F417158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 347 | 196 | 346 | 452 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_10026994|Ga0157379_100269944 |
| Length | 515 |
| Sequence | MSDLFDLPFEEDDDVGPPLVADVPASGAGRQRPAVDRQPSTVDTPRSTVPPQPPGASARRAPGDERPVAPVVTRRVFSVTELTLGIRDLLETEFFEVWVEGEISNCKVWNTGHLYFTLKDSGAQVRSVIFRSALRYLKFKPADGLRVVARGRVSVYEPKGEYQLVCEHMEPHGLGALQLAFDQLKKRLQQEGLFDAARKRPLPALPRKIGIVTSLDGAAIRDIIKVLSRRYTNAHLVIRPARVQGDGAALDIARGLRAIARLPGVDVIIVGRGGGSIEDLWAFNEEIVARAIVGSPVPVISAVGHESDVTIADFVADLRAPTPSAAAEMVVVRKDEFAARIDRLAGRLVATTRARVHALSRAVHLISGRPALAGVPGRVAMRGRHVAELTHTLAREIRSALTLRHRRLQQLQRQLDAFDPGRCLGGVRTRLVTADSRLTAATRRAHHQADARLRGCASRLDSLSPLAVLGRGYAVCWTADGARILRASTDVSVGEPVRVTLASGELDCIVRRTTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 127 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 128 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 130 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 140 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 141 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 142 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 145 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 152 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 161 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 164 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 165 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 182 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 183 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 184 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.02 |
| Nodule | 0 |
| Rhizoplane | 2.59 |
| Rhizosphere | 95.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10085306 | 3300005295 | Bacteria | 6268 |
| 2 | Ga0070676_10001436 | 3300005328 | Bacteria | 12032 |
| 3 | Ga0070676_10048646 | 3300005328 | Bacteria | 2479 |
| 4 | Ga0070690_100020851 | 3300005330 | Bacteria | 3996 |
| 5 | Ga0070690_100026105 | 3300005330 | Bacteria | 3600 |
| 6 | Ga0070670_100004731 | 3300005331 | Bacteria | 11423 |
| 7 | Ga0070670_100155880 | 3300005331 | Bacteria | 1978 |
| 8 | Ga0068869_100103482 | 3300005334 | Bacteria | 2157 |
| 9 | Ga0068869_100220671 | 3300005334 | Bacteria | 1502 |
| 10 | Ga0070666_10060375 | 3300005335 | Bacteria | 2566 |
| 11 | Ga0070680_100065511 | 3300005336 | Bacteria | 2977 |
| 12 | Ga0068868_100008101 | 3300005338 | Bacteria | 7516 |
| 13 | Ga0068868_100013300 | 3300005338 | Bacteria | 6031 |
| 14 | Ga0068868_100066063 | 3300005338 | Bacteria | 2875 |
| 15 | Ga0070660_100084783 | 3300005339 | Bacteria | 2491 |
| 16 | Ga0070689_100004875 | 3300005340 | Bacteria | 9111 |
| 17 | Ga0070689_100011650 | 3300005340 | Bacteria | 6305 |
| 18 | Ga0070691_10066880 | 3300005341 | Bacteria | 1738 |
| 19 | Ga0070687_100016036 | 3300005343 | Bacteria | 3404 |
| 20 | Ga0070668_100152382 | 3300005347 | Bacteria | 1870 |
| 21 | Ga0070669_100007108 | 3300005353 | Bacteria | 8043 |
| 22 | Ga0070669_100087623 | 3300005353 | Bacteria | 2328 |
| 23 | Ga0070669_100152861 | 3300005353 | Bacteria | 1788 |
| 24 | Ga0070671_100007176 | 3300005355 | Bacteria | 8908 |
| 25 | Ga0070674_100001500 | 3300005356 | Bacteria | 12440 |
| 26 | Ga0070674_100005863 | 3300005356 | Bacteria | 7145 |
| 27 | Ga0070673_100001513 | 3300005364 | Bacteria | 13666 |
| 28 | Ga0070673_100007858 | 3300005364 | Bacteria | 7065 |
| 29 | Ga0070673_100067941 | 3300005364 | Bacteria | 2852 |
| 30 | Ga0070688_100008035 | 3300005365 | Bacteria | 5709 |
| 31 | Ga0070688_100020794 | 3300005365 | Bacteria | 3823 |
| 32 | Ga0070659_100041428 | 3300005366 | Bacteria | 3600 |
| 33 | Ga0070667_100010567 | 3300005367 | Bacteria | 7620 |
| 34 | Ga0070667_100028673 | 3300005367 | Bacteria | 4635 |
| 35 | Ga0070714_100009663 | 3300005435 | Bacteria | 7595 |
| 36 | Ga0070701_10002082 | 3300005438 | Bacteria | 7593 |
| 37 | Ga0070701_10003091 | 3300005438 | Bacteria | 6522 |
| 38 | Ga0070701_10008615 | 3300005438 | Bacteria | 4423 |
| 39 | Ga0070705_100056891 | 3300005440 | Bacteria | 2305 |
| 40 | Ga0070705_100094391 | 3300005440 | Bacteria | 1873 |
| 41 | Ga0070700_100004777 | 3300005441 | Bacteria | 7109 |
| 42 | Ga0070700_100010283 | 3300005441 | Bacteria | 5163 |
| 43 | Ga0070700_100044865 | 3300005441 | Bacteria | 2725 |
| 44 | Ga0070694_100007724 | 3300005444 | Bacteria | 6561 |
| 45 | Ga0070694_100032804 | 3300005444 | Bacteria | 3412 |
| 46 | Ga0070678_100022786 | 3300005456 | Bacteria | 4159 |
| 47 | Ga0070678_100039934 | 3300005456 | Bacteria | 3316 |
| 48 | Ga0070678_100106710 | 3300005456 | Bacteria | 2183 |
| 49 | Ga0070678_100114816 | 3300005456 | Bacteria | 2113 |
| 50 | Ga0070662_100105371 | 3300005457 | Bacteria | 2140 |
| 51 | Ga0070681_10068998 | 3300005458 | Bacteria | 3502 |
| 52 | Ga0068867_100050891 | 3300005459 | Bacteria | 3055 |
| 53 | Ga0068867_100087249 | 3300005459 | Bacteria | 2362 |
| 54 | Ga0070707_100064337 | 3300005468 | Bacteria | 3522 |
| 55 | Ga0070707_100199367 | 3300005468 | Bacteria | 1951 |
| 56 | Ga0070707_100259460 | 3300005468 | Bacteria | 1691 |
| 57 | Ga0070699_100110895 | 3300005518 | Bacteria | 2409 |
| 58 | Ga0070679_100033013 | 3300005530 | Bacteria | 5123 |
| 59 | Ga0070684_100035871 | 3300005535 | Bacteria | 4247 |
| 60 | Ga0070697_100169779 | 3300005536 | Bacteria | 1845 |
| 61 | Ga0070695_100000481 | 3300005545 | Bacteria | 20745 |
| 62 | Ga0070695_100001237 | 3300005545 | Bacteria | 14040 |
| 63 | Ga0070695_100045350 | 3300005545 | Unclassified | 2802 |
| 64 | Ga0070696_100062422 | 3300005546 | Bacteria | 2608 |
| 65 | Ga0070696_100103607 | 3300005546 | Unclassified | 2042 |
| 66 | Ga0070665_100012196 | 3300005548 | Bacteria | 8665 |
| 67 | Ga0070665_100031333 | 3300005548 | Bacteria | 5351 |
| 68 | Ga0070704_100001748 | 3300005549 | Bacteria | 11869 |
| 69 | Ga0070704_100004766 | 3300005549 | Bacteria | 7851 |
| 70 | Ga0070704_100011670 | 3300005549 | Bacteria | 5396 |
| 71 | Ga0070704_100081911 | 3300005549 | Bacteria | 2378 |
| 72 | Ga0068855_100046860 | 3300005563 | Bacteria | 5109 |
| 73 | Ga0068857_100033732 | 3300005577 | Bacteria | 4527 |
| 74 | Ga0068854_100061997 | 3300005578 | Bacteria | 2709 |
| 75 | Ga0068856_100105637 | 3300005614 | Bacteria | 2810 |
| 76 | Ga0070702_100005462 | 3300005615 | Bacteria | 5924 |
| 77 | Ga0068852_100036771 | 3300005616 | Bacteria | 4100 |
| 78 | Ga0068859_100001952 | 3300005617 | Bacteria | 21030 |
| 79 | Ga0068859_100044995 | 3300005617 | Bacteria | 4435 |
| 80 | Ga0068859_100193992 | 3300005617 | Bacteria | 2115 |
| 81 | Ga0068864_100146741 | 3300005618 | Bacteria | 2133 |
| 82 | Ga0068864_100239193 | 3300005618 | Bacteria | 1682 |
| 83 | Ga0068861_100049827 | 3300005719 | Bacteria | 3172 |
| 84 | Ga0068861_100060837 | 3300005719 | Bacteria | 2896 |
| 85 | Ga0068863_100305578 | 3300005841 | Bacteria | 1543 |
| 86 | Ga0068858_100024924 | 3300005842 | Bacteria | 5567 |
| 87 | Ga0068858_100026222 | 3300005842 | Bacteria | 5418 |
| 88 | Ga0068858_100041409 | 3300005842 | Bacteria | 4270 |
| 89 | Ga0068858_100142128 | 3300005842 | Bacteria | 2253 |
| 90 | Ga0068860_100029873 | 3300005843 | Bacteria | 5243 |
| 91 | Ga0068862_100006547 | 3300005844 | Bacteria | 9666 |
| 92 | Ga0068862_100019606 | 3300005844 | Bacteria | 5647 |
| 93 | Ga0081540_1063145 | 3300005983 | Bacteria | 1754 |
| 94 | Ga0081539_10074971 | 3300005985 | Bacteria | 1799 |
| 95 | Ga0075362_10000801 | 3300006177 | Bacteria | 9387 |
| 96 | Ga0075366_10000530 | 3300006195 | Bacteria | 17699 |
| 97 | Ga0097621_100014512 | 3300006237 | Bacteria | 5898 |
| 98 | Ga0097621_100082623 | 3300006237 | Bacteria | 2675 |
| 99 | Ga0068871_100109241 | 3300006358 | Bacteria | 2325 |
| 100 | Ga0075428_100008690 | 3300006844 | Bacteria | 11268 |
| 101 | Ga0075428_100057629 | 3300006844 | Bacteria | 4252 |
| 102 | Ga0075428_100082490 | 3300006844 | Bacteria | 3508 |
| 103 | Ga0075430_100007940 | 3300006846 | Bacteria | 8968 |
| 104 | Ga0075430_100011667 | 3300006846 | Bacteria | 7477 |
| 105 | Ga0075430_100057396 | 3300006846 | Bacteria | 3275 |
| 106 | Ga0075431_100004728 | 3300006847 | Bacteria | 13381 |
| 107 | Ga0075431_100031624 | 3300006847 | Bacteria | 5450 |
| 108 | Ga0075431_100108235 | 3300006847 | Bacteria | 2868 |
| 109 | Ga0075433_10009188 | 3300006852 | Bacteria | 7899 |
| 110 | Ga0075433_10159396 | 3300006852 | Bacteria | 2008 |
| 111 | Ga0075433_10231963 | 3300006852 | Bacteria | 1639 |
| 112 | Ga0075434_100038568 | 3300006871 | Bacteria | 4731 |
| 113 | Ga0075434_100064046 | 3300006871 | Bacteria | 3660 |
| 114 | Ga0075434_100077864 | 3300006871 | Bacteria | 3311 |
| 115 | Ga0075434_100192192 | 3300006871 | Bacteria | 2062 |
| 116 | Ga0075429_100012552 | 3300006880 | Bacteria | 7350 |
| 117 | Ga0075429_100052468 | 3300006880 | Bacteria | 3548 |
| 118 | Ga0068865_100017474 | 3300006881 | Bacteria | 4613 |
| 119 | Ga0068865_100079258 | 3300006881 | Bacteria | 2352 |
| 120 | Ga0068865_100091677 | 3300006881 | Bacteria | 2206 |
| 121 | Ga0075436_100008930 | 3300006914 | Bacteria | 6863 |
| 122 | Ga0097620_100001952 | 3300006931 | Bacteria | 21030 |
| 123 | Ga0097620_100044994 | 3300006931 | Bacteria | 4435 |
| 124 | Ga0097620_100193994 | 3300006931 | Bacteria | 2115 |
| 125 | Ga0075435_100000706 | 3300007076 | Bacteria | 20658 |
| 126 | Ga0075435_100010574 | 3300007076 | Bacteria | 6754 |
| 127 | Ga0075435_100123546 | 3300007076 | Bacteria | 2162 |
| 128 | Ga0075435_100202810 | 3300007076 | Bacteria | 1681 |
| 129 | Ga0105240_10006418 | 3300009093 | Bacteria | 17287 |
| 130 | Ga0105240_10051976 | 3300009093 | Bacteria | 5153 |
| 131 | Ga0111539_10001774 | 3300009094 | Bacteria | 28680 |
| 132 | Ga0111539_10002365 | 3300009094 | Bacteria | 25074 |
| 133 | Ga0111539_10002665 | 3300009094 | Bacteria | 23642 |
| 134 | Ga0111539_10007274 | 3300009094 | Bacteria | 14174 |
| 135 | Ga0111539_10078744 | 3300009094 | Bacteria | 3877 |
| 136 | Ga0111539_10100266 | 3300009094 | Bacteria | 3401 |
| 137 | Ga0111539_10180046 | 3300009094 | Bacteria | 2469 |
| 138 | Ga0105247_10015547 | 3300009101 | Bacteria | 4557 |
| 139 | Ga0114129_10003079 | 3300009147 | Bacteria | 23397 |
| 140 | Ga0114129_10003085 | 3300009147 | Bacteria | 23382 |
| 141 | Ga0114129_10006591 | 3300009147 | Bacteria | 16480 |
| 142 | Ga0114129_10010707 | 3300009147 | Bacteria | 13075 |
| 143 | Ga0114129_10011496 | 3300009147 | Bacteria | 12605 |
| 144 | Ga0114129_10016775 | 3300009147 | Bacteria | 10427 |
| 145 | Ga0114129_10029480 | 3300009147 | Bacteria | 7773 |
| 146 | Ga0114129_10061238 | 3300009147 | Bacteria | 5259 |
| 147 | Ga0114129_10164829 | 3300009147 | Bacteria | 3025 |
| 148 | Ga0105242_10001388 | 3300009176 | Bacteria | 19073 |
| 149 | Ga0105242_10019944 | 3300009176 | Bacteria | 5252 |
| 150 | Ga0105248_10030068 | 3300009177 | Bacteria | 6062 |
| 151 | Ga0105248_10058431 | 3300009177 | Bacteria | 4332 |
| 152 | Ga0105248_10078857 | 3300009177 | Bacteria | 3702 |
| 153 | Ga0105248_10207244 | 3300009177 | Bacteria | 2209 |
| 154 | Ga0105249_10001334 | 3300009553 | Bacteria | 21606 |
| 155 | Ga0105249_10043919 | 3300009553 | Bacteria | 4065 |
| 156 | Ga0105249_10065938 | 3300009553 | Bacteria | 3332 |
| 157 | Ga0105246_10021871 | 3300011119 | Bacteria | 4122 |
| 158 | Ga0157375_10018181 | 3300013308 | Bacteria | 6370 |
| 159 | Ga0163163_10015742 | 3300014325 | Bacteria | 7003 |
| 160 | Ga0163163_10270488 | 3300014325 | Bacteria | 1751 |
| 161 | Ga0157380_10003886 | 3300014326 | Bacteria | 10304 |
| 162 | Ga0157380_10007439 | 3300014326 | Bacteria | 7775 |
| 163 | Ga0157380_10058997 | 3300014326 | Bacteria | 3061 |
| 164 | Ga0157380_10226727 | 3300014326 | Bacteria | 1675 |
| 165 | Ga0157377_10015219 | 3300014745 | Bacteria | 3929 |
| 166 | Ga0157379_10003739 | 3300014968 | Bacteria | 12939 |
| 167 | Ga0157379_10013864 | 3300014968 | Bacteria | 7066 |
| 168 | Ga0157379_10026994 | 3300014968 | Bacteria | 5110 |
| 169 | Ga0157379_10037352 | 3300014968 | Bacteria | 4330 |
| 170 | Ga0157376_10009597 | 3300014969 | Bacteria | 7038 |
| 171 | Ga0157376_10057545 | 3300014969 | Bacteria | 3253 |
| 172 | Ga0207697_10001514 | 3300025315 | Bacteria | 12621 |
| 173 | Ga0207682_10001841 | 3300025893 | Bacteria | 9661 |
| 174 | Ga0207688_10001443 | 3300025901 | Bacteria | 12425 |
| 175 | Ga0207680_10049789 | 3300025903 | Bacteria | 2496 |
| 176 | Ga0207645_10002829 | 3300025907 | Bacteria | 13470 |
| 177 | Ga0207643_10020319 | 3300025908 | Bacteria | 3644 |
| 178 | Ga0207705_10090377 | 3300025909 | Bacteria | 2241 |
| 179 | Ga0207662_10002054 | 3300025918 | Bacteria | 9973 |
| 180 | Ga0207662_10002248 | 3300025918 | Bacteria | 9648 |
| 181 | Ga0207657_10093963 | 3300025919 | Bacteria | 2497 |
| 182 | Ga0207652_10018662 | 3300025921 | Bacteria | 5692 |
| 183 | Ga0207646_10053917 | 3300025922 | Bacteria | 3597 |
| 184 | Ga0207646_10064569 | 3300025922 | Bacteria | 3268 |
| 185 | Ga0207646_10079753 | 3300025922 | Bacteria | 2927 |
| 186 | Ga0207681_10023762 | 3300025923 | Bacteria | 3925 |
| 187 | Ga0207681_10140167 | 3300025923 | Bacteria | 1800 |
| 188 | Ga0207659_10005636 | 3300025926 | Bacteria | 7615 |
| 189 | Ga0207687_10014295 | 3300025927 | Bacteria | 5193 |
| 190 | Ga0207644_10037261 | 3300025931 | Bacteria | 3420 |
| 191 | Ga0207690_10035132 | 3300025932 | Bacteria | 3235 |
| 192 | Ga0207686_10014004 | 3300025934 | Bacteria | 4453 |
| 193 | Ga0207670_10051307 | 3300025936 | Bacteria | 2769 |
| 194 | Ga0207669_10001529 | 3300025937 | Bacteria | 9860 |
| 195 | Ga0207704_10031756 | 3300025938 | Bacteria | 2979 |
| 196 | Ga0207704_10066093 | 3300025938 | Bacteria | 2268 |
| 197 | Ga0207691_10005705 | 3300025940 | Bacteria | 12037 |
| 198 | Ga0207711_10022416 | 3300025941 | Bacteria | 5280 |
| 199 | Ga0207711_10031445 | 3300025941 | Bacteria | 4481 |
| 200 | Ga0207689_10000831 | 3300025942 | Bacteria | 29759 |
| 201 | Ga0207679_10032912 | 3300025945 | Bacteria | 3645 |
| 202 | Ga0207651_10001622 | 3300025960 | Bacteria | 10322 |
| 203 | Ga0207712_10002418 | 3300025961 | Bacteria | 12069 |
| 204 | Ga0207658_10022805 | 3300025986 | Bacteria | 4361 |
| 205 | Ga0207677_10021249 | 3300026023 | Bacteria | 3962 |
| 206 | Ga0207677_10056451 | 3300026023 | Bacteria | 2691 |
| 207 | Ga0207703_10006046 | 3300026035 | Bacteria | 9681 |
| 208 | Ga0207703_10167767 | 3300026035 | Bacteria | 1928 |
| 209 | Ga0207708_10000690 | 3300026075 | Bacteria | 25620 |
| 210 | Ga0207708_10002607 | 3300026075 | Bacteria | 13262 |
| 211 | Ga0207702_10138797 | 3300026078 | Bacteria | 2197 |
| 212 | Ga0207648_10001594 | 3300026089 | Bacteria | 24839 |
| 213 | Ga0207676_10080485 | 3300026095 | Bacteria | 2644 |
| 214 | Ga0207674_10043449 | 3300026116 | Bacteria | 4633 |
| 215 | Ga0207675_100001401 | 3300026118 | Bacteria | 24104 |
| 216 | Ga0207675_100004015 | 3300026118 | Bacteria | 14272 |
| 217 | Ga0207675_100045021 | 3300026118 | Bacteria | 4123 |
| 218 | Ga0207675_100070037 | 3300026118 | Bacteria | 3278 |
| 219 | Ga0207683_10019861 | 3300026121 | Bacteria | 5741 |
| 220 | Ga0207428_10002217 | 3300027907 | Bacteria | 19496 |
| 221 | Ga0207428_10003096 | 3300027907 | Bacteria | 16357 |
| 222 | Ga0207428_10008381 | 3300027907 | Bacteria | 9336 |
| 223 | Ga0268266_10005725 | 3300028379 | Bacteria | 11509 |
| 224 | Ga0268266_10051839 | 3300028379 | Bacteria | 3523 |
| 225 | Ga0268265_10018031 | 3300028380 | Bacteria | 4886 |
| 226 | Ga0268265_10049130 | 3300028380 | Bacteria | 3171 |
| 227 | Ga0268265_10066118 | 3300028380 | Bacteria | 2793 |
| 228 | Ga0268265_10094318 | 3300028380 | Bacteria | 2400 |
| 229 | Ga0268265_10156747 | 3300028380 | Bacteria | 1928 |
| 230 | Ga0265330_10000034 | 3300031235 | Bacteria | 123933 |
| 231 | Ga0265332_10000236 | 3300031238 | Bacteria | 44137 |
| 232 | Ga0265316_10000057 | 3300031344 | Bacteria | 119213 |
| 233 | Ga0307408_100035547 | 3300031548 | Bacteria | 3497 |
| 234 | Ga0316575_10021295 | 3300031665 | Bacteria | 2494 |
| 235 | Ga0316579_10002456 | 3300031691 | Bacteria | 7003 |
| 236 | Ga0265314_10000039 | 3300031711 | Bacteria | 220957 |
| 237 | Ga0265342_10000475 | 3300031712 | Bacteria | 43531 |
| 238 | Ga0316578_10002726 | 3300031728 | Bacteria | 7857 |
| 239 | Ga0307405_10015488 | 3300031731 | Bacteria | 4132 |
| 240 | Ga0316577_10003699 | 3300031733 | Bacteria | 7783 |
| 241 | Ga0307406_10014542 | 3300031901 | Bacteria | 4532 |
| 242 | Ga0307407_10004539 | 3300031903 | Bacteria | 5910 |
| 243 | Ga0307416_100187770 | 3300032002 | Bacteria | 1945 |
| 244 | Ga0307416_100273766 | 3300032002 | Bacteria | 1659 |
| 245 | Ga0307416_100294025 | 3300032002 | Bacteria | 1610 |
| 246 | Ga0307414_10156696 | 3300032004 | Bacteria | 1804 |
| 247 | Ga0307411_10008301 | 3300032005 | Bacteria | 5367 |
| 248 | Ga0307411_10047981 | 3300032005 | Bacteria | 2764 |
| 249 | Ga0307411_10205608 | 3300032005 | Bacteria | 1516 |
| 250 | Ga0307415_100009527 | 3300032126 | Bacteria | 5450 |
| 251 | Ga0316583_10000796 | 3300032133 | Bacteria | 9934 |
| 252 | Ga0316585_10001922 | 3300032137 | Bacteria | 5549 |
| 253 | Ga0373948_0007332 | 3300034817 | Bacteria | 1852 |
| 254 | Ga0373940_0002102 | 3300035088 | Bacteria | 3793 |
| 255 | Ga0373949_0007478 | 3300035090 | Bacteria | 2392 |
| 256 | Ga0373952_0014519 | 3300035092 | Bacteria | 1578 |
| 257 | Ga0373932_0015582 | 3300035112 | Bacteria | 1928 |
| 258 | Ga0373961_0006165 | 3300035241 | Bacteria | 2881 |
| 259 | Ga0373931_0022676 | 3300035691 | Bacteria | 3162 |
| 260 | Ga0373937_0095996 | 3300036401 | Bacteria | 2749 |
| 261 | Ga0316582_0001195 | 3300036647 | Bacteria | 11141 |
| 262 | Ga0395905_0040669 | 3300037471 | Bacteria | 4362 |
| 263 | Ga0439450_000447 | 3300042008 | Bacteria | 5354 |
| 264 | Ga0439460_0014685 | 3300042461 | Bacteria | 2060 |
| 265 | Ga0453684_0088249 | 3300044712 | Bacteria | 3840 |
| 266 | Ga0451576_0047449 | 3300045051 | Bacteria | 4516 |
| 267 | Ga0451576_0253696 | 3300045051 | Bacteria | 1838 |
| 268 | Ga0495629_0186616 | 3300046459 | Bacteria | 1436 |
| 269 | Ga0495658_0127590 | 3300046683 | Bacteria | 1545 |
| 270 | Ga0496100_0003996 | 3300048903 | Bacteria | 7755 |
| 271 | Ga0496104_0031178 | 3300048907 | Bacteria | 4957 |
| 272 | Ga0496105_0122966 | 3300048908 | Bacteria | 2140 |
| 273 | Ga0496107_0099798 | 3300048910 | Bacteria | 2128 |
| 274 | Ga0496108_0054911 | 3300048911 | Bacteria | 3343 |
| 275 | Ga0496112_0014053 | 3300048915 | Bacteria | 7411 |
| 276 | Ga0496112_0080596 | 3300048915 | Bacteria | 3219 |
| 277 | Ga0496113_0090843 | 3300048916 | Bacteria | 2353 |
| 278 | Ga0496114_0007297 | 3300048917 | Bacteria | 8730 |
| 279 | Ga0501032_0075152 | 3300049569 | Unclassified | 2250 |
| 280 | Ga0501034_0062838 | 3300049571 | Bacteria | 3728 |
| 281 | Ga0501034_0089402 | 3300049571 | Bacteria | 3078 |
| 282 | Ga0501036_0153024 | 3300049572 | Unclassified | 1945 |
| 283 | Ga0501038_0010451 | 3300049574 | Bacteria | 8490 |
| 284 | Ga0501041_0005261 | 3300049577 | Bacteria | 7561 |
| 285 | Ga0501042_0015069 | 3300049578 | Bacteria | 5287 |
| 286 | Ga0501046_0032638 | 3300049580 | Bacteria | 4215 |
| 287 | Ga0501046_0184558 | 3300049580 | Bacteria | 1558 |
| 288 | Ga0501047_0076323 | 3300049581 | Bacteria | 3225 |
| 289 | Ga0501047_0100838 | 3300049581 | Bacteria | 2766 |
| 290 | Ga0501048_0019441 | 3300049582 | Bacteria | 4983 |
| 291 | Ga0501048_0046252 | 3300049582 | Bacteria | 3107 |
| 292 | Ga0501048_0069226 | 3300049582 | Bacteria | 2493 |
| 293 | Ga0501048_0082864 | 3300049582 | Bacteria | 2262 |
| 294 | Ga0501071_0187571 | 3300049587 | Bacteria | 1550 |
| 295 | Ga0501075_0006302 | 3300049591 | Bacteria | 8152 |
| 296 | Ga0501075_0043267 | 3300049591 | Bacteria | 3378 |
| 297 | Ga0501076_0030415 | 3300049592 | Bacteria | 4206 |
| 298 | Ga0501076_0264585 | 3300049592 | Bacteria | 1408 |
| 299 | Ga0501079_0071641 | 3300049741 | Bacteria | 2678 |
| 300 | Ga0501080_0043835 | 3300049742 | Bacteria | 4166 |
| 301 | Ga0501080_0127622 | 3300049742 | Bacteria | 2355 |
| 302 | Ga0501081_0011827 | 3300049743 | Bacteria | 5716 |
| 303 | Ga0501045_0028727 | 3300049824 | Bacteria | 4013 |
| 304 | Ga0501045_0103943 | 3300049824 | Bacteria | 2104 |
| 305 | nmdc:mga03683_28234_c1 | 3300050489 | Bacteria | 2230 |
| 306 | nmdc:mga00v17_2954_c1 | 3300050491 | Bacteria | 8726 |
| 307 | nmdc:mga00v17_77518_c1 | 3300050491 | Bacteria | 2069 |
| 308 | nmdc:mga0k408_19012_c1 | 3300050493 | Bacteria | 3835 |
| 309 | nmdc:mga05p37_181794_c1 | 3300050507 | Bacteria | 2558 |
| 310 | nmdc:mga05p37_1909_c1 | 3300050507 | Bacteria | 24257 |
| 311 | nmdc:mga05p37_20228_c1 | 3300050507 | Bacteria | 4619 |
| 312 | nmdc:mga05p37_4985_c1 | 3300050507 | Bacteria | 15559 |
| 313 | nmdc:mga05p37_50248_c1 | 3300050507 | Bacteria | 5128 |
| 314 | nmdc:mga05p37_61833_c1 | 3300050507 | Bacteria | 4609 |
| 315 | nmdc:mga05p37_8400_c1 | 3300050507 | Bacteria | 12208 |
| 316 | nmdc:mga09592_11592_c1 | 3300050508 | Bacteria | 7169 |
| 317 | nmdc:mga09592_127930_c1 | 3300050508 | Bacteria | 2184 |
| 318 | nmdc:mga0qj67_22171_c1 | 3300050509 | Bacteria | 4876 |
| 319 | nmdc:mga0qj67_42209_c1 | 3300050509 | Bacteria | 3590 |
| 320 | nmdc:mga06r32_111270_c1 | 3300050510 | Bacteria | 2695 |
| 321 | nmdc:mga06r32_78722_c1 | 3300050510 | Bacteria | 3205 |
| 322 | nmdc:mga08y16_119311_c1 | 3300050511 | Bacteria | 2745 |
| 323 | nmdc:mga08y16_12914_c1 | 3300050511 | Bacteria | 8786 |
| 324 | nmdc:mga08y16_142330_c1 | 3300050511 | Bacteria | 2493 |
| 325 | nmdc:mga08y16_2853_c1 | 3300050511 | Bacteria | 17774 |
| 326 | nmdc:mga08y16_34682_c1 | 3300050511 | Bacteria | 5301 |
| 327 | nmdc:mga08y16_99414_c1 | 3300050511 | Bacteria | 3029 |
| 328 | nmdc:mga0n895_39130_c1 | 3300050512 | Bacteria | 4599 |
| 329 | nmdc:mga0n895_81489_c1 | 3300050512 | Bacteria | 3225 |
| 330 | nmdc:mga0n895_86419_c1 | 3300050512 | Bacteria | 3132 |
| 331 | nmdc:mga0n895_98608_c1 | 3300050512 | Bacteria | 2929 |
| 332 | nmdc:mga0rr50_21346_c1 | 3300050513 | Bacteria | 4419 |
| 333 | nmdc:mga0rr50_99718_c1 | 3300050513 | Bacteria | 2279 |
| 334 | nmdc:mga08x19_18998_c1 | 3300050514 | Bacteria | 3598 |
| 335 | nmdc:mga08x19_2140_c1 | 3300050514 | Bacteria | 12069 |
| 336 | nmdc:mga0a205_1497_c1 | 3300050515 | Bacteria | 19917 |
| 337 | nmdc:mga0a205_229907_c1 | 3300050515 | Bacteria | 1738 |
| 338 | nmdc:mga0a205_37160_c1 | 3300050515 | Bacteria | 4682 |
| 339 | nmdc:mga0a205_42998_c1 | 3300050515 | Bacteria | 4355 |
| 340 | nmdc:mga0a205_4601_c1 | 3300050515 | Bacteria | 12370 |
| 341 | nmdc:mga0a205_57897_c1 | 3300050515 | Bacteria | 3742 |
| 342 | nmdc:mga0a205_82700_c1 | 3300050515 | Bacteria | 3101 |
| 343 | Ga0500568_0001345 | 3300053139 | Bacteria | 16034 |
| 344 | Ga0501084_0130788 | 3300054114 | Bacteria | 2113 |
| 345 | Ga0501082_0195545 | 3300060353 | Bacteria | 1759 |
| 346 | Ga0530510_0029041 | 3300061734 | Bacteria | 3968 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031665 | Ga0316575_10021295 | Ga0316575_100212952 | 359 |
| 2 | 3300031691 | Ga0316579_10002456 | Ga0316579_100024563 | 359 |
| 3 | 3300031728 | Ga0316578_10002726 | Ga0316578_100027264 | 359 |
| 4 | 3300031733 | Ga0316577_10003699 | Ga0316577_100036994 | 359 |
| 5 | 3300032133 | Ga0316583_10000796 | Ga0316583_100007963 | 359 |
| 6 | 3300032137 | Ga0316585_10001922 | Ga0316585_100019225 | 359 |
| 7 | 3300036647 | Ga0316582_0001195 | Ga0316582_0001195_2008_3366 | 359 |
| 8 | 3300049581 | Ga0501047_0100838 | Ga0501047_0100838_355_1578 | 361 |
| 9 | 3300005546 | Ga0070696_100103607 | Ga0070696_1001036072 | 384 |
| 10 | 3300031235 | Ga0265330_10000034 | Ga0265330_1000003431 | 397 |
| 11 | 3300031238 | Ga0265332_10000236 | Ga0265332_1000023623 | 397 |
| 12 | 3300031344 | Ga0265316_10000057 | Ga0265316_1000005754 | 397 |
| 13 | 3300031711 | Ga0265314_10000039 | Ga0265314_10000039146 | 397 |
| 14 | 3300031712 | Ga0265342_10000475 | Ga0265342_100004752 | 397 |
| 15 | 3300007076 | Ga0075435_100123546 | Ga0075435_1001235462 | 401 |
| 16 | 3300044712 | Ga0453684_0088249 | Ga0453684_0088249_333_1727 | 402 |
| 17 | 3300006844 | Ga0075428_100082490 | Ga0075428_1000824902 | 407 |
| 18 | 3300006880 | Ga0075429_100052468 | Ga0075429_1000524683 | 407 |
| 19 | 3300009094 | Ga0111539_10001774 | Ga0111539_1000177425 | 407 |
| 20 | 3300009147 | Ga0114129_10029480 | Ga0114129_100294807 | 407 |
| 21 | 3300032002 | Ga0307416_100294025 | Ga0307416_1002940251 | 412 |
| 22 | 3300005438 | Ga0070701_10008615 | Ga0070701_100086155 | 413 |
| 23 | 3300009094 | Ga0111539_10007274 | Ga0111539_100072743 | 414 |
| 24 | 3300009147 | Ga0114129_10003079 | Ga0114129_100030795 | 414 |
| 25 | 3300014326 | Ga0157380_10226727 | Ga0157380_102267271 | 414 |
| 26 | 3300049578 | Ga0501042_0015069 | Ga0501042_0015069_1501_2808 | 414 |
| 27 | 3300049582 | Ga0501048_0019441 | Ga0501048_0019441_2471_3778 | 414 |
| 28 | 3300049587 | Ga0501071_0187571 | Ga0501071_0187571_25_1332 | 414 |
| 29 | 3300049591 | Ga0501075_0043267 | Ga0501075_0043267_83_1390 | 414 |
| 30 | 3300049824 | Ga0501045_0028727 | Ga0501045_0028727_2660_3967 | 414 |
| 31 | 3300050507 | nmdc:mga05p37_50248_c1 | nmdc:mga05p37_50248_c1_2479_3891 | 414 |
| 32 | 3300054114 | Ga0501084_0130788 | Ga0501084_0130788_272_1579 | 414 |
| 33 | 3300005331 | Ga0070670_100004731 | Ga0070670_1000047312 | 415 |
| 34 | 3300032002 | Ga0307416_100273766 | Ga0307416_1002737662 | 417 |
| 35 | 3300032004 | Ga0307414_10156696 | Ga0307414_101566962 | 417 |
| 36 | 3300032005 | Ga0307411_10047981 | Ga0307411_100479812 | 417 |
| 37 | 3300032126 | Ga0307415_100009527 | Ga0307415_1000095275 | 417 |
| 38 | 3300037471 | Ga0395905_0040669 | Ga0395905_0040669_2696_3973 | 417 |
| 39 | 3300031548 | Ga0307408_100035547 | Ga0307408_1000355473 | 418 |
| 40 | 3300031731 | Ga0307405_10015488 | Ga0307405_100154883 | 418 |
| 41 | 3300031901 | Ga0307406_10014542 | Ga0307406_100145423 | 418 |
| 42 | 3300031903 | Ga0307407_10004539 | Ga0307407_100045395 | 418 |
| 43 | 3300032005 | Ga0307411_10008301 | Ga0307411_100083015 | 418 |
| 44 | 3300050507 | nmdc:mga05p37_61833_c1 | nmdc:mga05p37_61833_c1_994_2511 | 418 |
| 45 | 3300050509 | nmdc:mga0qj67_22171_c1 | nmdc:mga0qj67_22171_c1_2614_4026 | 418 |
| 46 | 3300026118 | Ga0207675_100070037 | Ga0207675_1000700373 | 419 |
| 47 | 3300028380 | Ga0268265_10066118 | Ga0268265_100661183 | 419 |
| 48 | 3300050514 | nmdc:mga08x19_2140_c1 | nmdc:mga08x19_2140_c1_6784_8250 | 419 |
| 49 | 3300005468 | Ga0070707_100259460 | Ga0070707_1002594601 | 421 |
| 50 | 3300005444 | Ga0070694_100032804 | Ga0070694_1000328042 | 422 |
| 51 | 3300005468 | Ga0070707_100199367 | Ga0070707_1001993673 | 422 |
| 52 | 3300005545 | Ga0070695_100000481 | Ga0070695_1000004815 | 422 |
| 53 | 3300005546 | Ga0070696_100062422 | Ga0070696_1000624222 | 422 |
| 54 | 3300005549 | Ga0070704_100011670 | Ga0070704_1000116705 | 422 |
| 55 | 3300009093 | Ga0105240_10051976 | Ga0105240_100519766 | 422 |
| 56 | 3300009147 | Ga0114129_10010707 | Ga0114129_100107075 | 422 |
| 57 | 3300050507 | nmdc:mga05p37_1909_c1 | nmdc:mga05p37_1909_c1_22387_23808 | 422 |
| 58 | 3300050510 | nmdc:mga06r32_78722_c1 | nmdc:mga06r32_78722_c1_1717_3174 | 422 |
| 59 | 3300005458 | Ga0070681_10068998 | Ga0070681_100689984 | 423 |
| 60 | 3300005468 | Ga0070707_100064337 | Ga0070707_1000643374 | 423 |
| 61 | 3300005615 | Ga0070702_100005462 | Ga0070702_1000054625 | 423 |
| 62 | 3300025922 | Ga0207646_10079753 | Ga0207646_100797533 | 423 |
| 63 | 3300049592 | Ga0501076_0264585 | Ga0501076_0264585_26_1366 | 424 |
| 64 | 3300006844 | Ga0075428_100008690 | Ga0075428_10000869010 | 425 |
| 65 | 3300006844 | Ga0075428_100057629 | Ga0075428_1000576295 | 425 |
| 66 | 3300006846 | Ga0075430_100007940 | Ga0075430_10000794012 | 425 |
| 67 | 3300006846 | Ga0075430_100057396 | Ga0075430_1000573962 | 425 |
| 68 | 3300006847 | Ga0075431_100031624 | Ga0075431_1000316243 | 425 |
| 69 | 3300006847 | Ga0075431_100108235 | Ga0075431_1001082352 | 425 |
| 70 | 3300006880 | Ga0075429_100012552 | Ga0075429_1000125523 | 425 |
| 71 | 3300009147 | Ga0114129_10003085 | Ga0114129_100030858 | 425 |
| 72 | 3300049592 | Ga0501076_0030415 | Ga0501076_0030415_2138_3415 | 425 |
| 73 | 3300050491 | nmdc:mga00v17_77518_c1 | nmdc:mga00v17_77518_c1_44_1372 | 425 |
| 74 | 3300050508 | nmdc:mga09592_127930_c1 | nmdc:mga09592_127930_c1_585_2051 | 425 |
| 75 | 3300005328 | Ga0070676_10001436 | Ga0070676_100014369 | 426 |
| 76 | 3300005356 | Ga0070674_100001500 | Ga0070674_1000015009 | 426 |
| 77 | 3300005364 | Ga0070673_100067941 | Ga0070673_1000679413 | 426 |
| 78 | 3300005438 | Ga0070701_10003091 | Ga0070701_100030914 | 426 |
| 79 | 3300005440 | Ga0070705_100056891 | Ga0070705_1000568912 | 426 |
| 80 | 3300005441 | Ga0070700_100004777 | Ga0070700_1000047775 | 426 |
| 81 | 3300005444 | Ga0070694_100007724 | Ga0070694_1000077242 | 426 |
| 82 | 3300005456 | Ga0070678_100114816 | Ga0070678_1001148163 | 426 |
| 83 | 3300005545 | Ga0070695_100001237 | Ga0070695_1000012374 | 426 |
| 84 | 3300005549 | Ga0070704_100001748 | Ga0070704_1000017489 | 426 |
| 85 | 3300005719 | Ga0068861_100049827 | Ga0068861_1000498273 | 426 |
| 86 | 3300006881 | Ga0068865_100079258 | Ga0068865_1000792583 | 426 |
| 87 | 3300014326 | Ga0157380_10003886 | Ga0157380_1000388610 | 426 |
| 88 | 3300025907 | Ga0207645_10002829 | Ga0207645_100028299 | 426 |
| 89 | 3300025937 | Ga0207669_10001529 | Ga0207669_100015295 | 426 |
| 90 | 3300025938 | Ga0207704_10066093 | Ga0207704_100660933 | 426 |
| 91 | 3300026075 | Ga0207708_10002607 | Ga0207708_1000260711 | 426 |
| 92 | 3300026118 | Ga0207675_100001401 | Ga0207675_10000140114 | 426 |
| 93 | 3300048915 | Ga0496112_0080596 | Ga0496112_0080596_1309_2727 | 426 |
| 94 | 3300005353 | Ga0070669_100087623 | Ga0070669_1000876232 | 427 |
| 95 | 3300005365 | Ga0070688_100008035 | Ga0070688_1000080354 | 428 |
| 96 | 3300005335 | Ga0070666_10060375 | Ga0070666_100603752 | 429 |
| 97 | 3300005536 | Ga0070697_100169779 | Ga0070697_1001697792 | 429 |
| 98 | 3300005548 | Ga0070665_100031333 | Ga0070665_1000313332 | 429 |
| 99 | 3300025927 | Ga0207687_10014295 | Ga0207687_100142953 | 429 |
| 100 | 3300026023 | Ga0207677_10056451 | Ga0207677_100564512 | 429 |
| 101 | 3300028379 | Ga0268266_10051839 | Ga0268266_100518393 | 429 |
| 102 | 3300049571 | Ga0501034_0062838 | Ga0501034_0062838_777_2117 | 429 |
| 103 | 3300049581 | Ga0501047_0076323 | Ga0501047_0076323_1261_2709 | 429 |
| 104 | 3300049742 | Ga0501080_0043835 | Ga0501080_0043835_1461_2909 | 429 |
| 105 | 3300014969 | Ga0157376_10057545 | Ga0157376_100575453 | 430 |
| 106 | 3300006852 | Ga0075433_10159396 | Ga0075433_101593963 | 431 |
| 107 | 3300006871 | Ga0075434_100038568 | Ga0075434_1000385684 | 431 |
| 108 | 3300007076 | Ga0075435_100010574 | Ga0075435_1000105744 | 431 |
| 109 | 3300007076 | Ga0075435_100202810 | Ga0075435_1002028101 | 431 |
| 110 | 3300009553 | Ga0105249_10043919 | Ga0105249_100439193 | 431 |
| 111 | 3300032002 | Ga0307416_100187770 | Ga0307416_1001877702 | 431 |
| 112 | 3300050512 | nmdc:mga0n895_39130_c1 | nmdc:mga0n895_39130_c1_1287_2816 | 431 |
| 113 | 3300050512 | nmdc:mga0n895_86419_c1 | nmdc:mga0n895_86419_c1_1535_2947 | 431 |
| 114 | 3300050513 | nmdc:mga0rr50_21346_c1 | nmdc:mga0rr50_21346_c1_1402_2931 | 431 |
| 115 | 3300050515 | nmdc:mga0a205_37160_c1 | nmdc:mga0a205_37160_c1_1143_2564 | 431 |
| 116 | 3300005985 | Ga0081539_10074971 | Ga0081539_100749712 | 432 |
| 117 | 3300046683 | Ga0495658_0127590 | Ga0495658_0127590_127_1437 | 432 |
| 118 | 3300050493 | nmdc:mga0k408_19012_c1 | nmdc:mga0k408_19012_c1_45_1484 | 432 |
| 119 | 3300006177 | Ga0075362_10000801 | Ga0075362_1000080113 | 433 |
| 120 | 3300006195 | Ga0075366_10000530 | Ga0075366_1000053011 | 433 |
| 121 | 3300009093 | Ga0105240_10006418 | Ga0105240_100064188 | 433 |
| 122 | 3300045051 | Ga0451576_0253696 | Ga0451576_0253696_10_1332 | 433 |
| 123 | 3300050489 | nmdc:mga03683_28234_c1 | nmdc:mga03683_28234_c1_747_2186 | 433 |
| 124 | 3300050491 | nmdc:mga00v17_2954_c1 | nmdc:mga00v17_2954_c1_2205_3644 | 433 |
| 125 | 3300005330 | Ga0070690_100026105 | Ga0070690_1000261053 | 434 |
| 126 | 3300005338 | Ga0068868_100008101 | Ga0068868_1000081014 | 434 |
| 127 | 3300005457 | Ga0070662_100105371 | Ga0070662_1001053713 | 434 |
| 128 | 3300005618 | Ga0068864_100146741 | Ga0068864_1001467412 | 434 |
| 129 | 3300005841 | Ga0068863_100305578 | Ga0068863_1003055782 | 434 |
| 130 | 3300005842 | Ga0068858_100142128 | Ga0068858_1001421282 | 434 |
| 131 | 3300006881 | Ga0068865_100017474 | Ga0068865_1000174743 | 434 |
| 132 | 3300014326 | Ga0157380_10007439 | Ga0157380_100074397 | 434 |
| 133 | 3300014745 | Ga0157377_10015219 | Ga0157377_100152194 | 434 |
| 134 | 3300014968 | Ga0157379_10003739 | Ga0157379_100037392 | 434 |
| 135 | 3300006914 | Ga0075436_100008930 | Ga0075436_1000089302 | 435 |
| 136 | 3300050515 | nmdc:mga0a205_229907_c1 | nmdc:mga0a205_229907_c1_107_1504 | 435 |
| 137 | 3300006871 | Ga0075434_100064046 | Ga0075434_1000640462 | 436 |
| 138 | 3300009147 | Ga0114129_10006591 | Ga0114129_100065914 | 436 |
| 139 | 3300050507 | nmdc:mga05p37_4985_c1 | nmdc:mga05p37_4985_c1_8551_9987 | 436 |
| 140 | 3300050511 | nmdc:mga08y16_119311_c1 | nmdc:mga08y16_119311_c1_547_1959 | 436 |
| 141 | 3300050512 | nmdc:mga0n895_98608_c1 | nmdc:mga0n895_98608_c1_1309_2745 | 436 |
| 142 | 3300053139 | Ga0500568_0001345 | Ga0500568_0001345_5517_6911 | 436 |
| 143 | 3300025922 | Ga0207646_10064569 | Ga0207646_100645694 | 437 |
| 144 | 3300042461 | Ga0439460_0014685 | Ga0439460_0014685_411_1814 | 437 |
| 145 | 3300005353 | Ga0070669_100152861 | Ga0070669_1001528612 | 438 |
| 146 | 3300009094 | Ga0111539_10002665 | Ga0111539_1000266515 | 438 |
| 147 | 3300025923 | Ga0207681_10140167 | Ga0207681_101401672 | 438 |
| 148 | 3300005356 | Ga0070674_100005863 | Ga0070674_1000058635 | 439 |
| 149 | 3300006871 | Ga0075434_100192192 | Ga0075434_1001921922 | 439 |
| 150 | 3300009094 | Ga0111539_10078744 | Ga0111539_100787443 | 439 |
| 151 | 3300014326 | Ga0157380_10058997 | Ga0157380_100589973 | 439 |
| 152 | 3300050511 | nmdc:mga08y16_34682_c1 | nmdc:mga08y16_34682_c1_2770_4191 | 439 |
| 153 | 3300050511 | nmdc:mga08y16_99414_c1 | nmdc:mga08y16_99414_c1_1575_2942 | 439 |
| 154 | 3300050513 | nmdc:mga0rr50_99718_c1 | nmdc:mga0rr50_99718_c1_812_2215 | 439 |
| 155 | 3300006846 | Ga0075430_100011667 | Ga0075430_10001166710 | 440 |
| 156 | 3300006847 | Ga0075431_100004728 | Ga0075431_1000047287 | 440 |
| 157 | 3300009101 | Ga0105247_10015547 | Ga0105247_100155472 | 440 |
| 158 | 3300042008 | Ga0439450_000447 | Ga0439450_000447_1731_3152 | 440 |
| 159 | 3300050509 | nmdc:mga0qj67_42209_c1 | nmdc:mga0qj67_42209_c1_1558_2979 | 440 |
| 160 | 3300006237 | Ga0097621_100082623 | Ga0097621_1000826233 | 441 |
| 161 | 3300009176 | Ga0105242_10019944 | Ga0105242_100199444 | 441 |
| 162 | 3300025909 | Ga0207705_10090377 | Ga0207705_100903772 | 441 |
| 163 | 3300025921 | Ga0207652_10018662 | Ga0207652_100186625 | 441 |
| 164 | 3300048903 | Ga0496100_0003996 | Ga0496100_0003996_2989_4503 | 441 |
| 165 | 3300048907 | Ga0496104_0031178 | Ga0496104_0031178_1216_2730 | 441 |
| 166 | 3300048910 | Ga0496107_0099798 | Ga0496107_0099798_491_2005 | 441 |
| 167 | 3300048917 | Ga0496114_0007297 | Ga0496114_0007297_4880_6394 | 441 |
| 168 | 3300049571 | Ga0501034_0089402 | Ga0501034_0089402_1559_2893 | 441 |
| 169 | 3300009094 | Ga0111539_10180046 | Ga0111539_101800462 | 442 |
| 170 | 3300027907 | Ga0207428_10003096 | Ga0207428_100030967 | 442 |
| 171 | 3300050511 | nmdc:mga08y16_142330_c1 | nmdc:mga08y16_142330_c1_650_2071 | 442 |
| 172 | 3300014325 | Ga0163163_10270488 | Ga0163163_102704881 | 443 |
| 173 | 3300005435 | Ga0070714_100009663 | Ga0070714_1000096634 | 444 |
| 174 | 3300011119 | Ga0105246_10021871 | Ga0105246_100218713 | 444 |
| 175 | 3300026121 | Ga0207683_10019861 | Ga0207683_100198614 | 444 |
| 176 | 3300005456 | Ga0070678_100106710 | Ga0070678_1001067102 | 445 |
| 177 | 3300009094 | Ga0111539_10100266 | Ga0111539_101002663 | 445 |
| 178 | 3300050510 | nmdc:mga06r32_111270_c1 | nmdc:mga06r32_111270_c1_14_1420 | 445 |
| 179 | 3300027907 | Ga0207428_10008381 | Ga0207428_1000838110 | 446 |
| 180 | 3300049569 | Ga0501032_0075152 | Ga0501032_0075152_807_2168 | 446 |
| 181 | 3300049572 | Ga0501036_0153024 | Ga0501036_0153024_90_1451 | 446 |
| 182 | 3300049574 | Ga0501038_0010451 | Ga0501038_0010451_3595_4956 | 446 |
| 183 | 3300049577 | Ga0501041_0005261 | Ga0501041_0005261_2450_3811 | 446 |
| 184 | 3300049580 | Ga0501046_0032638 | Ga0501046_0032638_103_1464 | 446 |
| 185 | 3300049582 | Ga0501048_0082864 | Ga0501048_0082864_184_1545 | 446 |
| 186 | 3300050511 | nmdc:mga08y16_2853_c1 | nmdc:mga08y16_2853_c1_13144_14676 | 446 |
| 187 | 3300046459 | Ga0495629_0186616 | Ga0495629_0186616_23_1390 | 448 |
| 188 | 3300005334 | Ga0068869_100103482 | Ga0068869_1001034823 | 451 |
| 189 | 3300005343 | Ga0070687_100016036 | Ga0070687_1000160363 | 451 |
| 190 | 3300005353 | Ga0070669_100007108 | Ga0070669_1000071087 | 451 |
| 191 | 3300005367 | Ga0070667_100010567 | Ga0070667_1000105677 | 451 |
| 192 | 3300005456 | Ga0070678_100039934 | Ga0070678_1000399343 | 451 |
| 193 | 3300005459 | Ga0068867_100087249 | Ga0068867_1000872492 | 451 |
| 194 | 3300005548 | Ga0070665_100012196 | Ga0070665_1000121964 | 451 |
| 195 | 3300005577 | Ga0068857_100033732 | Ga0068857_1000337324 | 451 |
| 196 | 3300005617 | Ga0068859_100044995 | Ga0068859_1000449954 | 451 |
| 197 | 3300005617 | Ga0068859_100193992 | Ga0068859_1001939922 | 451 |
| 198 | 3300005719 | Ga0068861_100060837 | Ga0068861_1000608374 | 451 |
| 199 | 3300005843 | Ga0068860_100029873 | Ga0068860_1000298732 | 451 |
| 200 | 3300005844 | Ga0068862_100006547 | Ga0068862_1000065472 | 451 |
| 201 | 3300006358 | Ga0068871_100109241 | Ga0068871_1001092412 | 451 |
| 202 | 3300006852 | Ga0075433_10009188 | Ga0075433_100091887 | 451 |
| 203 | 3300006931 | Ga0097620_100044994 | Ga0097620_1000449944 | 451 |
| 204 | 3300006931 | Ga0097620_100193994 | Ga0097620_1001939942 | 451 |
| 205 | 3300009553 | Ga0105249_10001334 | Ga0105249_1000133414 | 451 |
| 206 | 3300013308 | Ga0157375_10018181 | Ga0157375_100181813 | 451 |
| 207 | 3300025315 | Ga0207697_10001514 | Ga0207697_1000151412 | 451 |
| 208 | 3300025893 | Ga0207682_10001841 | Ga0207682_1000184110 | 451 |
| 209 | 3300025901 | Ga0207688_10001443 | Ga0207688_100014437 | 451 |
| 210 | 3300025908 | Ga0207643_10020319 | Ga0207643_100203192 | 451 |
| 211 | 3300025918 | Ga0207662_10002054 | Ga0207662_100020545 | 451 |
| 212 | 3300025940 | Ga0207691_10005705 | Ga0207691_1000570512 | 451 |
| 213 | 3300025942 | Ga0207689_10000831 | Ga0207689_100008316 | 451 |
| 214 | 3300025945 | Ga0207679_10032912 | Ga0207679_100329122 | 451 |
| 215 | 3300025961 | Ga0207712_10002418 | Ga0207712_100024187 | 451 |
| 216 | 3300026116 | Ga0207674_10043449 | Ga0207674_100434492 | 451 |
| 217 | 3300026118 | Ga0207675_100004015 | Ga0207675_1000040157 | 451 |
| 218 | 3300027907 | Ga0207428_10002217 | Ga0207428_1000221716 | 451 |
| 219 | 3300028380 | Ga0268265_10018031 | Ga0268265_100180312 | 451 |
| 220 | 3300035088 | Ga0373940_0002102 | Ga0373940_0002102_2272_3675 | 451 |
| 221 | 3300035090 | Ga0373949_0007478 | Ga0373949_0007478_850_2253 | 451 |
| 222 | 3300035092 | Ga0373952_0014519 | Ga0373952_0014519_79_1482 | 451 |
| 223 | 3300035112 | Ga0373932_0015582 | Ga0373932_0015582_506_1909 | 451 |
| 224 | 3300035241 | Ga0373961_0006165 | Ga0373961_0006165_441_1844 | 451 |
| 225 | 3300035691 | Ga0373931_0022676 | Ga0373931_0022676_356_1759 | 451 |
| 226 | 3300050508 | nmdc:mga09592_11592_c1 | nmdc:mga09592_11592_c1_294_1697 | 451 |
| 227 | 3300050511 | nmdc:mga08y16_12914_c1 | nmdc:mga08y16_12914_c1_1169_2572 | 451 |
| 228 | 3300050512 | nmdc:mga0n895_81489_c1 | nmdc:mga0n895_81489_c1_737_2140 | 451 |
| 229 | 3300050515 | nmdc:mga0a205_1497_c1 | nmdc:mga0a205_1497_c1_8250_9653 | 451 |
| 230 | 3300005347 | Ga0070668_100152382 | Ga0070668_1001523821 | 452 |
| 231 | 3300005535 | Ga0070684_100035871 | Ga0070684_1000358715 | 452 |
| 232 | 3300005983 | Ga0081540_1063145 | Ga0081540_10631452 | 452 |
| 233 | 3300009147 | Ga0114129_10011496 | Ga0114129_100114968 | 452 |
| 234 | 3300050507 | nmdc:mga05p37_8400_c1 | nmdc:mga05p37_8400_c1_6860_8275 | 452 |
| 235 | 3300061734 | Ga0530510_0029041 | Ga0530510_0029041_612_2111 | 452 |
| 236 | 3300009147 | Ga0114129_10016775 | Ga0114129_1001677510 | 453 |
| 237 | 3300036401 | Ga0373937_0095996 | Ga0373937_0095996_364_1782 | 453 |
| 238 | 3300048908 | Ga0496105_0122966 | Ga0496105_0122966_241_1641 | 453 |
| 239 | 3300050507 | nmdc:mga05p37_20228_c1 | nmdc:mga05p37_20228_c1_1226_2674 | 453 |
| 240 | 3300050514 | nmdc:mga08x19_18998_c1 | nmdc:mga08x19_18998_c1_1466_2872 | 453 |
| 241 | 3300050515 | nmdc:mga0a205_82700_c1 | nmdc:mga0a205_82700_c1_89_1537 | 453 |
| 242 | 3300006881 | Ga0068865_100091677 | Ga0068865_1000916772 | 454 |
| 243 | 3300005328 | Ga0070676_10048646 | Ga0070676_100486463 | 456 |
| 244 | 3300005341 | Ga0070691_10066880 | Ga0070691_100668802 | 456 |
| 245 | 3300005441 | Ga0070700_100010283 | Ga0070700_1000102833 | 456 |
| 246 | 3300005578 | Ga0068854_100061997 | Ga0068854_1000619973 | 456 |
| 247 | 3300005616 | Ga0068852_100036771 | Ga0068852_1000367715 | 456 |
| 248 | 3300025918 | Ga0207662_10002248 | Ga0207662_100022486 | 456 |
| 249 | 3300025986 | Ga0207658_10022805 | Ga0207658_100228053 | 456 |
| 250 | 3300026035 | Ga0207703_10167767 | Ga0207703_101677672 | 456 |
| 251 | 3300026075 | Ga0207708_10000690 | Ga0207708_1000069014 | 456 |
| 252 | 3300005340 | Ga0070689_100011650 | Ga0070689_1000116506 | 457 |
| 253 | 3300005365 | Ga0070688_100020794 | Ga0070688_1000207943 | 457 |
| 254 | 3300025936 | Ga0207670_10051307 | Ga0207670_100513072 | 457 |
| 255 | 3300049580 | Ga0501046_0184558 | Ga0501046_0184558_88_1521 | 457 |
| 256 | 3300049582 | Ga0501048_0046252 | Ga0501048_0046252_723_2156 | 457 |
| 257 | 3300049591 | Ga0501075_0006302 | Ga0501075_0006302_3142_4575 | 457 |
| 258 | 3300049742 | Ga0501080_0127622 | Ga0501080_0127622_547_1980 | 457 |
| 259 | 3300049743 | Ga0501081_0011827 | Ga0501081_0011827_1624_3057 | 457 |
| 260 | 3300049824 | Ga0501045_0103943 | Ga0501045_0103943_45_1478 | 457 |
| 261 | 3300005518 | Ga0070699_100110895 | Ga0070699_1001108953 | 458 |
| 262 | 3300009177 | Ga0105248_10058431 | Ga0105248_100584312 | 458 |
| 263 | 3300045051 | Ga0451576_0047449 | Ga0451576_0047449_2957_4357 | 458 |
| 264 | 3300005336 | Ga0070680_100065511 | Ga0070680_1000655111 | 459 |
| 265 | 3300005440 | Ga0070705_100094391 | Ga0070705_1000943911 | 459 |
| 266 | 3300049582 | Ga0501048_0069226 | Ga0501048_0069226_865_2391 | 459 |
| 267 | 3300005339 | Ga0070660_100084783 | Ga0070660_1000847832 | 461 |
| 268 | 3300025919 | Ga0207657_10093963 | Ga0207657_100939632 | 461 |
| 269 | 3300025932 | Ga0207690_10035132 | Ga0207690_100351322 | 461 |
| 270 | 3300028379 | Ga0268266_10005725 | Ga0268266_1000572511 | 461 |
| 271 | 3300028380 | Ga0268265_10049130 | Ga0268265_100491302 | 461 |
| 272 | 3300032005 | Ga0307411_10205608 | Ga0307411_102056081 | 461 |
| 273 | iso_pu_bacteria | 2786546548 | 2787508844 | 461 |
| 274 | 3300005441 | Ga0070700_100044865 | Ga0070700_1000448652 | 462 |
| 275 | 3300005545 | Ga0070695_100045350 | Ga0070695_1000453503 | 462 |
| 276 | 3300005549 | Ga0070704_100081911 | Ga0070704_1000819112 | 462 |
| 277 | 3300005617 | Ga0068859_100001952 | Ga0068859_10000195219 | 462 |
| 278 | 3300005842 | Ga0068858_100026222 | Ga0068858_1000262224 | 462 |
| 279 | 3300006931 | Ga0097620_100001952 | Ga0097620_10000195219 | 462 |
| 280 | 3300014968 | Ga0157379_10037352 | Ga0157379_100373523 | 462 |
| 281 | 3300025922 | Ga0207646_10053917 | Ga0207646_100539173 | 462 |
| 282 | 3300025923 | Ga0207681_10023762 | Ga0207681_100237622 | 462 |
| 283 | 3300026118 | Ga0207675_100045021 | Ga0207675_1000450215 | 462 |
| 284 | 3300028380 | Ga0268265_10094318 | Ga0268265_100943183 | 462 |
| 285 | 3300034817 | Ga0373948_0007332 | Ga0373948_0007332_158_1591 | 462 |
| 286 | 3300048916 | Ga0496113_0090843 | Ga0496113_0090843_138_1604 | 462 |
| 287 | 3300005364 | Ga0070673_100007858 | Ga0070673_1000078585 | 464 |
| 288 | 3300009094 | Ga0111539_10002365 | Ga0111539_1000236521 | 464 |
| 289 | 3300009177 | Ga0105248_10078857 | Ga0105248_100788572 | 464 |
| 290 | 3300005456 | Ga0070678_100022786 | Ga0070678_1000227865 | 465 |
| 291 | 3300005842 | Ga0068858_100024924 | Ga0068858_1000249244 | 465 |
| 292 | 3300006852 | Ga0075433_10231963 | Ga0075433_102319631 | 465 |
| 293 | 3300009147 | Ga0114129_10061238 | Ga0114129_100612384 | 465 |
| 294 | 3300009553 | Ga0105249_10065938 | Ga0105249_100659383 | 465 |
| 295 | 3300026035 | Ga0207703_10006046 | Ga0207703_100060464 | 465 |
| 296 | 3300050515 | nmdc:mga0a205_57897_c1 | nmdc:mga0a205_57897_c1_564_2042 | 465 |
| 297 | 3300005331 | Ga0070670_100155880 | Ga0070670_1001558802 | 466 |
| 298 | 3300005338 | Ga0068868_100066063 | Ga0068868_1000660632 | 466 |
| 299 | 3300005530 | Ga0070679_100033013 | Ga0070679_1000330134 | 466 |
| 300 | 3300005563 | Ga0068855_100046860 | Ga0068855_1000468603 | 466 |
| 301 | 3300005614 | Ga0068856_100105637 | Ga0068856_1001056372 | 466 |
| 302 | 3300005618 | Ga0068864_100239193 | Ga0068864_1002391932 | 466 |
| 303 | 3300006237 | Ga0097621_100014512 | Ga0097621_1000145125 | 466 |
| 304 | 3300006871 | Ga0075434_100077864 | Ga0075434_1000778643 | 466 |
| 305 | 3300009176 | Ga0105242_10001388 | Ga0105242_1000138811 | 466 |
| 306 | 3300014968 | Ga0157379_10013864 | Ga0157379_100138642 | 466 |
| 307 | 3300014968 | Ga0157379_10026994 | Ga0157379_100269944 | 466 |
| 308 | 3300014969 | Ga0157376_10009597 | Ga0157376_100095974 | 466 |
| 309 | 3300025903 | Ga0207680_10049789 | Ga0207680_100497892 | 466 |
| 310 | 3300025934 | Ga0207686_10014004 | Ga0207686_100140044 | 466 |
| 311 | 3300025938 | Ga0207704_10031756 | Ga0207704_100317563 | 466 |
| 312 | 3300025941 | Ga0207711_10031445 | Ga0207711_100314452 | 466 |
| 313 | 3300026023 | Ga0207677_10021249 | Ga0207677_100212494 | 466 |
| 314 | 3300026078 | Ga0207702_10138797 | Ga0207702_101387973 | 466 |
| 315 | 3300049741 | Ga0501079_0071641 | Ga0501079_0071641_1078_2517 | 466 |
| 316 | 3300050515 | nmdc:mga0a205_42998_c1 | nmdc:mga0a205_42998_c1_422_1894 | 466 |
| 317 | 3300060353 | Ga0501082_0195545 | Ga0501082_0195545_125_1564 | 466 |
| 318 | 3300005330 | Ga0070690_100020851 | Ga0070690_1000208513 | 467 |
| 319 | 3300005334 | Ga0068869_100220671 | Ga0068869_1002206711 | 467 |
| 320 | 3300005338 | Ga0068868_100013300 | Ga0068868_1000133006 | 467 |
| 321 | 3300005340 | Ga0070689_100004875 | Ga0070689_1000048756 | 467 |
| 322 | 3300005355 | Ga0070671_100007176 | Ga0070671_1000071763 | 467 |
| 323 | 3300005364 | Ga0070673_100001513 | Ga0070673_1000015135 | 467 |
| 324 | 3300005367 | Ga0070667_100028673 | Ga0070667_1000286733 | 467 |
| 325 | 3300005438 | Ga0070701_10002082 | Ga0070701_1000208210 | 467 |
| 326 | 3300005459 | Ga0068867_100050891 | Ga0068867_1000508913 | 467 |
| 327 | 3300005549 | Ga0070704_100004766 | Ga0070704_1000047665 | 467 |
| 328 | 3300005842 | Ga0068858_100041409 | Ga0068858_1000414092 | 467 |
| 329 | 3300005844 | Ga0068862_100019606 | Ga0068862_1000196061 | 467 |
| 330 | 3300007076 | Ga0075435_100000706 | Ga0075435_1000007068 | 467 |
| 331 | 3300009177 | Ga0105248_10030068 | Ga0105248_100300682 | 467 |
| 332 | 3300014325 | Ga0163163_10015742 | Ga0163163_100157423 | 467 |
| 333 | 3300025926 | Ga0207659_10005636 | Ga0207659_100056364 | 467 |
| 334 | 3300025931 | Ga0207644_10037261 | Ga0207644_100372614 | 467 |
| 335 | 3300025941 | Ga0207711_10022416 | Ga0207711_100224164 | 467 |
| 336 | 3300025960 | Ga0207651_10001622 | Ga0207651_100016222 | 467 |
| 337 | 3300026089 | Ga0207648_10001594 | Ga0207648_1000159426 | 467 |
| 338 | 3300026095 | Ga0207676_10080485 | Ga0207676_100804853 | 467 |
| 339 | 3300028380 | Ga0268265_10156747 | Ga0268265_101567473 | 467 |
| 340 | 3300048911 | Ga0496108_0054911 | Ga0496108_0054911_1591_3090 | 467 |
| 341 | 3300048915 | Ga0496112_0014053 | Ga0496112_0014053_3372_4871 | 467 |
| 342 | 3300050515 | nmdc:mga0a205_4601_c1 | nmdc:mga0a205_4601_c1_8998_10518 | 467 |
| 343 | 3300009147 | Ga0114129_10164829 | Ga0114129_101648293 | 468 |
| 344 | 3300009177 | Ga0105248_10207244 | Ga0105248_102072442 | 468 |
| 345 | 3300050507 | nmdc:mga05p37_181794_c1 | nmdc:mga05p37_181794_c1_137_1624 | 468 |
| 346 | 3300005366 | Ga0070659_100041428 | Ga0070659_1000414283 | 469 |
| 347 | 3300005295 | Ga0065707_10085306 | Ga0065707_100853067 | 488 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z6k-assembly1.cif.gz_A | crystal structure of full-length human rpa14/32 heterodimer | 0.8574 | 66 | 143 |
| 1l1o-assembly1.cif.gz_E | structure of the human replication protein a (rpa) trimerization core | 0.8513 | 66 | 142 |
| 2pi2-assembly3.cif.gz_C | full-length replication protein a subunits rpa14 and rpa32 | 0.8409 | 66 | 142 |
| 2pqa-assembly1.cif.gz_A | crystal structure of full-length human rpa 14/32 heterodimer | 0.8406 | 64 | 142 |
| 4h02-assembly4.cif.gz_G | crystal structure of p. falciparum lysyl-trna synthetase | 0.8266 | 66 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P04994_10_103_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9904 | 47 | 140 | 2.40.50.140 |
| af_P04994_10_103_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9801 | 47 | 140 | 2.40.50.140 |
| af_Q2FY46_5_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9762 | 47 | 140 | 2.40.50.140 |
| af_Q2FY46_5_100_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9465 | 47 | 140 | 2.40.50.140 |
| af_P9WF31_10_105_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8757 | 47 | 140 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1AAC6-F1-model_v4 | Exonuclease VII, large subunit (EC 3.1.11.6) | 0.9863 | 148 | 300 |
GO:0006308
GO:0008855 GO:0009318 |
| AF-A0A2X1KF80-F1-model_v4 | Exodeoxyribonuclease 7 large subunit (EC 3.1.11.6) | 0.9773 | 66 | 143 |
GO:0003676
GO:0006308 GO:0008855 GO:0009318 |
| AF-Q71IW7-F1-model_v4 | Exodeoxyribonuclease VII large subunit (EC 3.1.11.6) | 0.9727 | 161 | 300 |
GO:0006308
GO:0008855 GO:0009318 |
| AF-A0A6L5EKV6-F1-model_v4 | Exodeoxyribonuclease VII large subunit | 0.9671 | 193 | 293 |
GO:0006308
GO:0008855 GO:0009318 |
| AF-A0A656K7M2-F1-model_v4 | deleted | 0.9661 | 164 | 327 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar