ga0068867_100050891 3300005459 Bacteria 3055
53 Ga0068867_100087249 3300005459 Bacteria 2362
54 Ga0070707_100064337 3300005468 Bacteria 3522
55 Ga0070707_100199367 3300005468 Bacteria 1951
56 Ga0070707_100259460 3300005468 Bacteria 1691
57 Ga0070699_100110895 3300005518 Bacteria 2409
58 Ga0070679_100033013 3300005530 Bacteria 5123
59 Ga0070684_100035871 3300005535 Bacteria 4247
60 Ga0070697_100169779 3300005536 Bacteria 1845
61 Ga0070695_100000481 3300005545 Bacteria 20745
62 Ga0070695_100001237 3300005545 Bacteria 14040
63 Ga0070695_100045350 3300005545 Unclassified 2802
64 Ga0070696_100062422 3300005546 Bacteria 2608
65 Ga0070696_100103607 3300005546 Unclassified 2042
66 Ga0070665_100012196 3300005548 Bacteria 8665
67 Ga0070665_100031333 3300005548 Bacteria 5351
68 Ga0070704_100001748 3300005549 Bacteria 11869
69 Ga0070704_100004766 3300005549 Bacteria 7851
70 Ga0070704_100011670 3300005549 Bacteria 5396
71 Ga0070704_100081911 3300005549 Bacteria 2378
72 Ga0068855_100046860 3300005563 Bacteria 5109
73 Ga0068857_100033732 3300005577 Bacteria 4527
74 Ga0068854_100061997 3300005578 Bacteria 2709
75 Ga0068856_100105637 3300005614 Bacteria 2810
76 Ga0070702_100005462 3300005615 Bacteria 5924
77 Ga0068852_100036771 3300005616 Bacteria 4100
78 Ga0068859_100001952 3300005617 Bacteria 21030
79 Ga0068859_100044995 3300005617 Bacteria 4435
80 Ga0068859_100193992 3300005617 Bacteria 2115
81 Ga0068864_100146741 3300005618 Bacteria 2133
82 Ga0068864_100239193 3300005618 Bacteria 1682
83 Ga0068861_100049827 3300005719 Bacteria 3172
84 Ga0068861_100060837 3300005719 Bacteria 2896
85 Ga0068863_100305578 3300005841 Bacteria 1543
86 Ga0068858_100024924 3300005842 Bacteria 5567
87 Ga0068858_100026222 3300005842 Bacteria 5418
88 Ga0068858_100041409 3300005842 Bacteria 4270
89 Ga0068858_100142128 3300005842 Bacteria 2253
90 Ga0068860_100029873 3300005843 Bacteria 5243
91 Ga0068862_100006547 3300005844 Bacteria 9666
92 Ga0068862_100019606 3300005844 Bacteria 5647
93 Ga0081540_1063145 3300005983 Bacteria 1754
94 Ga0081539_10074971 3300005985 Bacteria 1799
95 Ga0075362_10000801 3300006177 Bacteria 9387
96 Ga0075366_10000530 3300006195 Bacteria 17699
97 Ga0097621_100014512 3300006237 Bacteria 5898
98 Ga0097621_100082623 3300006237 Bacteria 2675
99 Ga0068871_100109241 3300006358 Bacteria 2325
100 Ga0075428_100008690 3300006844 Bacteria 11268
101 Ga0075428_100057629 3300006844 Bacteria 4252
102 Ga0075428_100082490 3300006844 Bacteria 3508
103 Ga0075430_100007940 3300006846 Bacteria 8968
104 Ga0075430_100011667 3300006846 Bacteria 7477
105 Ga0075430_100057396 3300006846 Bacteria 3275
106 Ga0075431_100004728 3300006847 Bacteria 13381
107 Ga0075431_100031624 3300006847 Bacteria 5450
108 Ga0075431_100108235 3300006847 Bacteria 2868
109 Ga0075433_10009188 3300006852 Bacteria 7899
110 Ga0075433_10159396 3300006852 Bacteria 2008
111 Ga0075433_10231963 3300006852 Bacteria 1639
112 Ga0075434_100038568 3300006871 Bacteria 4731
113 Ga0075434_100064046 3300006871 Bacteria 3660
114 Ga0075434_100077864 3300006871 Bacteria 3311
115 Ga0075434_100192192 3300006871 Bacteria 2062
116 Ga0075429_100012552 3300006880 Bacteria 7350
117 Ga0075429_100052468 3300006880 Bacteria 3548
118 Ga0068865_100017474 3300006881 Bacteria 4613
119 Ga0068865_100079258 3300006881 Bacteria 2352
120 Ga0068865_100091677 3300006881 Bacteria 2206
121 Ga0075436_100008930 3300006914 Bacteria 6863
122 Ga0097620_100001952 3300006931 Bacteria 21030
123 Ga0097620_100044994 3300006931 Bacteria 4435
124 Ga0097620_100193994 3300006931 Bacteria 2115
125 Ga0075435_100000706 3300007076 Bacteria 20658
126 Ga0075435_100010574 3300007076 Bacteria 6754
127 Ga0075435_100123546 3300007076 Bacteria 2162
128 Ga0075435_100202810 3300007076 Bacteria 1681
129 Ga0105240_10006418 3300009093 Bacteria 17287
130 Ga0105240_10051976 3300009093 Bacteria 5153
131 Ga0111539_10001774 3300009094 Bacteria 28680
132 Ga0111539_10002365 3300009094 Bacteria 25074
133 Ga0111539_10002665 3300009094 Bacteria 23642
134 Ga0111539_10007274 3300009094 Bacteria 14174
135 Ga0111539_10078744 3300009094 Bacteria 3877
136 Ga0111539_10100266 3300009094 Bacteria 3401
137 Ga0111539_10180046 3300009094 Bacteria 2469
138 Ga0105247_10015547 3300009101 Bacteria 4557
139 Ga0114129_10003079 3300009147 Bacteria 23397
140 Ga0114129_10003085 3300009147 Bacteria 23382
141 Ga0114129_10006591 3300009147 Bacteria 16480
142 Ga0114129_10010707 3300009147 Bacteria 13075
143 Ga0114129_10011496 3300009147 Bacteria 12605
144 Ga0114129_10016775 3300009147 Bacteria 10427
145 Ga0114129_10029480 3300009147 Bacteria 7773
146 Ga0114129_10061238 3300009147 Bacteria 5259
147 Ga0114129_10164829 3300009147 Bacteria 3025
148 Ga0105242_10001388 3300009176 Bacteria 19073
149 Ga0105242_10019944 3300009176 Bacteria 5252
150 Ga0105248_10030068 3300009177 Bacteria 6062
151 Ga0105248_10058431 3300009177 Bacteria 4332
152 Ga0105248_10078857 3300009177 Bacteria 3702
153 Ga0105248_10207244 3300009177 Bacteria 2209
154 Ga0105249_10001334 3300009553 Bacteria 21606
155 Ga0105249_10043919 3300009553 Bacteria 4065
156 Ga0105249_10065938 3300009553 Bacteria 3332
157 Ga0105246_10021871 3300011119 Bacteria 4122
158 Ga0157375_10018181 3300013308 Bacteria 6370
159 Ga0163163_10015742 3300014325 Bacteria 7003
160 Ga0163163_10270488 3300014325 Bacteria 1751
161 Ga0157380_10003886 3300014326 Bacteria 10304
162 Ga0157380_10007439 3300014326 Bacteria 7775
163 Ga0157380_10058997 3300014326 Bacteria 3061
164 Ga0157380_10226727 3300014326 Bacteria 1675
165 Ga0157377_10015219 3300014745 Bacteria 3929
166 Ga0157379_10003739 3300014968 Bacteria 12939
167 Ga0157379_10013864 3300014968 Bacteria 7066
168 Ga0157379_10026994 3300014968 Bacteria 5110
169 Ga0157379_10037352 3300014968 Bacteria 4330
170 Ga0157376_10009597 3300014969 Bacteria 7038
171 Ga0157376_10057545 3300014969 Bacteria 3253
172 Ga0207697_10001514 3300025315 Bacteria 12621
173 Ga0207682_10001841 3300025893 Bacteria 9661
174 Ga0207688_10001443 3300025901 Bacteria 12425
175 Ga0207680_10049789 3300025903 Bacteria 2496
176 Ga0207645_10002829 3300025907 Bacteria 13470
177 Ga0207643_10020319 3300025908 Bacteria 3644
178 Ga0207705_10090377 3300025909 Bacteria 2241
179 Ga0207662_10002054 3300025918 Bacteria 9973
180 Ga0207662_10002248 3300025918 Bacteria 9648
181 Ga0207657_10093963 3300025919 Bacteria 2497
182 Ga0207652_10018662 3300025921 Bacteria 5692
183 Ga0207646_10053917 3300025922 Bacteria 3597
184 Ga0207646_10064569 3300025922 Bacteria 3268
185 Ga0207646_10079753 3300025922 Bacteria 2927
186 Ga0207681_10023762 3300025923 Bacteria 3925
187 Ga0207681_10140167 3300025923 Bacteria 1800
188 Ga0207659_10005636 3300025926 Bacteria 7615
189 Ga0207687_10014295 3300025927 Bacteria 5193
190 Ga0207644_10037261 3300025931 Bacteria 3420
191 Ga0207690_10035132 3300025932 Bacteria 3235
192 Ga0207686_10014004 3300025934 Bacteria 4453
193 Ga0207670_10051307 3300025936 Bacteria 2769
194 Ga0207669_10001529 3300025937 Bacteria 9860
195 Ga0207704_10031756 3300025938 Bacteria 2979
196 Ga0207704_10066093 3300025938 Bacteria 2268
197 Ga0207691_10005705 3300025940 Bacteria 12037
198 Ga0207711_10022416 3300025941 Bacteria 5280
199 Ga0207711_10031445 3300025941 Bacteria 4481
200 Ga0207689_10000831 3300025942 Bacteria 29759
201 Ga0207679_10032912 3300025945 Bacteria 3645
202 Ga0207651_10001622 3300025960 Bacteria 10322
203 Ga0207712_10002418 3300025961 Bacteria 12069
204 Ga0207658_10022805 3300025986 Bacteria 4361
205 Ga0207677_10021249 3300026023 Bacteria 3962
206 Ga0207677_10056451 3300026023 Bacteria 2691
207 Ga0207703_10006046 3300026035 Bacteria 9681
208 Ga0207703_10167767 3300026035 Bacteria 1928
209 Ga0207708_10000690 3300026075 Bacteria 25620
210 Ga0207708_10002607 3300026075 Bacteria 13262
211 Ga0207702_10138797 3300026078 Bacteria 2197
212 Ga0207648_10001594 3300026089 Bacteria 24839
213 Ga0207676_10080485 3300026095 Bacteria 2644
214 Ga0207674_10043449 3300026116 Bacteria 4633
215 Ga0207675_100001401 3300026118 Bacteria 24104
216 Ga0207675_100004015 3300026118 Bacteria 14272
217 Ga0207675_100045021 3300026118 Bacteria 4123
218 Ga0207675_100070037 3300026118 Bacteria 3278
219 Ga0207683_10019861 3300026121 Bacteria 5741
220 Ga0207428_10002217 3300027907 Bacteria 19496
221 Ga0207428_10003096 3300027907 Bacteria 16357
222 Ga0207428_10008381 3300027907 Bacteria 9336
223 Ga0268266_10005725 3300028379 Bacteria 11509
224 Ga0268266_10051839 3300028379 Bacteria 3523
225 Ga0268265_10018031 3300028380 Bacteria 4886
226 Ga0268265_10049130 3300028380 Bacteria 3171
227 Ga0268265_10066118 3300028380 Bacteria 2793
228 Ga0268265_10094318 3300028380 Bacteria 2400
229 Ga0268265_10156747 3300028380 Bacteria 1928
230 Ga0265330_10000034 3300031235 Bacteria 123933
231 Ga0265332_10000236 3300031238 Bacteria 44137
232 Ga0265316_10000057 3300031344 Bacteria 119213
233 Ga0307408_100035547 3300031548 Bacteria 3497
234 Ga0316575_10021295 3300031665 Bacteria 2494
235 Ga0316579_10002456 3300031691 Bacteria 7003
236 Ga0265314_10000039 3300031711 Bacteria 220957
237 Ga0265342_10000475 3300031712 Bacteria 43531
238 Ga0316578_10002726 3300031728 Bacteria 7857
239 Ga0307405_10015488 3300031731 Bacteria 4132
240 Ga0316577_10003699 3300031733 Bacteria 7783
241 Ga0307406_10014542 3300031901 Bacteria 4532
242 Ga0307407_10004539 3300031903 Bacteria 5910
243 Ga0307416_100187770 3300032002 Bacteria 1945
244 Ga0307416_100273766 3300032002 Bacteria 1659
245 Ga0307416_100294025 3300032002 Bacteria 1610
246 Ga0307414_10156696 3300032004 Bacteria 1804
247 Ga0307411_10008301 3300032005 Bacteria 5367
248 Ga0307411_10047981 3300032005 Bacteria 2764
249 Ga0307411_10205608 3300032005 Bacteria 1516
250 Ga0307415_100009527 3300032126 Bacteria 5450
251 Ga0316583_10000796 3300032133 Bacteria 9934
252 Ga0316585_10001922 3300032137 Bacteria 5549
253 Ga0373948_0007332 3300034817 Bacteria 1852
254 Ga0373940_0002102 3300035088 Bacteria 3793
255 Ga0373949_0007478 3300035090 Bacteria 2392
256 Ga0373952_0014519 3300035092 Bacteria 1578
257 Ga0373932_0015582 3300035112 Bacteria 1928
258 Ga0373961_0006165 3300035241 Bacteria 2881
259 Ga0373931_0022676 3300035691 Bacteria 3162
260 Ga0373937_0095996 3300036401 Bacteria 2749
261 Ga0316582_0001195 3300036647 Bacteria 11141
262 Ga0395905_0040669 3300037471 Bacteria 4362
263 Ga0439450_000447 3300042008 Bacteria 5354
264 Ga0439460_0014685 3300042461 Bacteria 2060
265 Ga0453684_0088249 3300044712 Bacteria 3840
266 Ga0451576_0047449 3300045051 Bacteria 4516
267 Ga0451576_0253696 3300045051 Bacteria 1838
268 Ga0495629_0186616 3300046459 Bacteria 1436
269 Ga0495658_0127590 3300046683 Bacteria 1545
270 Ga0496100_0003996 3300048903 Bacteria 7755
271 Ga0496104_0031178 3300048907 Bacteria 4957
272 Ga0496105_0122966 3300048908 Bacteria 2140
273 Ga0496107_0099798 3300048910 Bacteria 2128
274 Ga0496108_0054911 3300048911 Bacteria 3343
275 Ga0496112_0014053 3300048915 Bacteria 7411
276 Ga0496112_0080596 3300048915 Bacteria 3219
277 Ga0496113_0090843 3300048916 Bacteria 2353
278 Ga0496114_0007297 3300048917 Bacteria 8730
279 Ga0501032_0075152 3300049569 Unclassified 2250
280 Ga0501034_0062838 3300049571 Bacteria 3728
281 Ga0501034_0089402 3300049571 Bacteria 3078
282 Ga0501036_0153024 3300049572 Unclassified 1945
283 Ga0501038_0010451 3300049574 Bacteria 8490
284 Ga0501041_0005261 3300049577 Bacteria 7561
285 Ga0501042_0015069 3300049578 Bacteria 5287
286 Ga0501046_0032638 3300049580 Bacteria 4215
287 Ga0501046_0184558 3300049580 Bacteria 1558
288 Ga0501047_0076323 3300049581 Bacteria 3225
289 Ga0501047_0100838 3300049581 Bacteria 2766
290 Ga0501048_0019441 3300049582 Bacteria 4983
291 Ga0501048_0046252 3300049582 Bacteria 3107
292 Ga0501048_0069226 3300049582 Bacteria 2493
293 Ga0501048_0082864 3300049582 Bacteria 2262
294 Ga0501071_0187571 3300049587 Bacteria 1550
295 Ga0501075_0006302 3300049591 Bacteria 8152
296 Ga0501075_0043267 3300049591 Bacteria 3378
297 Ga0501076_0030415 3300049592 Bacteria 4206
298 Ga0501076_0264585 3300049592 Bacteria 1408
299 Ga0501079_0071641 3300049741 Bacteria 2678
300 Ga0501080_0043835 3300049742 Bacteria 4166
301 Ga0501080_0127622 3300049742 Bacteria 2355
302 Ga0501081_0011827 3300049743 Bacteria 5716
303 Ga0501045_0028727 3300049824 Bacteria 4013
304 Ga0501045_0103943 3300049824 Bacteria 2104
305 nmdc:mga03683_28234_c1 3300050489 Bacteria 2230
306 nmdc:mga00v17_2954_c1 3300050491 Bacteria 8726
307 nmdc:mga00v17_77518_c1 3300050491 Bacteria 2069
308 nmdc:mga0k408_19012_c1 3300050493 Bacteria 3835
309 nmdc:mga05p37_181794_c1 3300050507 Bacteria 2558
310 nmdc:mga05p37_1909_c1 3300050507 Bacteria 24257
311 nmdc:mga05p37_20228_c1 3300050507 Bacteria 4619
312 nmdc:mga05p37_4985_c1 3300050507 Bacteria 15559
313 nmdc:mga05p37_50248_c1 3300050507 Bacteria 5128
314 nmdc:mga05p37_61833_c1 3300050507 Bacteria 4609
315 nmdc:mga05p37_8400_c1 3300050507 Bacteria 12208
316 nmdc:mga09592_11592_c1 3300050508 Bacteria 7169
317 nmdc:mga09592_127930_c1 3300050508 Bacteria 2184
318 nmdc:mga0qj67_22171_c1 3300050509 Bacteria 4876
319 nmdc:mga0qj67_42209_c1 3300050509 Bacteria 3590
320 nmdc:mga06r32_111270_c1 3300050510 Bacteria 2695
321 nmdc:mga06r32_78722_c1 3300050510 Bacteria 3205
322 nmdc:mga08y16_119311_c1 3300050511 Bacteria 2745
323 nmdc:mga08y16_12914_c1 3300050511 Bacteria 8786
324 nmdc:mga08y16_142330_c1 3300050511 Bacteria 2493
325 nmdc:mga08y16_2853_c1 3300050511 Bacteria 17774
326 nmdc:mga08y16_34682_c1 3300050511 Bacteria 5301
327 nmdc:mga08y16_99414_c1 3300050511 Bacteria 3029
328 nmdc:mga0n895_39130_c1 3300050512 Bacteria 4599
329 nmdc:mga0n895_81489_c1 3300050512 Bacteria 3225
330 nmdc:mga0n895_86419_c1 3300050512 Bacteria 3132
331 nmdc:mga0n895_98608_c1 3300050512 Bacteria 2929
332 nmdc:mga0rr50_21346_c1 3300050513 Bacteria 4419
333 nmdc:mga0rr50_99718_c1 3300050513 Bacteria 2279
334 nmdc:mga08x19_18998_c1 3300050514 Bacteria 3598
335 nmdc:mga08x19_2140_c1 3300050514 Bacteria 12069
336 nmdc:mga0a205_1497_c1 3300050515 Bacteria 19917
337 nmdc:mga0a205_229907_c1 3300050515 Bacteria 1738
338 nmdc:mga0a205_37160_c1 3300050515 Bacteria 4682
339 nmdc:mga0a205_42998_c1 3300050515 Bacteria 4355
340 nmdc:mga0a205_4601_c1 3300050515 Bacteria 12370
341 nmdc:mga0a205_57897_c1 3300050515 Bacteria 3742
342 nmdc:mga0a205_82700_c1 3300050515 Bacteria 3101
343 Ga0500568_0001345 3300053139 Bacteria 16034
344 Ga0501084_0130788 3300054114 Bacteria 2113
345 Ga0501082_0195545 3300060353 Bacteria 1759
346 Ga0530510_0029041 3300061734 Bacteria 3968

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031665 Ga0316575_10021295 Ga0316575_100212952 359
2 3300031691 Ga0316579_10002456 Ga0316579_100024563 359
3 3300031728 Ga0316578_10002726 Ga0316578_100027264 359
4 3300031733 Ga0316577_10003699 Ga0316577_100036994 359
5 3300032133 Ga0316583_10000796 Ga0316583_100007963 359
6 3300032137 Ga0316585_10001922 Ga0316585_100019225 359
7 3300036647 Ga0316582_0001195 Ga0316582_0001195_2008_3366 359
8 3300049581 Ga0501047_0100838 Ga0501047_0100838_355_1578 361
9 3300005546 Ga0070696_100103607 Ga0070696_1001036072 384
10 3300031235 Ga0265330_10000034 Ga0265330_1000003431 397
11 3300031238 Ga0265332_10000236 Ga0265332_1000023623 397
12 3300031344 Ga0265316_10000057 Ga0265316_1000005754 397
13 3300031711 Ga0265314_10000039 Ga0265314_10000039146 397
14 3300031712 Ga0265342_10000475 Ga0265342_100004752 397
15 3300007076 Ga0075435_100123546 Ga0075435_1001235462 401
16 3300044712 Ga0453684_0088249 Ga0453684_0088249_333_1727 402
17 3300006844 Ga0075428_100082490 Ga0075428_1000824902 407
18 3300006880 Ga0075429_100052468 Ga0075429_1000524683 407
19 3300009094 Ga0111539_10001774 Ga0111539_1000177425 407
20 3300009147 Ga0114129_10029480 Ga0114129_100294807 407
21 3300032002 Ga0307416_100294025 Ga0307416_1002940251 412
22 3300005438 Ga0070701_10008615 Ga0070701_100086155 413
23 3300009094 Ga0111539_10007274 Ga0111539_100072743 414
24 3300009147 Ga0114129_10003079 Ga0114129_100030795 414
25 3300014326 Ga0157380_10226727 Ga0157380_102267271 414
26 3300049578 Ga0501042_0015069 Ga0501042_0015069_1501_2808 414
27 3300049582 Ga0501048_0019441 Ga0501048_0019441_2471_3778 414
28 3300049587 Ga0501071_0187571 Ga0501071_0187571_25_1332 414
29 3300049591 Ga0501075_0043267 Ga0501075_0043267_83_1390 414
30 3300049824 Ga0501045_0028727 Ga0501045_0028727_2660_3967 414
31 3300050507 nmdc:mga05p37_50248_c1 nmdc:mga05p37_50248_c1_2479_3891 414
32 3300054114 Ga0501084_0130788 Ga0501084_0130788_272_1579 414
33 3300005331 Ga0070670_100004731 Ga0070670_1000047312 415
34 3300032002 Ga0307416_100273766 Ga0307416_1002737662 417
35 3300032004 Ga0307414_10156696 Ga0307414_101566962 417
36 3300032005 Ga0307411_10047981 Ga0307411_100479812 417
37 3300032126 Ga0307415_100009527 Ga0307415_1000095275 417
38 3300037471 Ga0395905_0040669 Ga0395905_0040669_2696_3973 417
39 3300031548 Ga0307408_100035547 Ga0307408_1000355473 418
40 3300031731 Ga0307405_10015488 Ga0307405_100154883 418
41 3300031901 Ga0307406_10014542 Ga0307406_100145423 418
42 3300031903 Ga0307407_10004539 Ga0307407_100045395 418
43 3300032005 Ga0307411_10008301 Ga0307411_100083015 418
44 3300050507 nmdc:mga05p37_61833_c1 nmdc:mga05p37_61833_c1_994_2511 418
45 3300050509 nmdc:mga0qj67_22171_c1 nmdc:mga0qj67_22171_c1_2614_4026 418
46 3300026118 Ga0207675_100070037 Ga0207675_1000700373 419
47 3300028380 Ga0268265_10066118 Ga0268265_100661183 419
48 3300050514 nmdc:mga08x19_2140_c1 nmdc:mga08x19_2140_c1_6784_8250 419
49 3300005468 Ga0070707_100259460 Ga0070707_1002594601 421
50 3300005444 Ga0070694_100032804 Ga0070694_1000328042 422
51 3300005468 Ga0070707_100199367 Ga0070707_1001993673 422
52 3300005545 Ga0070695_100000481 Ga0070695_1000004815 422
53 3300005546 Ga0070696_100062422 Ga0070696_1000624222 422
54 3300005549 Ga0070704_100011670 Ga0070704_1000116705 422
55 3300009093 Ga0105240_10051976 Ga0105240_100519766 422
56 3300009147 Ga0114129_10010707 Ga0114129_100107075 422
57 3300050507 nmdc:mga05p37_1909_c1 nmdc:mga05p37_1909_c1_22387_23808 422
58 3300050510 nmdc:mga06r32_78722_c1 nmdc:mga06r32_78722_c1_1717_3174 422
59 3300005458 Ga0070681_10068998 Ga0070681_100689984 423
60 3300005468 Ga0070707_100064337 Ga0070707_1000643374 423
61 3300005615 Ga0070702_100005462 Ga0070702_1000054625 423
62 3300025922 Ga0207646_10079753 Ga0207646_100797533 423
63 3300049592 Ga0501076_0264585 Ga0501076_0264585_26_1366 424
64 3300006844 Ga0075428_100008690 Ga0075428_10000869010 425
65 3300006844 Ga0075428_100057629 Ga0075428_1000576295 425
66 3300006846 Ga0075430_100007940 Ga0075430_10000794012 425
67 3300006846 Ga0075430_100057396 Ga0075430_1000573962 425
68 3300006847 Ga0075431_100031624 Ga0075431_1000316243 425
69 3300006847 Ga0075431_100108235 Ga0075431_1001082352 425
70 3300006880 Ga0075429_100012552 Ga0075429_1000125523 425
71 3300009147 Ga0114129_10003085 Ga0114129_100030858 425
72 3300049592 Ga0501076_0030415 Ga0501076_0030415_2138_3415 425
73 3300050491 nmdc:mga00v17_77518_c1 nmdc:mga00v17_77518_c1_44_1372 425
74 3300050508 nmdc:mga09592_127930_c1 nmdc:mga09592_127930_c1_585_2051 425
75 3300005328 Ga0070676_10001436 Ga0070676_100014369 426
76 3300005356 Ga0070674_100001500 Ga0070674_1000015009 426
77 3300005364 Ga0070673_100067941 Ga0070673_1000679413 426
78 3300005438 Ga0070701_10003091 Ga0070701_100030914 426
79 3300005440 Ga0070705_100056891 Ga0070705_1000568912 426
80 3300005441 Ga0070700_100004777 Ga0070700_1000047775 426
81 3300005444 Ga0070694_100007724 Ga0070694_1000077242 426
82 3300005456 Ga0070678_100114816 Ga0070678_1001148163 426
83 3300005545 Ga0070695_100001237 Ga0070695_1000012374 426
84 3300005549 Ga0070704_100001748 Ga0070704_1000017489 426
85 3300005719 Ga0068861_100049827 Ga0068861_1000498273 426
86 3300006881 Ga0068865_100079258 Ga0068865_1000792583 426
87 3300014326 Ga0157380_10003886 Ga0157380_1000388610 426
88 3300025907 Ga0207645_10002829 Ga0207645_100028299 426
89 3300025937 Ga0207669_10001529 Ga0207669_100015295 426
90 3300025938 Ga0207704_10066093 Ga0207704_100660933 426
91 3300026075 Ga0207708_10002607 Ga0207708_1000260711 426
92 3300026118 Ga0207675_100001401 Ga0207675_10000140114 426
93 3300048915 Ga0496112_0080596 Ga0496112_0080596_1309_2727 426
94 3300005353 Ga0070669_100087623 Ga0070669_1000876232 427
95 3300005365 Ga0070688_100008035 Ga0070688_1000080354 428
96 3300005335 Ga0070666_10060375 Ga0070666_100603752 429
97 3300005536 Ga0070697_100169779 Ga0070697_1001697792 429
98 3300005548 Ga0070665_100031333 Ga0070665_1000313332 429
99 3300025927 Ga0207687_10014295 Ga0207687_100142953 429
100 3300026023 Ga0207677_10056451 Ga0207677_100564512 429
101 3300028379 Ga0268266_10051839 Ga0268266_100518393 429
102 3300049571 Ga0501034_0062838 Ga0501034_0062838_777_2117 429
103 3300049581 Ga0501047_0076323 Ga0501047_0076323_1261_2709 429
104 3300049742 Ga0501080_0043835 Ga0501080_0043835_1461_2909 429
105 3300014969 Ga0157376_10057545 Ga0157376_100575453 430
106 3300006852 Ga0075433_10159396 Ga0075433_101593963 431
107 3300006871 Ga0075434_100038568 Ga0075434_1000385684 431
108 3300007076 Ga0075435_100010574 Ga0075435_1000105744 431
109 3300007076 Ga0075435_100202810 Ga0075435_1002028101 431
110 3300009553 Ga0105249_10043919 Ga0105249_100439193 431
111 3300032002 Ga0307416_100187770 Ga0307416_1001877702 431
112 3300050512 nmdc:mga0n895_39130_c1 nmdc:mga0n895_39130_c1_1287_2816 431
113 3300050512 nmdc:mga0n895_86419_c1 nmdc:mga0n895_86419_c1_1535_2947 431
114 3300050513 nmdc:mga0rr50_21346_c1 nmdc:mga0rr50_21346_c1_1402_2931 431
115 3300050515 nmdc:mga0a205_37160_c1 nmdc:mga0a205_37160_c1_1143_2564 431
116 3300005985 Ga0081539_10074971 Ga0081539_100749712 432
117 3300046683 Ga0495658_0127590 Ga0495658_0127590_127_1437 432
118 3300050493 nmdc:mga0k408_19012_c1 nmdc:mga0k408_19012_c1_45_1484 432
119 3300006177 Ga0075362_10000801 Ga0075362_1000080113 433
120 3300006195 Ga0075366_10000530 Ga0075366_1000053011 433
121 3300009093 Ga0105240_10006418 Ga0105240_100064188 433
122 3300045051 Ga0451576_0253696 Ga0451576_0253696_10_1332 433
123 3300050489 nmdc:mga03683_28234_c1 nmdc:mga03683_28234_c1_747_2186 433
124 3300050491 nmdc:mga00v17_2954_c1 nmdc:mga00v17_2954_c1_2205_3644 433
125 3300005330 Ga0070690_100026105 Ga0070690_1000261053 434
126 3300005338 Ga0068868_100008101 Ga0068868_1000081014 434
127 3300005457 Ga0070662_100105371 Ga0070662_1001053713 434
128 3300005618 Ga0068864_100146741 Ga0068864_1001467412 434
129 3300005841 Ga0068863_100305578 Ga0068863_1003055782 434
130 3300005842 Ga0068858_100142128 Ga0068858_1001421282 434
131 3300006881 Ga0068865_100017474 Ga0068865_1000174743 434
132 3300014326 Ga0157380_10007439 Ga0157380_100074397 434
133 3300014745 Ga0157377_10015219 Ga0157377_100152194 434
134 3300014968 Ga0157379_10003739 Ga0157379_100037392 434
135 3300006914 Ga0075436_100008930 Ga0075436_1000089302 435
136 3300050515 nmdc:mga0a205_229907_c1 nmdc:mga0a205_229907_c1_107_1504 435
137 3300006871 Ga0075434_100064046 Ga0075434_1000640462 436
138 3300009147 Ga0114129_10006591 Ga0114129_100065914 436
139 3300050507 nmdc:mga05p37_4985_c1 nmdc:mga05p37_4985_c1_8551_9987 436
140 3300050511 nmdc:mga08y16_119311_c1 nmdc:mga08y16_119311_c1_547_1959 436
141 3300050512 nmdc:mga0n895_98608_c1 nmdc:mga0n895_98608_c1_1309_2745 436
142 3300053139 Ga0500568_0001345 Ga0500568_0001345_5517_6911 436
143 3300025922 Ga0207646_10064569 Ga0207646_100645694 437
144 3300042461 Ga0439460_0014685 Ga0439460_0014685_411_1814 437
145 3300005353 Ga0070669_100152861 Ga0070669_1001528612 438
146 3300009094 Ga0111539_10002665 Ga0111539_1000266515 438
147 3300025923 Ga0207681_10140167 Ga0207681_101401672 438
148 3300005356 Ga0070674_100005863 Ga0070674_1000058635 439
149 3300006871 Ga0075434_100192192 Ga0075434_1001921922 439
150 3300009094 Ga0111539_10078744 Ga0111539_100787443 439
151 3300014326 Ga0157380_10058997 Ga0157380_100589973 439
152 3300050511 nmdc:mga08y16_34682_c1 nmdc:mga08y16_34682_c1_2770_4191 439
153 3300050511 nmdc:mga08y16_99414_c1 nmdc:mga08y16_99414_c1_1575_2942 439
154 3300050513 nmdc:mga0rr50_99718_c1 nmdc:mga0rr50_99718_c1_812_2215 439
155 3300006846 Ga0075430_100011667 Ga0075430_10001166710 440
156 3300006847 Ga0075431_100004728 Ga0075431_1000047287 440
157 3300009101 Ga0105247_10015547 Ga0105247_100155472 440
158 3300042008 Ga0439450_000447 Ga0439450_000447_1731_3152 440
159 3300050509 nmdc:mga0qj67_42209_c1 nmdc:mga0qj67_42209_c1_1558_2979 440
160 3300006237 Ga0097621_100082623 Ga0097621_1000826233 441
161 3300009176 Ga0105242_10019944 Ga0105242_100199444 441
162 3300025909 Ga0207705_10090377 Ga0207705_100903772 441
163 3300025921 Ga0207652_10018662 Ga0207652_100186625 441
164 3300048903 Ga0496100_0003996 Ga0496100_0003996_2989_4503 441
165 3300048907 Ga0496104_0031178 Ga0496104_0031178_1216_2730 441
166 3300048910 Ga0496107_0099798 Ga0496107_0099798_491_2005 441
167 3300048917 Ga0496114_0007297 Ga0496114_0007297_4880_6394 441
168 3300049571 Ga0501034_0089402 Ga0501034_0089402_1559_2893 441
169 3300009094 Ga0111539_10180046 Ga0111539_101800462 442
170 3300027907 Ga0207428_10003096 Ga0207428_100030967 442
171 3300050511 nmdc:mga08y16_142330_c1 nmdc:mga08y16_142330_c1_650_2071 442
172 3300014325 Ga0163163_10270488 Ga0163163_102704881 443
173 3300005435 Ga0070714_100009663 Ga0070714_1000096634 444
174 3300011119 Ga0105246_10021871 Ga0105246_100218713 444
175 3300026121 Ga0207683_10019861 Ga0207683_100198614 444
176 3300005456 Ga0070678_100106710 Ga0070678_1001067102 445
177 3300009094 Ga0111539_10100266 Ga0111539_101002663 445
178 3300050510 nmdc:mga06r32_111270_c1 nmdc:mga06r32_111270_c1_14_1420 445
179 3300027907 Ga0207428_10008381 Ga0207428_1000838110 446
180 3300049569 Ga0501032_0075152 Ga0501032_0075152_807_2168 446
181 3300049572 Ga0501036_0153024 Ga0501036_0153024_90_1451 446
182 3300049574 Ga0501038_0010451 Ga0501038_0010451_3595_4956 446
183 3300049577 Ga0501041_0005261 Ga0501041_0005261_2450_3811 446
184 3300049580 Ga0501046_0032638 Ga0501046_0032638_103_1464 446
185 3300049582 Ga0501048_0082864 Ga0501048_0082864_184_1545 446
186 3300050511 nmdc:mga08y16_2853_c1 nmdc:mga08y16_2853_c1_13144_14676 446
187 3300046459 Ga0495629_0186616 Ga0495629_0186616_23_1390 448
188 3300005334 Ga0068869_100103482 Ga0068869_1001034823 451
189 3300005343 Ga0070687_100016036 Ga0070687_1000160363 451
190 3300005353 Ga0070669_100007108 Ga0070669_1000071087 451
191 3300005367 Ga0070667_100010567 Ga0070667_1000105677 451
192 3300005456 Ga0070678_100039934 Ga0070678_1000399343 451
193 3300005459 Ga0068867_100087249 Ga0068867_1000872492 451
194 3300005548 Ga0070665_100012196 Ga0070665_1000121964 451
195 3300005577 Ga0068857_100033732 Ga0068857_1000337324 451
196 3300005617 Ga0068859_100044995 Ga0068859_1000449954 451
197 3300005617 Ga0068859_100193992 Ga0068859_1001939922 451
198 3300005719 Ga0068861_100060837 Ga0068861_1000608374 451
199 3300005843 Ga0068860_100029873 Ga0068860_1000298732 451
200 3300005844 Ga0068862_100006547 Ga0068862_1000065472 451
201 3300006358 Ga0068871_100109241 Ga0068871_1001092412 451
202 3300006852 Ga0075433_10009188 Ga0075433_100091887 451
203 3300006931 Ga0097620_100044994 Ga0097620_1000449944 451
204 3300006931 Ga0097620_100193994 Ga0097620_1001939942 451
205 3300009553 Ga0105249_10001334 Ga0105249_1000133414 451
206 3300013308 Ga0157375_10018181 Ga0157375_100181813 451
207 3300025315 Ga0207697_10001514 Ga0207697_1000151412 451
208 3300025893 Ga0207682_10001841 Ga0207682_1000184110 451
209 3300025901 Ga0207688_10001443 Ga0207688_100014437 451
210 3300025908 Ga0207643_10020319 Ga0207643_100203192 451
211 3300025918 Ga0207662_10002054 Ga0207662_100020545 451
212 3300025940 Ga0207691_10005705 Ga0207691_1000570512 451
213 3300025942 Ga0207689_10000831 Ga0207689_100008316 451
214 3300025945 Ga0207679_10032912 Ga0207679_100329122 451
215 3300025961 Ga0207712_10002418 Ga0207712_100024187 451
216 3300026116 Ga0207674_10043449 Ga0207674_100434492 451
217 3300026118 Ga0207675_100004015 Ga0207675_1000040157 451
218 3300027907 Ga0207428_10002217 Ga0207428_1000221716 451
219 3300028380 Ga0268265_10018031 Ga0268265_100180312 451
220 3300035088 Ga0373940_0002102 Ga0373940_0002102_2272_3675 451
221 3300035090 Ga0373949_0007478 Ga0373949_0007478_850_2253 451
222 3300035092 Ga0373952_0014519 Ga0373952_0014519_79_1482 451
223 3300035112 Ga0373932_0015582 Ga0373932_0015582_506_1909 451
224 3300035241 Ga0373961_0006165 Ga0373961_0006165_441_1844 451
225 3300035691 Ga0373931_0022676 Ga0373931_0022676_356_1759 451
226 3300050508 nmdc:mga09592_11592_c1 nmdc:mga09592_11592_c1_294_1697 451
227 3300050511 nmdc:mga08y16_12914_c1 nmdc:mga08y16_12914_c1_1169_2572 451
228 3300050512 nmdc:mga0n895_81489_c1 nmdc:mga0n895_81489_c1_737_2140 451
229 3300050515 nmdc:mga0a205_1497_c1 nmdc:mga0a205_1497_c1_8250_9653 451
230 3300005347 Ga0070668_100152382 Ga0070668_1001523821 452
231 3300005535 Ga0070684_100035871 Ga0070684_1000358715 452
232 3300005983 Ga0081540_1063145 Ga0081540_10631452 452
233 3300009147 Ga0114129_10011496 Ga0114129_100114968 452
234 3300050507 nmdc:mga05p37_8400_c1 nmdc:mga05p37_8400_c1_6860_8275 452
235 3300061734 Ga0530510_0029041 Ga0530510_0029041_612_2111 452
236 3300009147 Ga0114129_10016775 Ga0114129_1001677510 453
237 3300036401 Ga0373937_0095996 Ga0373937_0095996_364_1782 453
238 3300048908 Ga0496105_0122966 Ga0496105_0122966_241_1641 453
239 3300050507 nmdc:mga05p37_20228_c1 nmdc:mga05p37_20228_c1_1226_2674 453
240 3300050514 nmdc:mga08x19_18998_c1 nmdc:mga08x19_18998_c1_1466_2872 453
241 3300050515 nmdc:mga0a205_82700_c1 nmdc:mga0a205_82700_c1_89_1537 453
242 3300006881 Ga0068865_100091677 Ga0068865_1000916772 454
243 3300005328 Ga0070676_10048646 Ga0070676_100486463 456
244 3300005341 Ga0070691_10066880 Ga0070691_100668802 456
245 3300005441 Ga0070700_100010283 Ga0070700_1000102833 456
246 3300005578 Ga0068854_100061997 Ga0068854_1000619973 456
247 3300005616 Ga0068852_100036771 Ga0068852_1000367715 456
248 3300025918 Ga0207662_10002248 Ga0207662_100022486 456
249 3300025986 Ga0207658_10022805 Ga0207658_100228053 456
250 3300026035 Ga0207703_10167767 Ga0207703_101677672 456
251 3300026075 Ga0207708_10000690 Ga0207708_1000069014 456
252 3300005340 Ga0070689_100011650 Ga0070689_1000116506 457
253 3300005365 Ga0070688_100020794 Ga0070688_1000207943 457
254 3300025936 Ga0207670_10051307 Ga0207670_100513072 457
255 3300049580 Ga0501046_0184558 Ga0501046_0184558_88_1521 457
256 3300049582 Ga0501048_0046252 Ga0501048_0046252_723_2156 457
257 3300049591 Ga0501075_0006302 Ga0501075_0006302_3142_4575 457
258 3300049742 Ga0501080_0127622 Ga0501080_0127622_547_1980 457
259 3300049743 Ga0501081_0011827 Ga0501081_0011827_1624_3057 457
260 3300049824 Ga0501045_0103943 Ga0501045_0103943_45_1478 457
261 3300005518 Ga0070699_100110895 Ga0070699_1001108953 458
262 3300009177 Ga0105248_10058431 Ga0105248_100584312 458
263 3300045051 Ga0451576_0047449 Ga0451576_0047449_2957_4357 458
264 3300005336 Ga0070680_100065511 Ga0070680_1000655111 459
265 3300005440 Ga0070705_100094391 Ga0070705_1000943911 459
266 3300049582 Ga0501048_0069226 Ga0501048_0069226_865_2391 459
267 3300005339 Ga0070660_100084783 Ga0070660_1000847832 461
268 3300025919 Ga0207657_10093963 Ga0207657_100939632 461
269 3300025932 Ga0207690_10035132 Ga0207690_100351322 461
270 3300028379 Ga0268266_10005725 Ga0268266_1000572511 461
271 3300028380 Ga0268265_10049130 Ga0268265_100491302 461
272 3300032005 Ga0307411_10205608 Ga0307411_102056081 461
273 iso_pu_bacteria 2786546548 2787508844 461
274 3300005441 Ga0070700_100044865 Ga0070700_1000448652 462
275 3300005545 Ga0070695_100045350 Ga0070695_1000453503 462
276 3300005549 Ga0070704_100081911 Ga0070704_1000819112 462
277 3300005617 Ga0068859_100001952 Ga0068859_10000195219 462
278 3300005842 Ga0068858_100026222 Ga0068858_1000262224 462
279 3300006931 Ga0097620_100001952 Ga0097620_10000195219 462
280 3300014968 Ga0157379_10037352 Ga0157379_100373523 462
281 3300025922 Ga0207646_10053917 Ga0207646_100539173 462
282 3300025923 Ga0207681_10023762 Ga0207681_100237622 462
283 3300026118 Ga0207675_100045021 Ga0207675_1000450215 462
284 3300028380 Ga0268265_10094318 Ga0268265_100943183 462
285 3300034817 Ga0373948_0007332 Ga0373948_0007332_158_1591 462
286 3300048916 Ga0496113_0090843 Ga0496113_0090843_138_1604 462
287 3300005364 Ga0070673_100007858 Ga0070673_1000078585 464
288 3300009094 Ga0111539_10002365 Ga0111539_1000236521 464
289 3300009177 Ga0105248_10078857 Ga0105248_100788572 464
290 3300005456 Ga0070678_100022786 Ga0070678_1000227865 465
291 3300005842 Ga0068858_100024924 Ga0068858_1000249244 465
292 3300006852 Ga0075433_10231963 Ga0075433_102319631 465
293 3300009147 Ga0114129_10061238 Ga0114129_100612384 465
294 3300009553 Ga0105249_10065938 Ga0105249_100659383 465
295 3300026035 Ga0207703_10006046 Ga0207703_100060464 465
296 3300050515 nmdc:mga0a205_57897_c1 nmdc:mga0a205_57897_c1_564_2042 465
297 3300005331 Ga0070670_100155880 Ga0070670_1001558802 466
298 3300005338 Ga0068868_100066063 Ga0068868_1000660632 466
299 3300005530 Ga0070679_100033013 Ga0070679_1000330134 466
300 3300005563 Ga0068855_100046860 Ga0068855_1000468603 466
301 3300005614 Ga0068856_100105637 Ga0068856_1001056372 466
302 3300005618 Ga0068864_100239193 Ga0068864_1002391932 466
303 3300006237 Ga0097621_100014512 Ga0097621_1000145125 466
304 3300006871 Ga0075434_100077864 Ga0075434_1000778643 466
305 3300009176 Ga0105242_10001388 Ga0105242_1000138811 466
306 3300014968 Ga0157379_10013864 Ga0157379_100138642 466
307 3300014968 Ga0157379_10026994 Ga0157379_100269944 466
308 3300014969 Ga0157376_10009597 Ga0157376_100095974 466
309 3300025903 Ga0207680_10049789 Ga0207680_100497892 466
310 3300025934 Ga0207686_10014004 Ga0207686_100140044 466
311 3300025938 Ga0207704_10031756 Ga0207704_100317563 466
312 3300025941 Ga0207711_10031445 Ga0207711_100314452 466
313 3300026023 Ga0207677_10021249 Ga0207677_100212494 466
314 3300026078 Ga0207702_10138797 Ga0207702_101387973 466
315 3300049741 Ga0501079_0071641 Ga0501079_0071641_1078_2517 466
316 3300050515 nmdc:mga0a205_42998_c1 nmdc:mga0a205_42998_c1_422_1894 466
317 3300060353 Ga0501082_0195545 Ga0501082_0195545_125_1564 466
318 3300005330 Ga0070690_100020851 Ga0070690_1000208513 467
319 3300005334 Ga0068869_100220671 Ga0068869_1002206711 467
320 3300005338 Ga0068868_100013300 Ga0068868_1000133006 467
321 3300005340 Ga0070689_100004875 Ga0070689_1000048756 467
322 3300005355 Ga0070671_100007176 Ga0070671_1000071763 467
323 3300005364 Ga0070673_100001513 Ga0070673_1000015135 467
324 3300005367 Ga0070667_100028673 Ga0070667_1000286733 467
325 3300005438 Ga0070701_10002082 Ga0070701_1000208210 467
326 3300005459 Ga0068867_100050891 Ga0068867_1000508913 467
327 3300005549 Ga0070704_100004766 Ga0070704_1000047665 467
328 3300005842 Ga0068858_100041409 Ga0068858_1000414092 467
329 3300005844 Ga0068862_100019606 Ga0068862_1000196061 467
330 3300007076 Ga0075435_100000706 Ga0075435_1000007068 467
331 3300009177 Ga0105248_10030068 Ga0105248_100300682 467
332 3300014325 Ga0163163_10015742 Ga0163163_100157423 467
333 3300025926 Ga0207659_10005636 Ga0207659_100056364 467
334 3300025931 Ga0207644_10037261 Ga0207644_100372614 467
335 3300025941 Ga0207711_10022416 Ga0207711_100224164 467
336 3300025960 Ga0207651_10001622 Ga0207651_100016222 467
337 3300026089 Ga0207648_10001594 Ga0207648_1000159426 467
338 3300026095 Ga0207676_10080485 Ga0207676_100804853 467
339 3300028380 Ga0268265_10156747 Ga0268265_101567473 467
340 3300048911 Ga0496108_0054911 Ga0496108_0054911_1591_3090 467
341 3300048915 Ga0496112_0014053 Ga0496112_0014053_3372_4871 467
342 3300050515 nmdc:mga0a205_4601_c1 nmdc:mga0a205_4601_c1_8998_10518 467
343 3300009147 Ga0114129_10164829 Ga0114129_101648293 468
344 3300009177 Ga0105248_10207244 Ga0105248_102072442 468
345 3300050507 nmdc:mga05p37_181794_c1 nmdc:mga05p37_181794_c1_137_1624 468
346 3300005366 Ga0070659_100041428 Ga0070659_1000414283 469
347 3300005295 Ga0065707_10085306 Ga0065707_100853067 488

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02601

Exonuc_VII_L

Exonuclease VII, large subunit

193

509

0.97

PF01336

tRNA_anti-codon

OB-fold nucleic acid binding domain

97

171

0.96

PF13742

tRNA_anti_2

OB-fold nucleic acid binding domain

77

170

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z6k-assembly1.cif.gz_A crystal structure of full-length human rpa14/32 heterodimer 0.8574 66 143
1l1o-assembly1.cif.gz_E structure of the human replication protein a (rpa) trimerization core 0.8513 66 142
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.8409 66 142
2pqa-assembly1.cif.gz_A crystal structure of full-length human rpa 14/32 heterodimer 0.8406 64 142
4h02-assembly4.cif.gz_G crystal structure of p. falciparum lysyl-trna synthetase 0.8266 66 141
ID Description Score Start End Superfamily
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9904 47 140 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9801 47 140 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9762 47 140 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9465 47 140 2.40.50.140
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8757 47 140 2.40.50.140
ID Description Score Start End GO Terms
AF-T1AAC6-F1-model_v4 Exonuclease VII, large subunit (EC 3.1.11.6) 0.9863 148 300 GO:0006308
GO:0008855
GO:0009318
AF-A0A2X1KF80-F1-model_v4 Exodeoxyribonuclease 7 large subunit (EC 3.1.11.6) 0.9773 66 143 GO:0003676
GO:0006308
GO:0008855
GO:0009318
AF-Q71IW7-F1-model_v4 Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) 0.9727 161 300 GO:0006308
GO:0008855
GO:0009318
AF-A0A6L5EKV6-F1-model_v4 Exodeoxyribonuclease VII large subunit 0.9671 193 293 GO:0006308
GO:0008855
GO:0009318
AF-A0A656K7M2-F1-model_v4 deleted 0.9661 164 327

Feature Viewer

pLDDT pTM Quality
82.77 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map