F417181

General Info

Members Datasets Scaffolds Average Seq Length
347 152 694 279

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10235464|Ga0207702_102354642
Length 325
Sequence MTQAPQLPAPTWFVGCGNMGRAILDGWRGAGISLEPIVVVDPAKPAIDGVKRAATPAEAGPAPKLVILGVKPQMIDEVAGQLKTWLTSKTVVVSLLVGVEAASLRQRLPKAGPIVRALPNLPVAVRRGVVALFSDEADEAVRQQLANLFAPLGFAPWMADEAKLAAVGSVAGAGPAYVARFIAALAKAGEKRGLSEEIASTVALETVLGTAWLAAAKGEDHVVAIRKLDYGRGLTHNVKFYPNMAAWNVEERQLRSLGADDYLTRDVYQRMHFPPTGVDQLLARLEAEAKSTSKLKDVLKRVKAVAYPHIAKAFDLLHKKESVAA

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.32
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 1.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10235464 3300026078 Bacteria 1713
2 JGI24737J22298_10000281 3300001990 Bacteria 16865
3 JGI24744J21845_10003311 3300002077 Bacteria 3308
4 rootH2_10093800 3300003320 Unclassified 1237
5 Ga0070658_10126872 3300005327 Bacteria 2124
6 Ga0070658_10403723 3300005327 Bacteria 1174
7 Ga0070658_10618193 3300005327 Unclassified 939
8 Ga0070676_10003383 3300005328 Bacteria 8303
9 Ga0070690_100064884 3300005330 Bacteria 2360
10 Ga0070670_100053046 3300005331 Bacteria 3482
11 Ga0070670_100100941 3300005331 Bacteria 2484
12 Ga0068869_100000385 3300005334 Bacteria 23972
13 Ga0068868_100001184 3300005338 Bacteria 17874
14 Ga0068868_100006311 3300005338 Bacteria 8380
15 Ga0068868_100034935 3300005338 Bacteria 3883
16 Ga0070660_100011437 3300005339 Bacteria 6305
17 Ga0070660_100052226 3300005339 Bacteria 3151
18 Ga0070660_100078132 3300005339 Bacteria 2595
19 Ga0070689_100099774 3300005340 Bacteria 2297
20 Ga0070661_100009694 3300005344 Bacteria 6680
21 Ga0070661_100188452 3300005344 Bacteria 1572
22 Ga0070661_100288297 3300005344 Bacteria 1275
23 Ga0070661_100382504 3300005344 Bacteria 1110
24 Ga0070692_10026792 3300005345 Bacteria 2852
25 Ga0070692_10031615 3300005345 Bacteria 2654
26 Ga0070669_100000643 3300005353 Bacteria 25821
27 Ga0070675_100056674 3300005354 Bacteria 3230
28 Ga0070671_100000784 3300005355 Bacteria 22894
29 Ga0070671_100012172 3300005355 Bacteria 6923
30 Ga0070671_100017658 3300005355 Bacteria 5781
31 Ga0070671_100117846 3300005355 Bacteria 2233
32 Ga0070674_100007764 3300005356 Bacteria 6340
33 Ga0070674_100026500 3300005356 Bacteria 3788
34 Ga0070673_100000663 3300005364 Bacteria 18945
35 Ga0070673_100012465 3300005364 Bacteria 5838
36 Ga0070673_100080383 3300005364 Bacteria 2641
37 Ga0070673_100340937 3300005364 Bacteria 1328
38 Ga0070659_100000382 3300005366 Bacteria 33581
39 Ga0070659_100007320 3300005366 Bacteria 8018
40 Ga0070659_100023443 3300005366 Bacteria 4722
41 Ga0070659_100076285 3300005366 Bacteria 2673
42 Ga0070659_100625964 3300005366 Unclassified 926
43 Ga0070667_100000520 3300005367 Bacteria 38650
44 Ga0070667_100001684 3300005367 Bacteria 19770
45 Ga0070667_100021677 3300005367 Bacteria 5332
46 Ga0070714_100046739 3300005435 Bacteria 3673
47 Ga0070713_100121090 3300005436 Bacteria 2295
48 Ga0070663_100009586 3300005455 Bacteria 6002
49 Ga0070663_100171476 3300005455 Bacteria 1677
50 Ga0070663_100253462 3300005455 Bacteria 1394
51 Ga0070678_100045766 3300005456 Bacteria 3132
52 Ga0070678_100101928 3300005456 Bacteria 2226
53 Ga0070662_100000975 3300005457 Bacteria 17516
54 Ga0070662_100119834 3300005457 Bacteria 2016
55 Ga0070662_100194338 3300005457 Bacteria 1607
56 Ga0070662_100478886 3300005457 Bacteria 1036
57 Ga0070681_10083231 3300005458 Bacteria 3153
58 Ga0070681_10254279 3300005458 Bacteria 1669
59 Ga0068867_100001073 3300005459 Bacteria 18682
60 Ga0068867_100003113 3300005459 Bacteria 11699
61 Ga0068867_100200753 3300005459 Bacteria 1596
62 Ga0068867_100215668 3300005459 Bacteria 1544
63 Ga0070679_100060450 3300005530 Bacteria 3776
64 Ga0070679_100297633 3300005530 Bacteria 1564
65 Ga0068853_100002970 3300005539 Bacteria 12921
66 Ga0068853_100159576 3300005539 Bacteria 2034
67 Ga0068853_100522991 3300005539 Bacteria 1122
68 Ga0068853_100524662 3300005539 Bacteria 1120
69 Ga0070672_100000342 3300005543 Bacteria 26866
70 Ga0070672_100009142 3300005543 Bacteria 6817
71 Ga0070672_100104878 3300005543 Bacteria 2297
72 Ga0070696_100093521 3300005546 Bacteria 2144
73 Ga0070696_100311333 3300005546 Bacteria 1209
74 Ga0070665_100735655 3300005548 Bacteria 999
75 Ga0068855_100147109 3300005563 Bacteria 2681
76 Ga0068855_100160912 3300005563 Bacteria 2548
77 Ga0070664_100003562 3300005564 Bacteria 12573
78 Ga0070664_100003589 3300005564 Bacteria 12514
79 Ga0070664_100025245 3300005564 Bacteria 4923
80 Ga0070664_100063791 3300005564 Bacteria 3141
81 Ga0070664_100206938 3300005564 Bacteria 1753
82 Ga0070664_100388530 3300005564 Bacteria 1275
83 Ga0068857_100003686 3300005577 Bacteria 12845
84 Ga0068857_100013620 3300005577 Bacteria 7085
85 Ga0068857_100057141 3300005577 Bacteria 3463
86 Ga0068857_100222495 3300005577 Bacteria 1724
87 Ga0068854_100000376 3300005578 Bacteria 28529
88 Ga0068854_100037487 3300005578 Bacteria 3404
89 Ga0068854_100041469 3300005578 Bacteria 3252
90 Ga0068856_100060780 3300005614 Bacteria 3732
91 Ga0068856_100222800 3300005614 Bacteria 1901
92 Ga0068856_100554766 3300005614 Bacteria 1170
93 Ga0068852_100001271 3300005616 Bacteria 16839
94 Ga0068852_100035005 3300005616 Bacteria 4184
95 Ga0068852_100085184 3300005616 Bacteria 2815
96 Ga0068852_100213373 3300005616 Bacteria 1832
97 Ga0068852_100233571 3300005616 Bacteria 1754
98 Ga0068859_100000982 3300005617 Bacteria 29213
99 Ga0068859_100061841 3300005617 Bacteria 3774
100 Ga0068859_100835255 3300005617 Bacteria 1008
101 Ga0068864_100000982 3300005618 Bacteria 23872
102 Ga0068864_100090916 3300005618 Bacteria 2691
103 Ga0068866_10021291 3300005718 Bacteria 2986
104 Ga0068851_10019419 3300005834 Bacteria 3284
105 Ga0068851_10020215 3300005834 Bacteria 3221
106 Ga0068851_10039368 3300005834 Bacteria 2373
107 Ga0068851_10040198 3300005834 Bacteria 2350
108 Ga0068863_100000871 3300005841 Bacteria 30229
109 Ga0068863_100050676 3300005841 Bacteria 3935
110 Ga0068858_100006590 3300005842 Bacteria 11297
111 Ga0068858_100014737 3300005842 Bacteria 7358
112 Ga0068858_100074533 3300005842 Bacteria 3151
113 Ga0068858_100467926 3300005842 Bacteria 1216
114 Ga0068860_100001576 3300005843 Bacteria 24578
115 Ga0068860_100029748 3300005843 Bacteria 5255
116 Ga0068860_100396052 3300005843 Bacteria 1365
117 Ga0068860_100523611 3300005843 Bacteria 1186
118 Ga0070712_100022733 3300006175 Bacteria 4134
119 Ga0068871_100033491 3300006358 Bacteria 4069
120 Ga0068865_100062669 3300006881 Bacteria 2611
121 Ga0097620_100000982 3300006931 Bacteria 29213
122 Ga0097620_100061841 3300006931 Bacteria 3774
123 Ga0097620_100835195 3300006931 Bacteria 1008
124 Ga0105240_10386554 3300009093 Bacteria 1579
125 Ga0105245_10000657 3300009098 Bacteria 31348
126 Ga0105243_10408716 3300009148 Bacteria 1263
127 Ga0105243_10595597 3300009148 Bacteria 1063
128 Ga0105242_10242812 3300009176 Bacteria 1620
129 Ga0105248_10000394 3300009177 Bacteria 50466
130 Ga0105248_10099823 3300009177 Bacteria 3271
131 Ga0105248_10147111 3300009177 Bacteria 2659
132 Ga0105248_10215831 3300009177 Bacteria 2161
133 Ga0105238_10056084 3300009551 Bacteria 3953
134 Ga0105239_10355211 3300010375 Bacteria 1655
135 Ga0157373_10019651 3300013100 Bacteria 4914
136 Ga0157371_10432766 3300013102 Bacteria 965
137 Ga0157370_10037567 3300013104 Bacteria 4694
138 Ga0157369_10069784 3300013105 Bacteria 3775
139 Ga0157369_10106226 3300013105 Bacteria 2988
140 Ga0157369_10765102 3300013105 Bacteria 993
141 Ga0157374_10009602 3300013296 Bacteria 8311
142 Ga0157374_10251873 3300013296 Bacteria 1738
143 Ga0157374_10820869 3300013296 Unclassified 946
144 Ga0157378_10078427 3300013297 Bacteria 2979
145 Ga0163162_10057255 3300013306 Bacteria 3926
146 Ga0163162_10129828 3300013306 Bacteria 2628
147 Ga0163162_10164961 3300013306 Bacteria 2339
148 Ga0157375_10040319 3300013308 Bacteria 4501
149 Ga0157375_10065348 3300013308 Bacteria 3626
150 Ga0157375_10124911 3300013308 Bacteria 2687
151 Ga0157375_10191301 3300013308 Bacteria 2201
152 Ga0163163_10604240 3300014325 Bacteria 1160
153 Ga0157379_10464509 3300014968 Bacteria 1170
154 Ga0157379_10606740 3300014968 Bacteria 1022
155 Ga0213875_10011631 3300021388 Bacteria 4374
156 Ga0207697_10090484 3300025315 Bacteria 1297
157 Ga0207656_10070720 3300025321 Bacteria 1550
158 Ga0207642_10019942 3300025899 Bacteria 2607
159 Ga0207688_10014674 3300025901 Bacteria 4255
160 Ga0207680_10002980 3300025903 Bacteria 7937
161 Ga0207680_10004835 3300025903 Bacteria 6409
162 Ga0207699_10039494 3300025906 Bacteria 2712
163 Ga0207645_10063666 3300025907 Bacteria 2357
164 Ga0207645_10063753 3300025907 Bacteria 2355
165 Ga0207645_10066096 3300025907 Bacteria 2312
166 Ga0207645_10090333 3300025907 Bacteria 1969
167 Ga0207645_10146768 3300025907 Bacteria 1538
168 Ga0207705_10004032 3300025909 Bacteria 11168
169 Ga0207705_10022260 3300025909 Bacteria 4521
170 Ga0207705_10028904 3300025909 Bacteria 3952
171 Ga0207705_10107412 3300025909 Bacteria 2059
172 Ga0207705_10164639 3300025909 Bacteria 1667
173 Ga0207705_10424595 3300025909 Bacteria 1029
174 Ga0207707_10271882 3300025912 Bacteria 1468
175 Ga0207707_10364136 3300025912 Bacteria 1244
176 Ga0207671_10454050 3300025914 Bacteria 1021
177 Ga0207693_10062291 3300025915 Bacteria 2922
178 Ga0207660_10023500 3300025917 Bacteria 4164
179 Ga0207662_10010077 3300025918 Bacteria 5209
180 Ga0207657_10016327 3300025919 Bacteria 7163
181 Ga0207657_10031009 3300025919 Bacteria 4847
182 Ga0207657_10048010 3300025919 Bacteria 3729
183 Ga0207657_10056867 3300025919 Bacteria 3373
184 Ga0207657_10077247 3300025919 Bacteria 2807
185 Ga0207657_10084926 3300025919 Bacteria 2652
186 Ga0207657_10104257 3300025919 Bacteria 2349
187 Ga0207657_10166725 3300025919 Bacteria 1786
188 Ga0207649_10144580 3300025920 Bacteria 1631
189 Ga0207649_10247291 3300025920 Bacteria 1283
190 Ga0207649_10305866 3300025920 Bacteria 1164
191 Ga0207694_10311514 3300025924 Bacteria 1298
192 Ga0207694_10475791 3300025924 Bacteria 1044
193 Ga0207650_10040992 3300025925 Bacteria 3391
194 Ga0207650_10075006 3300025925 Bacteria 2551
195 Ga0207650_10253918 3300025925 Bacteria 1424
196 Ga0207700_10167755 3300025928 Bacteria 1828
197 Ga0207664_10030600 3300025929 Bacteria 4112
198 Ga0207644_10000308 3300025931 Bacteria 31770
199 Ga0207644_10015287 3300025931 Bacteria 5148
200 Ga0207644_10025487 3300025931 Bacteria 4066
201 Ga0207644_10063447 3300025931 Bacteria 2682
202 Ga0207644_10138348 3300025931 Bacteria 1872
203 Ga0207690_10030227 3300025932 Bacteria 3453
204 Ga0207690_10308195 3300025932 Bacteria 1241
205 Ga0207690_10343621 3300025932 Bacteria 1178
206 Ga0207706_10016404 3300025933 Bacteria 6688
207 Ga0207706_10057579 3300025933 Bacteria 3423
208 Ga0207706_10092958 3300025933 Bacteria 2652
209 Ga0207706_10238888 3300025933 Bacteria 1588
210 Ga0207706_10277142 3300025933 Bacteria 1463
211 Ga0207686_10061994 3300025934 Bacteria 2373
212 Ga0207669_10012810 3300025937 Bacteria 4138
213 Ga0207691_10019225 3300025940 Bacteria 6466
214 Ga0207691_10122564 3300025940 Bacteria 2302
215 Ga0207711_10000876 3300025941 Bacteria 29060
216 Ga0207711_10002871 3300025941 Bacteria 15108
217 Ga0207711_10008432 3300025941 Bacteria 8618
218 Ga0207711_10016978 3300025941 Bacteria 6046
219 Ga0207689_10570101 3300025942 Bacteria 951
220 Ga0207661_10053484 3300025944 Bacteria 3231
221 Ga0207679_10010110 3300025945 Bacteria 6066
222 Ga0207679_10014881 3300025945 Bacteria 5125
223 Ga0207679_10384365 3300025945 Bacteria 1231
224 Ga0207667_10680564 3300025949 Unclassified 1032
225 Ga0207651_10029147 3300025960 Bacteria 3493
226 Ga0207651_10052281 3300025960 Bacteria 2785
227 Ga0207651_10069082 3300025960 Bacteria 2493
228 Ga0207651_10175120 3300025960 Bacteria 1696
229 Ga0207640_10030994 3300025981 Bacteria 3300
230 Ga0207640_10032443 3300025981 Bacteria 3238
231 Ga0207640_10049140 3300025981 Bacteria 2730
232 Ga0207640_10088028 3300025981 Bacteria 2143
233 Ga0207658_10004322 3300025986 Bacteria 9890
234 Ga0207658_10013965 3300025986 Bacteria 5496
235 Ga0207677_10020023 3300026023 Bacteria 4054
236 Ga0207677_10020076 3300026023 Bacteria 4049
237 Ga0207703_10037721 3300026035 Bacteria 3851
238 Ga0207703_10083875 3300026035 Bacteria 2663
239 Ga0207703_10254235 3300026035 Bacteria 1585
240 Ga0207639_10073181 3300026041 Bacteria 2686
241 Ga0207678_10006202 3300026067 Bacteria 10620
242 Ga0207678_10050163 3300026067 Bacteria 3606
243 Ga0207678_10052858 3300026067 Bacteria 3502
244 Ga0207678_10079163 3300026067 Bacteria 2814
245 Ga0207678_10117363 3300026067 Bacteria 2271
246 Ga0207678_10300762 3300026067 Bacteria 1379
247 Ga0207702_10170067 3300026078 Bacteria 1997
248 Ga0207702_10188972 3300026078 Bacteria 1902
249 Ga0207702_10268216 3300026078 Bacteria 1609
250 Ga0207641_10003577 3300026088 Bacteria 13730
251 Ga0207641_10016769 3300026088 Bacteria 5999
252 Ga0207648_10008103 3300026089 Bacteria 10229
253 Ga0207648_10076062 3300026089 Bacteria 2926
254 Ga0207648_10145917 3300026089 Bacteria 2087
255 Ga0207676_10004467 3300026095 Bacteria 9889
256 Ga0207676_10196208 3300026095 Bacteria 1780
257 Ga0207676_10205132 3300026095 Bacteria 1745
258 Ga0207674_10028200 3300026116 Bacteria 5929
259 Ga0207674_10100329 3300026116 Bacteria 2876
260 Ga0207674_10170631 3300026116 Bacteria 2129
261 Ga0207674_10325831 3300026116 Bacteria 1486
262 Ga0207675_100302121 3300026118 Bacteria 1559
263 Ga0207683_10018862 3300026121 Bacteria 5885
264 Ga0207683_10045410 3300026121 Bacteria 3842
265 Ga0207683_10113079 3300026121 Bacteria 2432
266 Ga0207698_10030156 3300026142 Bacteria 3896
267 Ga0207698_10042660 3300026142 Bacteria 3392
268 Ga0207698_10045484 3300026142 Bacteria 3308
269 Ga0207698_10101596 3300026142 Bacteria 2385
270 Ga0207698_10212326 3300026142 Bacteria 1742
271 Ga0268264_10077805 3300028381 Bacteria 2826
272 Ga0307413_10126378 3300031824 Bacteria 1742
273 Ga0307406_10099856 3300031901 Bacteria 1974
274 Ga0307414_10072574 3300032004 Bacteria 2487
275 Ga0373943_0047077 3300035170 Bacteria 2107
276 Ga0373935_0018835 3300035692 Bacteria 4207
277 Ga0395899_0011295 3300037312 Bacteria 6838
278 Ga0395899_0016960 3300037312 Bacteria 5551
279 Ga0395899_0049835 3300037312 Bacteria 3111
280 Ga0395899_0178711 3300037312 Bacteria 1491
281 Ga0395899_0180224 3300037312 Bacteria 1483
282 Ga0395900_0025735 3300037418 Bacteria 6022
283 Ga0395900_0111229 3300037418 Bacteria 2813
284 Ga0395900_0196600 3300037418 Bacteria 2042
285 Ga0395900_0241092 3300037418 Bacteria 1813
286 Ga0395900_0250690 3300037418 Bacteria 1772
287 Ga0395900_0254838 3300037418 Bacteria 1754
288 Ga0395898_0015905 3300037466 Bacteria 7710
289 Ga0395898_0056492 3300037466 Bacteria 3825
290 Ga0395898_0112289 3300037466 Bacteria 2612
291 Ga0395898_0132918 3300037466 Bacteria 2382
292 Ga0395898_0291923 3300037466 Bacteria 1555
293 Ga0395898_0455196 3300037466 Bacteria 1218
294 Ga0395898_0702732 3300037466 Bacteria 953
295 Ga0395905_0004868 3300037471 Bacteria 13838
296 Ga0395905_0044408 3300037471 Bacteria 4171
297 Ga0395905_0064153 3300037471 Bacteria 3436
298 Ga0395905_0068507 3300037471 Bacteria 3323
299 Ga0395905_0092072 3300037471 Bacteria 2843
300 Ga0395905_0241733 3300037471 Bacteria 1687
301 Ga0436364_0292967 3300037853 Bacteria 4519
302 Ga0395901_0013677 3300038443 Bacteria 8247
303 Ga0395901_0040892 3300038443 Bacteria 4802
304 Ga0395901_0054391 3300038443 Bacteria 4160
305 Ga0395901_0069303 3300038443 Bacteria 3673
306 Ga0395901_0178922 3300038443 Bacteria 2224
307 Ga0395901_0576412 3300038443 Bacteria 1137
308 Ga0450889_001001 3300042144 Bacteria 2980
309 Ga0466969_0028355 3300044656 Bacteria 2862
310 Ga0466972_0017087 3300044658 Bacteria 3628
311 Ga0466966_0031580 3300044684 Bacteria 3434
312 Ga0466966_0086966 3300044684 Bacteria 1943
313 Ga0466961_0067776 3300044693 Bacteria 2267
314 Ga0466961_0072573 3300044693 Bacteria 2183
315 Ga0466963_0145503 3300044694 Bacteria 1644
316 Ga0466964_0046949 3300044706 Bacteria 1761
317 Ga0466971_0028796 3300044719 Bacteria 2484
318 Ga0466968_0001603 3300044735 Bacteria 8166
319 Ga0466970_0034067 3300044765 Bacteria 2694
320 Ga0466957_0022472 3300044842 Bacteria 3721
321 Ga0466957_0271090 3300044842 Bacteria 1133
322 Ga0466960_0015799 3300044901 Bacteria 3262
323 Ga0466959_0053123 3300045049 Bacteria 2963
324 Ga0466959_0200956 3300045049 Bacteria 1388
325 Ga0466959_0257002 3300045049 Bacteria 1203
326 Ga0466958_0041994 3300045836 Bacteria 2752
327 Ga0466958_0203111 3300045836 Bacteria 1261
328 Ga0466967_0126562 3300045976 Bacteria 2367
329 Ga0495669_0007836 3300046684 Bacteria 4482
330 Ga0495669_0064903 3300046684 Bacteria 1657
331 Ga0495669_0161606 3300046684 Bacteria 1063
332 Ga0496100_0035809 3300048903 Bacteria 3125
333 Ga0496100_0415225 3300048903 Bacteria 1027
334 Ga0496101_0018477 3300048904 Bacteria 4741
335 Ga0496103_0067309 3300048906 Bacteria 2237
336 Ga0496103_0189639 3300048906 Bacteria 1322
337 Ga0496106_0458820 3300048909 Bacteria 1024
338 Ga0496107_0011093 3300048910 Bacteria 6269
339 Ga0496107_0248552 3300048910 Bacteria 1323
340 Ga0496108_0036883 3300048911 Bacteria 4069
341 Ga0496109_0026249 3300048912 Bacteria 5194
342 Ga0496109_0239128 3300048912 Bacteria 1709
343 Ga0496110_0111234 3300048913 Bacteria 2462
344 Ga0496112_0205008 3300048915 Bacteria 1930
345 Ga0496114_0000023 3300048917 Bacteria 219092
346 Ga0496115_0068137 3300048918 Bacteria 2880
347 Ga0466962_0082405 3300061719 Bacteria 1538
348 Ga0207702_10235464
349 JGI24737J22298_10000281
350 JGI24744J21845_10003311
351 rootH2_10093800
352 Ga0070658_10126872
353 Ga0070658_10403723
354 Ga0070658_10618193
355 Ga0070676_10003383
356 Ga0070690_100064884
357 Ga0070670_100053046
358 Ga0070670_100100941
359 Ga0068869_100000385
360 Ga0068868_100001184
361 Ga0068868_100006311
362 Ga0068868_100034935
363 Ga0070660_100011437
364 Ga0070660_100052226
365 Ga0070660_100078132
366 Ga0070689_100099774
367 Ga0070661_100009694
368 Ga0070661_100188452
369 Ga0070661_100288297
370 Ga0070661_100382504
371 Ga0070692_10026792
372 Ga0070692_10031615
373 Ga0070669_100000643
374 Ga0070675_100056674
375 Ga0070671_100000784
376 Ga0070671_100012172
377 Ga0070671_100017658
378 Ga0070671_100117846
379 Ga0070674_100007764
380 Ga0070674_100026500
381 Ga0070673_100000663
382 Ga0070673_100012465
383 Ga0070673_100080383
384 Ga0070673_100340937
385 Ga0070659_100000382
386 Ga0070659_100007320
387 Ga0070659_100023443
388 Ga0070659_100076285
389 Ga0070659_100625964
390 Ga0070667_100000520
391 Ga0070667_100001684
392 Ga0070667_100021677
393 Ga0070714_100046739
394 Ga0070713_100121090
395 Ga0070663_100009586
396 Ga0070663_100171476
397 Ga0070663_100253462
398 Ga0070678_100045766
399 Ga0070678_100101928
400 Ga0070662_100000975
401 Ga0070662_100119834
402 Ga0070662_100194338
403 Ga0070662_100478886
404 Ga0070681_10083231
405 Ga0070681_10254279
406 Ga0068867_100001073
407 Ga0068867_100003113
408 Ga0068867_100200753
409 Ga0068867_100215668
410 Ga0070679_100060450
411 Ga0070679_100297633
412 Ga0068853_100002970
413 Ga0068853_100159576
414 Ga0068853_100522991
415 Ga0068853_100524662
416 Ga0070672_100000342
417 Ga0070672_100009142
418 Ga0070672_100104878
419 Ga0070696_100093521
420 Ga0070696_100311333
421 Ga0070665_100735655
422 Ga0068855_100147109
423 Ga0068855_100160912
424 Ga0070664_100003562
425 Ga0070664_100003589
426 Ga0070664_100025245
427 Ga0070664_100063791
428 Ga0070664_100206938
429 Ga0070664_100388530
430 Ga0068857_100003686
431 Ga0068857_100013620
432 Ga0068857_100057141
433 Ga0068857_100222495
434 Ga0068854_100000376
435 Ga0068854_100037487
436 Ga0068854_100041469
437 Ga0068856_100060780
438 Ga0068856_100222800
439 Ga0068856_100554766
440 Ga0068852_100001271
441 Ga0068852_100035005
442 Ga0068852_100085184
443 Ga0068852_100213373
444 Ga0068852_100233571
445 Ga0068859_100000982
446 Ga0068859_100061841
447 Ga0068859_100835255
448 Ga0068864_100000982
449 Ga0068864_100090916
450 Ga0068866_10021291
451 Ga0068851_10019419
452 Ga0068851_10020215
453 Ga0068851_10039368
454 Ga0068851_10040198
455 Ga0068863_100000871
456 Ga0068863_100050676
457 Ga0068858_100006590
458 Ga0068858_100014737
459 Ga0068858_100074533
460 Ga0068858_100467926
461 Ga0068860_100001576
462 Ga0068860_100029748
463 Ga0068860_100396052
464 Ga0068860_100523611
465 Ga0070712_100022733
466 Ga0068871_100033491
467 Ga0068865_100062669
468 Ga0097620_100000982
469 Ga0097620_100061841
470 Ga0097620_100835195
471 Ga0105240_10386554
472 Ga0105245_10000657
473 Ga0105243_10408716
474 Ga0105243_10595597
475 Ga0105242_10242812
476 Ga0105248_10000394
477 Ga0105248_10099823
478 Ga0105248_10147111
479 Ga0105248_10215831
480 Ga0105238_10056084
481 Ga0105239_10355211
482 Ga0157373_10019651
483 Ga0157371_10432766
484 Ga0157370_10037567
485 Ga0157369_10069784
486 Ga0157369_10106226
487 Ga0157369_10765102
488 Ga0157374_10009602
489 Ga0157374_10251873
490 Ga0157374_10820869
491 Ga0157378_10078427
492 Ga0163162_10057255
493 Ga0163162_10129828
494 Ga0163162_10164961
495 Ga0157375_10040319
496 Ga0157375_10065348
497 Ga0157375_10124911
498 Ga0157375_10191301
499 Ga0163163_10604240
500 Ga0157379_10464509
501 Ga0157379_10606740
502 Ga0213875_10011631
503 Ga0207697_10090484
504 Ga0207656_10070720
505 Ga0207642_10019942
506 Ga0207688_10014674
507 Ga0207680_10002980
508 Ga0207680_10004835
509 Ga0207699_10039494
510 Ga0207645_10063666
511 Ga0207645_10063753
512 Ga0207645_10066096
513 Ga0207645_10090333
514 Ga0207645_10146768
515 Ga0207705_10004032
516 Ga0207705_10022260
517 Ga0207705_10028904
518 Ga0207705_10107412
519 Ga0207705_10164639
520 Ga0207705_10424595
521 Ga0207707_10271882
522 Ga0207707_10364136
523 Ga0207671_10454050
524 Ga0207693_10062291
525 Ga0207660_10023500
526 Ga0207662_10010077
527 Ga0207657_10016327
528 Ga0207657_10031009
529 Ga0207657_10048010
530 Ga0207657_10056867
531 Ga0207657_10077247
532 Ga0207657_10084926
533 Ga0207657_10104257
534 Ga0207657_10166725
535 Ga0207649_10144580
536 Ga0207649_10247291
537 Ga0207649_10305866
538 Ga0207694_10311514
539 Ga0207694_10475791
540 Ga0207650_10040992
541 Ga0207650_10075006
542 Ga0207650_10253918
543 Ga0207700_10167755
544 Ga0207664_10030600
545 Ga0207644_10000308
546 Ga0207644_10015287
547 Ga0207644_10025487
548 Ga0207644_10063447
549 Ga0207644_10138348
550 Ga0207690_10030227
551 Ga0207690_10308195
552 Ga0207690_10343621
553 Ga0207706_10016404
554 Ga0207706_10057579
555 Ga0207706_10092958
556 Ga0207706_10238888
557 Ga0207706_10277142
558 Ga0207686_10061994
559 Ga0207669_10012810
560 Ga0207691_10019225
561 Ga0207691_10122564
562 Ga0207711_10000876
563 Ga0207711_10002871
564 Ga0207711_10008432
565 Ga0207711_10016978
566 Ga0207689_10570101
567 Ga0207661_10053484
568 Ga0207679_10010110
569 Ga0207679_10014881
570 Ga0207679_10384365
571 Ga0207667_10680564
572 Ga0207651_10029147
573 Ga0207651_10052281
574 Ga0207651_10069082
575 Ga0207651_10175120
576 Ga0207640_10030994
577 Ga0207640_10032443
578 Ga0207640_10049140
579 Ga0207640_10088028
580 Ga0207658_10004322
581 Ga0207658_10013965
582 Ga0207677_10020023
583 Ga0207677_10020076
584 Ga0207703_10037721
585 Ga0207703_10083875
586 Ga0207703_10254235
587 Ga0207639_10073181
588 Ga0207678_10006202
589 Ga0207678_10050163
590 Ga0207678_10052858
591 Ga0207678_10079163
592 Ga0207678_10117363
593 Ga0207678_10300762
594 Ga0207702_10170067
595 Ga0207702_10188972
596 Ga0207702_10268216
597 Ga0207641_10003577
598 Ga0207641_10016769
599 Ga0207648_10008103
600 Ga0207648_10076062
601 Ga0207648_10145917
602 Ga0207676_10004467
603 Ga0207676_10196208
604 Ga0207676_10205132
605 Ga0207674_10028200
606 Ga0207674_10100329
607 Ga0207674_10170631
608 Ga0207674_10325831
609 Ga0207675_100302121
610 Ga0207683_10018862
611 Ga0207683_10045410
612 Ga0207683_10113079
613 Ga0207698_10030156
614 Ga0207698_10042660
615 Ga0207698_10045484
616 Ga0207698_10101596
617 Ga0207698_10212326
618 Ga0268264_10077805
619 Ga0307413_10126378
620 Ga0307406_10099856
621 Ga0307414_10072574
622 Ga0373943_0047077
623 Ga0373935_0018835
624 Ga0395899_0011295
625 Ga0395899_0016960
626 Ga0395899_0049835
627 Ga0395899_0178711
628 Ga0395899_0180224
629 Ga0395900_0025735
630 Ga0395900_0111229
631 Ga0395900_0196600
632 Ga0395900_0241092
633 Ga0395900_0250690
634 Ga0395900_0254838
635 Ga0395898_0015905
636 Ga0395898_0056492
637 Ga0395898_0112289
638 Ga0395898_0132918
639 Ga0395898_0291923
640 Ga0395898_0455196
641 Ga0395898_0702732
642 Ga0395905_0004868
643 Ga0395905_0044408
644 Ga0395905_0064153
645 Ga0395905_0068507
646 Ga0395905_0092072
647 Ga0395905_0241733
648 Ga0436364_0292967
649 Ga0395901_0013677
650 Ga0395901_0040892
651 Ga0395901_0054391
652 Ga0395901_0069303
653 Ga0395901_0178922
654 Ga0395901_0576412
655 Ga0450889_001001
656 Ga0466969_0028355
657 Ga0466972_0017087
658 Ga0466966_0031580
659 Ga0466966_0086966
660 Ga0466961_0067776
661 Ga0466961_0072573
662 Ga0466963_0145503
663 Ga0466964_0046949
664 Ga0466971_0028796
665 Ga0466968_0001603
666 Ga0466970_0034067
667 Ga0466957_0022472
668 Ga0466957_0271090
669 Ga0466960_0015799
670 Ga0466959_0053123
671 Ga0466959_0200956
672 Ga0466959_0257002
673 Ga0466958_0041994
674 Ga0466958_0203111
675 Ga0466967_0126562
676 Ga0495669_0007836
677 Ga0495669_0064903
678 Ga0495669_0161606
679 Ga0496100_0035809
680 Ga0496100_0415225
681 Ga0496101_0018477
682 Ga0496103_0067309
683 Ga0496103_0189639
684 Ga0496106_0458820
685 Ga0496107_0011093
686 Ga0496107_0248552
687 Ga0496108_0036883
688 Ga0496109_0026249
689 Ga0496109_0239128
690 Ga0496110_0111234
691 Ga0496112_0205008
692 Ga0496114_0000023
693 Ga0496115_0068137
694 Ga0466962_0082405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

161

237

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

12

98

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rcy-assembly1.cif.gz_A crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8956 4 265
6lhm-assembly2.cif.gz_B structure of human pycr2 0.8953 12 266
2rcy-assembly1.cif.gz_D-2 crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8951 11 265
2rcy-assembly1.cif.gz_E-2 crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8912 12 265
2rcy-assembly1.cif.gz_A crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8892 4 265
ID Description Score Start End Superfamily
af_Q4DH60_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9106 11 161 3.40.50.720
af_Q21544_1_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9058 11 162 3.40.50.720
af_P0A9L8_1_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8967 7 161 3.40.50.720
af_Q5SPD7_3_179_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8957 9 161 3.40.50.720
af_Q9VEJ3_1_166_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.888 9 162 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7G9SGC3-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.9504 5 269 GO:0004735
GO:0005737
GO:0055129
AF-A0A520IB92-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9462 8 225 GO:0004735
GO:0055129
AF-A0A6G7ZNW8-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.9446 6 270 GO:0004735
GO:0005737
GO:0055129
AF-A0A3D4CI51-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9364 99 244 GO:0004735
GO:0055129
AF-A0A536BZ74-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9362 97 234 GO:0004735
GO:0055129

Map