F417188
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 347 | 163 | 347 | 82 |
Family's Representative Sequence
| Representative Sequence | 3300028381|Ga0268264_10012583|Ga0268264_1001258311 |
| Length | 94 |
| Sequence | LTDVEIRNYNVVMKSQIIQIGNSQGIRIPKVLLEESGLRGDVDLELCPEGVLIRNIQKPRAGWDEAFKTMTENEDDDLQGSDVSTAFEKKEWQW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 123 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 124 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 125 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 131 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 132 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 136 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 137 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 138 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 140 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 145 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 146 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 148 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 149 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 150 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 151 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 152 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 153 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 154 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 155 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 156 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 157 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 158 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 159 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 160 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 161 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 162 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.88 |
| Rhizosphere | 96.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10224818 | 3300005289 | Unclassified | 1062 |
| 2 | Ga0065712_10129989 | 3300005290 | Bacteria | 1561 |
| 3 | Ga0065715_10988937 | 3300005293 | Bacteria | 548 |
| 4 | Ga0070690_100257088 | 3300005330 | Bacteria | 1237 |
| 5 | Ga0070670_100002158 | 3300005331 | Bacteria | 16150 |
| 6 | Ga0070670_100063757 | 3300005331 | Bacteria | 3162 |
| 7 | Ga0070677_10255217 | 3300005333 | Bacteria | 872 |
| 8 | Ga0070677_10267277 | 3300005333 | Bacteria | 856 |
| 9 | Ga0070677_10289275 | 3300005333 | Bacteria | 828 |
| 10 | Ga0068869_100164796 | 3300005334 | Bacteria | 1728 |
| 11 | Ga0068869_101078751 | 3300005334 | Bacteria | 702 |
| 12 | Ga0070666_10030634 | 3300005335 | Bacteria | 3546 |
| 13 | Ga0068868_100303402 | 3300005338 | Bacteria | 1357 |
| 14 | Ga0068868_100549872 | 3300005338 | Bacteria | 1017 |
| 15 | Ga0070689_100407055 | 3300005340 | Bacteria | 1151 |
| 16 | Ga0070692_10489263 | 3300005345 | Bacteria | 795 |
| 17 | Ga0070668_100161281 | 3300005347 | Bacteria | 1820 |
| 18 | Ga0070668_100235874 | 3300005347 | Bacteria | 1514 |
| 19 | Ga0070668_100383822 | 3300005347 | Bacteria | 1196 |
| 20 | Ga0070675_100012592 | 3300005354 | Bacteria | 6632 |
| 21 | Ga0070675_100097301 | 3300005354 | Bacteria | 2474 |
| 22 | Ga0070675_100370880 | 3300005354 | Bacteria | 1272 |
| 23 | Ga0070671_100247865 | 3300005355 | Bacteria | 1513 |
| 24 | Ga0070671_100275439 | 3300005355 | Bacteria | 1430 |
| 25 | Ga0070671_100419213 | 3300005355 | Bacteria | 1146 |
| 26 | Ga0070671_100828717 | 3300005355 | Bacteria | 806 |
| 27 | Ga0070674_100014135 | 3300005356 | Bacteria | 4956 |
| 28 | Ga0070674_100138966 | 3300005356 | Bacteria | 1821 |
| 29 | Ga0070673_100095529 | 3300005364 | Bacteria | 2438 |
| 30 | Ga0070673_102290344 | 3300005364 | Unclassified | 513 |
| 31 | Ga0070688_100735000 | 3300005365 | Bacteria | 767 |
| 32 | Ga0070659_101089362 | 3300005366 | Unclassified | 704 |
| 33 | Ga0070667_100018385 | 3300005367 | Bacteria | 5797 |
| 34 | Ga0070667_100233105 | 3300005367 | Bacteria | 1642 |
| 35 | Ga0070701_10363676 | 3300005438 | Bacteria | 907 |
| 36 | Ga0070663_100996178 | 3300005455 | Bacteria | 728 |
| 37 | Ga0070678_100052484 | 3300005456 | Bacteria | 2961 |
| 38 | Ga0070678_100543759 | 3300005456 | Bacteria | 1030 |
| 39 | Ga0070678_100546409 | 3300005456 | Bacteria | 1028 |
| 40 | Ga0070662_100283923 | 3300005457 | Bacteria | 1340 |
| 41 | Ga0068867_100120024 | 3300005459 | Bacteria | 2031 |
| 42 | Ga0068867_100187963 | 3300005459 | Bacteria | 1647 |
| 43 | Ga0068867_100443675 | 3300005459 | Bacteria | 1104 |
| 44 | Ga0068867_101286579 | 3300005459 | Unclassified | 674 |
| 45 | Ga0068867_102211133 | 3300005459 | Unclassified | 522 |
| 46 | Ga0070685_10051358 | 3300005466 | Bacteria | 2384 |
| 47 | Ga0070685_11101483 | 3300005466 | Unclassified | 600 |
| 48 | Ga0070698_100074861 | 3300005471 | Bacteria | 3391 |
| 49 | Ga0070679_101123177 | 3300005530 | Bacteria | 731 |
| 50 | Ga0070684_100736731 | 3300005535 | Unclassified | 920 |
| 51 | Ga0070684_101545610 | 3300005535 | Bacteria | 626 |
| 52 | Ga0068853_100062432 | 3300005539 | Bacteria | 3224 |
| 53 | Ga0070672_100044127 | 3300005543 | Bacteria | 3442 |
| 54 | Ga0070672_100049218 | 3300005543 | Bacteria | 3278 |
| 55 | Ga0070672_101409497 | 3300005543 | Unclassified | 623 |
| 56 | Ga0070686_100092081 | 3300005544 | Bacteria | 2029 |
| 57 | Ga0070696_100741622 | 3300005546 | Bacteria | 804 |
| 58 | Ga0068855_100403025 | 3300005563 | Bacteria | 1499 |
| 59 | Ga0070664_100040892 | 3300005564 | Bacteria | 3911 |
| 60 | Ga0070664_100227758 | 3300005564 | Bacteria | 1670 |
| 61 | Ga0070664_100861576 | 3300005564 | Bacteria | 848 |
| 62 | Ga0068857_100980503 | 3300005577 | Bacteria | 813 |
| 63 | Ga0068854_101378480 | 3300005578 | Bacteria | 637 |
| 64 | Ga0068854_102264558 | 3300005578 | Bacteria | 503 |
| 65 | Ga0070702_100027864 | 3300005615 | Bacteria | 3054 |
| 66 | Ga0068852_100401202 | 3300005616 | Bacteria | 1349 |
| 67 | Ga0068852_100808943 | 3300005616 | Bacteria | 952 |
| 68 | Ga0068859_100028886 | 3300005617 | Bacteria | 5562 |
| 69 | Ga0068859_100748102 | 3300005617 | Bacteria | 1066 |
| 70 | Ga0068864_100226039 | 3300005618 | Bacteria | 1729 |
| 71 | Ga0068864_100612672 | 3300005618 | Bacteria | 1057 |
| 72 | Ga0068864_101374645 | 3300005618 | Bacteria | 707 |
| 73 | Ga0068866_11005045 | 3300005718 | Bacteria | 593 |
| 74 | Ga0068861_100743334 | 3300005719 | Bacteria | 916 |
| 75 | Ga0068861_101359665 | 3300005719 | Bacteria | 692 |
| 76 | Ga0068870_10664736 | 3300005840 | Bacteria | 715 |
| 77 | Ga0068863_100491758 | 3300005841 | Bacteria | 1207 |
| 78 | Ga0068863_100807993 | 3300005841 | Unclassified | 935 |
| 79 | Ga0068863_102737876 | 3300005841 | Bacteria | 502 |
| 80 | Ga0068858_100113671 | 3300005842 | Bacteria | 2528 |
| 81 | Ga0068858_100285193 | 3300005842 | Bacteria | 1573 |
| 82 | Ga0068858_100371581 | 3300005842 | Bacteria | 1371 |
| 83 | Ga0068860_100043733 | 3300005843 | Bacteria | 4271 |
| 84 | Ga0068860_100070878 | 3300005843 | Bacteria | 3313 |
| 85 | Ga0068860_100081286 | 3300005843 | Bacteria | 3081 |
| 86 | Ga0068860_100689325 | 3300005843 | Bacteria | 1031 |
| 87 | Ga0068862_100510987 | 3300005844 | Bacteria | 1142 |
| 88 | Ga0068862_100745040 | 3300005844 | Unclassified | 953 |
| 89 | Ga0097621_100101460 | 3300006237 | Bacteria | 2421 |
| 90 | Ga0097621_100171739 | 3300006237 | Unclassified | 1869 |
| 91 | Ga0097621_100824757 | 3300006237 | Bacteria | 860 |
| 92 | Ga0068871_100062040 | 3300006358 | Bacteria | 3054 |
| 93 | Ga0068871_100132219 | 3300006358 | Bacteria | 2116 |
| 94 | Ga0068871_100339619 | 3300006358 | Bacteria | 1326 |
| 95 | Ga0068871_101477074 | 3300006358 | Unclassified | 642 |
| 96 | Ga0075428_101706582 | 3300006844 | Bacteria | 657 |
| 97 | Ga0068865_100057112 | 3300006881 | Bacteria | 2722 |
| 98 | Ga0068865_100386981 | 3300006881 | Bacteria | 1142 |
| 99 | Ga0068865_100445661 | 3300006881 | Bacteria | 1069 |
| 100 | Ga0097620_100028886 | 3300006931 | Bacteria | 5562 |
| 101 | Ga0097620_100748102 | 3300006931 | Bacteria | 1066 |
| 102 | Ga0105240_11643064 | 3300009093 | Unclassified | 672 |
| 103 | Ga0111539_10021901 | 3300009094 | Bacteria | 7856 |
| 104 | Ga0105245_11749096 | 3300009098 | Bacteria | 674 |
| 105 | Ga0105247_10011609 | 3300009101 | Bacteria | 5307 |
| 106 | Ga0105241_11302895 | 3300009174 | Unclassified | 692 |
| 107 | Ga0105242_10104992 | 3300009176 | Bacteria | 2399 |
| 108 | Ga0105242_10521359 | 3300009176 | Bacteria | 1134 |
| 109 | Ga0105242_11644675 | 3300009176 | Bacteria | 677 |
| 110 | Ga0105242_11972115 | 3300009176 | Unclassified | 626 |
| 111 | Ga0105248_10141095 | 3300009177 | Bacteria | 2718 |
| 112 | Ga0105248_10221020 | 3300009177 | Unclassified | 2133 |
| 113 | Ga0105248_12038294 | 3300009177 | Unclassified | 652 |
| 114 | Ga0105237_11531729 | 3300009545 | Bacteria | 673 |
| 115 | Ga0105249_10062297 | 3300009553 | Bacteria | 3425 |
| 116 | Ga0105249_10092131 | 3300009553 | Bacteria | 2837 |
| 117 | Ga0105249_10146072 | 3300009553 | Bacteria | 2272 |
| 118 | Ga0105249_10178666 | 3300009553 | Bacteria | 2063 |
| 119 | Ga0105239_11023880 | 3300010375 | Bacteria | 950 |
| 120 | Ga0105246_10885757 | 3300011119 | Unclassified | 799 |
| 121 | Ga0105246_11436446 | 3300011119 | Bacteria | 645 |
| 122 | Ga0157371_10122033 | 3300013102 | Bacteria | 1853 |
| 123 | Ga0157370_10831118 | 3300013104 | Unclassified | 840 |
| 124 | Ga0157369_11351627 | 3300013105 | Bacteria | 726 |
| 125 | Ga0157374_10052744 | 3300013296 | Bacteria | 3789 |
| 126 | Ga0157374_11032147 | 3300013296 | Bacteria | 842 |
| 127 | Ga0157374_11307028 | 3300013296 | Bacteria | 747 |
| 128 | Ga0157374_12836307 | 3300013296 | Bacteria | 512 |
| 129 | Ga0157378_10561142 | 3300013297 | Unclassified | 1148 |
| 130 | Ga0157378_11925263 | 3300013297 | Bacteria | 640 |
| 131 | Ga0157378_11974889 | 3300013297 | Bacteria | 633 |
| 132 | Ga0157378_12877036 | 3300013297 | Bacteria | 534 |
| 133 | Ga0163162_10043788 | 3300013306 | Bacteria | 4482 |
| 134 | Ga0163162_10164524 | 3300013306 | Bacteria | 2342 |
| 135 | Ga0163162_10202247 | 3300013306 | Bacteria | 2115 |
| 136 | Ga0163162_10711471 | 3300013306 | Unclassified | 1125 |
| 137 | Ga0163162_10715635 | 3300013306 | Bacteria | 1122 |
| 138 | Ga0163162_11725308 | 3300013306 | Bacteria | 715 |
| 139 | Ga0157372_10311429 | 3300013307 | Bacteria | 1832 |
| 140 | Ga0157375_10057210 | 3300013308 | Bacteria | 3853 |
| 141 | Ga0157375_10135044 | 3300013308 | Bacteria | 2590 |
| 142 | Ga0157375_10158199 | 3300013308 | Bacteria | 2406 |
| 143 | Ga0157375_10232528 | 3300013308 | Bacteria | 2002 |
| 144 | Ga0157375_10680199 | 3300013308 | Unclassified | 1184 |
| 145 | Ga0157375_10684405 | 3300013308 | Bacteria | 1180 |
| 146 | Ga0157375_13644799 | 3300013308 | Unclassified | 512 |
| 147 | Ga0157375_13644800 | 3300013308 | Bacteria | 512 |
| 148 | Ga0163163_10015220 | 3300014325 | Bacteria | 7106 |
| 149 | Ga0163163_10263905 | 3300014325 | Bacteria | 1773 |
| 150 | Ga0163163_10501278 | 3300014325 | Bacteria | 1276 |
| 151 | Ga0163163_10646002 | 3300014325 | Bacteria | 1121 |
| 152 | Ga0163163_11851606 | 3300014325 | Bacteria | 664 |
| 153 | Ga0157380_10169324 | 3300014326 | Bacteria | 1907 |
| 154 | Ga0157380_10340393 | 3300014326 | Bacteria | 1399 |
| 155 | Ga0157380_10433909 | 3300014326 | Bacteria | 1257 |
| 156 | Ga0157377_10100259 | 3300014745 | Bacteria | 1724 |
| 157 | Ga0157377_11095152 | 3300014745 | Bacteria | 610 |
| 158 | Ga0157376_10034478 | 3300014969 | Bacteria | 4087 |
| 159 | Ga0157376_10101954 | 3300014969 | Bacteria | 2509 |
| 160 | Ga0157376_10422273 | 3300014969 | Unclassified | 1294 |
| 161 | Ga0157376_10985435 | 3300014969 | Bacteria | 865 |
| 162 | Ga0157376_11121471 | 3300014969 | Bacteria | 813 |
| 163 | Ga0157376_11388311 | 3300014969 | Bacteria | 734 |
| 164 | Ga0163161_10001466 | 3300017792 | Bacteria | 17447 |
| 165 | Ga0163161_10036276 | 3300017792 | Bacteria | 3531 |
| 166 | Ga0163161_10080449 | 3300017792 | Bacteria | 2398 |
| 167 | Ga0207697_10096294 | 3300025315 | Bacteria | 1258 |
| 168 | Ga0207682_10049979 | 3300025893 | Bacteria | 1727 |
| 169 | Ga0207642_10893335 | 3300025899 | Unclassified | 569 |
| 170 | Ga0207710_10015790 | 3300025900 | Bacteria | 3193 |
| 171 | Ga0207643_10038796 | 3300025908 | Bacteria | 2677 |
| 172 | Ga0207705_10002127 | 3300025909 | Bacteria | 15372 |
| 173 | Ga0207654_10405134 | 3300025911 | Bacteria | 949 |
| 174 | Ga0207652_10965372 | 3300025921 | Bacteria | 750 |
| 175 | Ga0207650_10031089 | 3300025925 | Bacteria | 3853 |
| 176 | Ga0207650_10126450 | 3300025925 | Bacteria | 1996 |
| 177 | Ga0207650_10336809 | 3300025925 | Bacteria | 1238 |
| 178 | Ga0207650_10615292 | 3300025925 | Bacteria | 914 |
| 179 | Ga0207650_11003007 | 3300025925 | Bacteria | 710 |
| 180 | Ga0207659_10131632 | 3300025926 | Bacteria | 1932 |
| 181 | Ga0207659_10396791 | 3300025926 | Bacteria | 1153 |
| 182 | Ga0207659_10557900 | 3300025926 | Bacteria | 974 |
| 183 | Ga0207644_10754648 | 3300025931 | Bacteria | 813 |
| 184 | Ga0207644_11128096 | 3300025931 | Unclassified | 659 |
| 185 | Ga0207706_10133276 | 3300025933 | Bacteria | 2185 |
| 186 | Ga0207670_10430750 | 3300025936 | Bacteria | 1060 |
| 187 | Ga0207670_11186924 | 3300025936 | Bacteria | 646 |
| 188 | Ga0207669_10150411 | 3300025937 | Bacteria | 1630 |
| 189 | Ga0207669_10553647 | 3300025937 | Bacteria | 928 |
| 190 | Ga0207669_10701183 | 3300025937 | Bacteria | 832 |
| 191 | Ga0207704_10321466 | 3300025938 | Bacteria | 1194 |
| 192 | Ga0207704_10444012 | 3300025938 | Bacteria | 1034 |
| 193 | Ga0207704_10930372 | 3300025938 | Bacteria | 732 |
| 194 | Ga0207704_11434988 | 3300025938 | Bacteria | 592 |
| 195 | Ga0207704_11758723 | 3300025938 | Unclassified | 533 |
| 196 | Ga0207691_10035359 | 3300025940 | Bacteria | 4638 |
| 197 | Ga0207691_10058984 | 3300025940 | Bacteria | 3490 |
| 198 | Ga0207691_10362754 | 3300025940 | Unclassified | 1238 |
| 199 | Ga0207711_10310295 | 3300025941 | Bacteria | 1456 |
| 200 | Ga0207689_10215777 | 3300025942 | Bacteria | 1585 |
| 201 | Ga0207689_10421572 | 3300025942 | Bacteria | 1114 |
| 202 | Ga0207689_10607764 | 3300025942 | Bacteria | 920 |
| 203 | Ga0207661_11067918 | 3300025944 | Bacteria | 744 |
| 204 | Ga0207679_10075990 | 3300025945 | Bacteria | 2551 |
| 205 | Ga0207679_10741594 | 3300025945 | Bacteria | 893 |
| 206 | Ga0207667_10212263 | 3300025949 | Bacteria | 1984 |
| 207 | Ga0207651_10251827 | 3300025960 | Bacteria | 1445 |
| 208 | Ga0207651_10262357 | 3300025960 | Bacteria | 1419 |
| 209 | Ga0207651_11834337 | 3300025960 | Unclassified | 546 |
| 210 | Ga0207712_10016625 | 3300025961 | Bacteria | 4770 |
| 211 | Ga0207712_10065375 | 3300025961 | Bacteria | 2596 |
| 212 | Ga0207712_10067377 | 3300025961 | Bacteria | 2562 |
| 213 | Ga0207712_10407687 | 3300025961 | Unclassified | 1144 |
| 214 | Ga0207668_10141681 | 3300025972 | Bacteria | 1850 |
| 215 | Ga0207668_10372367 | 3300025972 | Bacteria | 1200 |
| 216 | Ga0207640_10910739 | 3300025981 | Bacteria | 769 |
| 217 | Ga0207640_12008459 | 3300025981 | Unclassified | 524 |
| 218 | Ga0207658_10203293 | 3300025986 | Bacteria | 1655 |
| 219 | Ga0207658_10337818 | 3300025986 | Bacteria | 1308 |
| 220 | Ga0207677_10051727 | 3300026023 | Bacteria | 2787 |
| 221 | Ga0207677_10885650 | 3300026023 | Bacteria | 804 |
| 222 | Ga0207703_10130728 | 3300026035 | Bacteria | 2168 |
| 223 | Ga0207703_10701910 | 3300026035 | Bacteria | 962 |
| 224 | Ga0207639_10005815 | 3300026041 | Bacteria | 8357 |
| 225 | Ga0207639_12195410 | 3300026041 | Unclassified | 513 |
| 226 | Ga0207678_10377254 | 3300026067 | Bacteria | 1226 |
| 227 | Ga0207641_10107687 | 3300026088 | Bacteria | 2465 |
| 228 | Ga0207641_12530329 | 3300026088 | Unclassified | 511 |
| 229 | Ga0207648_10112550 | 3300026089 | Bacteria | 2390 |
| 230 | Ga0207648_10306938 | 3300026089 | Bacteria | 1424 |
| 231 | Ga0207676_10041969 | 3300026095 | Bacteria | 3516 |
| 232 | Ga0207676_10100893 | 3300026095 | Bacteria | 2392 |
| 233 | Ga0207674_10095428 | 3300026116 | Bacteria | 2960 |
| 234 | Ga0207675_101261917 | 3300026118 | Bacteria | 759 |
| 235 | Ga0207683_10151683 | 3300026121 | Bacteria | 2091 |
| 236 | Ga0207683_10564693 | 3300026121 | Unclassified | 1052 |
| 237 | Ga0207683_10914892 | 3300026121 | Bacteria | 814 |
| 238 | Ga0207698_10686070 | 3300026142 | Bacteria | 1018 |
| 239 | Ga0207698_10984127 | 3300026142 | Bacteria | 854 |
| 240 | Ga0209974_10148298 | 3300027876 | Unclassified | 845 |
| 241 | Ga0207428_10377396 | 3300027907 | Bacteria | 1040 |
| 242 | Ga0268265_10037227 | 3300028380 | Bacteria | 3569 |
| 243 | Ga0268265_10784363 | 3300028380 | Bacteria | 927 |
| 244 | Ga0268265_11059250 | 3300028380 | Bacteria | 803 |
| 245 | Ga0268264_10012583 | 3300028381 | Bacteria | 6969 |
| 246 | Ga0268264_10023783 | 3300028381 | Bacteria | 4998 |
| 247 | Ga0268264_10909941 | 3300028381 | Unclassified | 883 |
| 248 | Ga0268264_11030166 | 3300028381 | Unclassified | 830 |
| 249 | Ga0268264_11747932 | 3300028381 | Bacteria | 632 |
| 250 | Ga0265336_10104992 | 3300028666 | Unclassified | 841 |
| 251 | Ga0307408_100062020 | 3300031548 | Bacteria | 2731 |
| 252 | Ga0307408_100083808 | 3300031548 | Unclassified | 2390 |
| 253 | Ga0307408_100277210 | 3300031548 | Unclassified | 1395 |
| 254 | Ga0307408_100313658 | 3300031548 | Bacteria | 1318 |
| 255 | Ga0307408_100610687 | 3300031548 | Bacteria | 970 |
| 256 | Ga0307405_10068905 | 3300031731 | Bacteria | 2266 |
| 257 | Ga0307405_10101916 | 3300031731 | Bacteria | 1927 |
| 258 | Ga0307405_10219433 | 3300031731 | Bacteria | 1394 |
| 259 | Ga0307405_11137482 | 3300031731 | Unclassified | 672 |
| 260 | Ga0307413_10004625 | 3300031824 | Bacteria | 6017 |
| 261 | Ga0307413_10015890 | 3300031824 | Bacteria | 3871 |
| 262 | Ga0307413_10028181 | 3300031824 | Bacteria | 3123 |
| 263 | Ga0307413_10079153 | 3300031824 | Bacteria | 2100 |
| 264 | Ga0307410_10003713 | 3300031852 | Bacteria | 7727 |
| 265 | Ga0307410_10003862 | 3300031852 | Bacteria | 7618 |
| 266 | Ga0307410_10011896 | 3300031852 | Bacteria | 5002 |
| 267 | Ga0307410_10040173 | 3300031852 | Bacteria | 3077 |
| 268 | Ga0307410_10167181 | 3300031852 | Bacteria | 1654 |
| 269 | Ga0307410_10223596 | 3300031852 | Bacteria | 1449 |
| 270 | Ga0307410_10351655 | 3300031852 | Bacteria | 1178 |
| 271 | Ga0307410_10458548 | 3300031852 | Bacteria | 1041 |
| 272 | Ga0307406_10008415 | 3300031901 | Bacteria | 5753 |
| 273 | Ga0307406_10075785 | 3300031901 | Unclassified | 2220 |
| 274 | Ga0307406_10100866 | 3300031901 | Bacteria | 1966 |
| 275 | Ga0307406_10146172 | 3300031901 | Bacteria | 1680 |
| 276 | Ga0307406_10395780 | 3300031901 | Bacteria | 1093 |
| 277 | Ga0307407_10084239 | 3300031903 | Bacteria | 1931 |
| 278 | Ga0307407_10119086 | 3300031903 | Bacteria | 1670 |
| 279 | Ga0307407_10137176 | 3300031903 | Bacteria | 1573 |
| 280 | Ga0307407_10147319 | 3300031903 | Bacteria | 1526 |
| 281 | Ga0307407_10151533 | 3300031903 | Bacteria | 1507 |
| 282 | Ga0307407_11009763 | 3300031903 | Unclassified | 643 |
| 283 | Ga0307412_10021792 | 3300031911 | Bacteria | 3919 |
| 284 | Ga0307412_10161827 | 3300031911 | Bacteria | 1664 |
| 285 | Ga0307409_100016440 | 3300031995 | Bacteria | 4895 |
| 286 | Ga0307409_100020036 | 3300031995 | Bacteria | 4547 |
| 287 | Ga0307409_100022996 | 3300031995 | Bacteria | 4309 |
| 288 | Ga0307409_100050242 | 3300031995 | Bacteria | 3184 |
| 289 | Ga0307409_100401331 | 3300031995 | Bacteria | 1309 |
| 290 | Ga0307409_100483908 | 3300031995 | Bacteria | 1201 |
| 291 | Ga0307416_100011923 | 3300032002 | Bacteria | 5831 |
| 292 | Ga0307416_100256601 | 3300032002 | Bacteria | 1705 |
| 293 | Ga0307416_100288474 | 3300032002 | Bacteria | 1623 |
| 294 | Ga0307416_100300972 | 3300032002 | Bacteria | 1594 |
| 295 | Ga0307416_100654736 | 3300032002 | Bacteria | 1135 |
| 296 | Ga0307414_10035221 | 3300032004 | Bacteria | 3329 |
| 297 | Ga0307414_10046945 | 3300032004 | Bacteria | 2969 |
| 298 | Ga0307414_10176544 | 3300032004 | Bacteria | 1714 |
| 299 | Ga0307414_11280194 | 3300032004 | Unclassified | 680 |
| 300 | Ga0307414_12174825 | 3300032004 | Bacteria | 518 |
| 301 | Ga0307411_10001470 | 3300032005 | Bacteria | 9670 |
| 302 | Ga0307411_10006416 | 3300032005 | Bacteria | 5884 |
| 303 | Ga0307411_10083590 | 3300032005 | Bacteria | 2205 |
| 304 | Ga0307411_10174845 | 3300032005 | Bacteria | 1623 |
| 305 | Ga0307411_11435578 | 3300032005 | Bacteria | 632 |
| 306 | Ga0307411_11553591 | 3300032005 | Unclassified | 609 |
| 307 | Ga0307415_100006754 | 3300032126 | Bacteria | 6220 |
| 308 | Ga0307415_100008783 | 3300032126 | Bacteria | 5624 |
| 309 | Ga0307415_100069751 | 3300032126 | Bacteria | 2466 |
| 310 | Ga0307415_100159101 | 3300032126 | Bacteria | 1748 |
| 311 | Ga0307415_100630662 | 3300032126 | Bacteria | 958 |
| 312 | Ga0436362_1285648 | 3300039453 | Bacteria | 1222 |
| 313 | Ga0451789_0603677 | 3300041443 | Bacteria | 582 |
| 314 | Ga0451791_1406720 | 3300041451 | Bacteria | 1082 |
| 315 | Ga0451791_1531823 | 3300041451 | Bacteria | 743 |
| 316 | Ga0451807_1151657 | 3300041486 | Bacteria | 855 |
| 317 | Ga0451837_0063136 | 3300041494 | Bacteria | 2956 |
| 318 | Ga0466961_0031519 | 3300044693 | Bacteria | 3408 |
| 319 | Ga0451576_1676365 | 3300045051 | Bacteria | 659 |
| 320 | Ga0495672_0191506 | 3300047320 | Bacteria | 1028 |
| 321 | Ga0496104_0844500 | 3300048907 | Bacteria | 821 |
| 322 | Ga0496105_0472228 | 3300048908 | Bacteria | 988 |
| 323 | Ga0496109_0340484 | 3300048912 | Bacteria | 1416 |
| 324 | Ga0496111_0624403 | 3300048914 | Bacteria | 788 |
| 325 | Ga0496112_1356817 | 3300048915 | Bacteria | 626 |
| 326 | Ga0496114_0385970 | 3300048917 | Bacteria | 1240 |
| 327 | Ga0501292_014022 | 3300049515 | Unclassified | 1238 |
| 328 | Ga0501072_0002774 | 3300049588 | Bacteria | 13167 |
| 329 | Ga0501216_004602 | 3300049660 | Unclassified | 2052 |
| 330 | Ga0501217_030293 | 3300049661 | Bacteria | 1328 |
| 331 | Ga0501233_253684 | 3300049668 | Unclassified | 530 |
| 332 | Ga0501235_025127 | 3300049669 | Bacteria | 1332 |
| 333 | Ga0501242_016230 | 3300049674 | Bacteria | 931 |
| 334 | Ga0501242_032322 | 3300049674 | Bacteria | 713 |
| 335 | Ga0501247_008872 | 3300049677 | Bacteria | 1180 |
| 336 | Ga0501249_078880 | 3300049679 | Unclassified | 773 |
| 337 | Ga0501257_033197 | 3300049686 | Bacteria | 1250 |
| 338 | Ga0501257_065392 | 3300049686 | Unclassified | 923 |
| 339 | Ga0501258_011939 | 3300049687 | Unclassified | 937 |
| 340 | Ga0501221_013208 | 3300049704 | Bacteria | 1516 |
| 341 | Ga0501263_011189 | 3300049760 | Bacteria | 1110 |
| 342 | Ga0501268_001076 | 3300049765 | Bacteria | 3277 |
| 343 | Ga0501270_012726 | 3300049767 | Bacteria | 1154 |
| 344 | Ga0501272_005218 | 3300049769 | Bacteria | 1364 |
| 345 | Ga0501273_013161 | 3300049770 | Unclassified | 1052 |
| 346 | nmdc:mga08y16_60998_c1 | 3300050511 | Bacteria | 3938 |
| 347 | Ga0590071_170189 | 3300059421 | Archaea | 569 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100828717 | Ga0070671_1008287171 | 79 |
| 2 | 3300025925 | Ga0207650_11003007 | Ga0207650_110030072 | 79 |
| 3 | 3300025931 | Ga0207644_10754648 | Ga0207644_107546483 | 79 |
| 4 | 3300026121 | Ga0207683_10914892 | Ga0207683_109148922 | 79 |
| 5 | 3300005333 | Ga0070677_10267277 | Ga0070677_102672773 | 80 |
| 6 | 3300005356 | Ga0070674_100138966 | Ga0070674_1001389662 | 80 |
| 7 | 3300005364 | Ga0070673_102290344 | Ga0070673_1022903441 | 80 |
| 8 | 3300005456 | Ga0070678_100546409 | Ga0070678_1005464092 | 80 |
| 9 | 3300005471 | Ga0070698_100074861 | Ga0070698_1000748613 | 80 |
| 10 | 3300005543 | Ga0070672_101409497 | Ga0070672_1014094972 | 80 |
| 11 | 3300005578 | Ga0068854_101378480 | Ga0068854_1013784802 | 80 |
| 12 | 3300005616 | Ga0068852_100401202 | Ga0068852_1004012023 | 80 |
| 13 | 3300006358 | Ga0068871_101477074 | Ga0068871_1014770742 | 80 |
| 14 | 3300013104 | Ga0157370_10831118 | Ga0157370_108311182 | 80 |
| 15 | 3300013296 | Ga0157374_10052744 | Ga0157374_100527442 | 80 |
| 16 | 3300013306 | Ga0163162_10711471 | Ga0163162_107114712 | 80 |
| 17 | 3300013308 | Ga0157375_10057210 | Ga0157375_100572104 | 80 |
| 18 | 3300014969 | Ga0157376_11388311 | Ga0157376_113883112 | 80 |
| 19 | 3300017792 | Ga0163161_10001466 | Ga0163161_100014663 | 80 |
| 20 | 3300025909 | Ga0207705_10002127 | Ga0207705_100021276 | 80 |
| 21 | 3300025925 | Ga0207650_10336809 | Ga0207650_103368092 | 80 |
| 22 | 3300025931 | Ga0207644_11128096 | Ga0207644_111280962 | 80 |
| 23 | 3300025937 | Ga0207669_10150411 | Ga0207669_101504112 | 80 |
| 24 | 3300025940 | Ga0207691_10362754 | Ga0207691_103627542 | 80 |
| 25 | 3300025960 | Ga0207651_11834337 | Ga0207651_118343372 | 80 |
| 26 | 3300026041 | Ga0207639_12195410 | Ga0207639_121954102 | 80 |
| 27 | 3300026142 | Ga0207698_10686070 | Ga0207698_106860702 | 80 |
| 28 | 3300026142 | Ga0207698_10984127 | Ga0207698_109841272 | 80 |
| 29 | 3300031548 | Ga0307408_100083808 | Ga0307408_1000838083 | 80 |
| 30 | 3300031731 | Ga0307405_11137482 | Ga0307405_111374822 | 80 |
| 31 | 3300031824 | Ga0307413_10079153 | Ga0307413_100791534 | 80 |
| 32 | 3300031852 | Ga0307410_10003862 | Ga0307410_100038624 | 80 |
| 33 | 3300031901 | Ga0307406_10075785 | Ga0307406_100757853 | 80 |
| 34 | 3300031903 | Ga0307407_10137176 | Ga0307407_101371763 | 80 |
| 35 | 3300031911 | Ga0307412_10021792 | Ga0307412_100217924 | 80 |
| 36 | 3300031995 | Ga0307409_100401331 | Ga0307409_1004013311 | 80 |
| 37 | 3300032002 | Ga0307416_100256601 | Ga0307416_1002566012 | 80 |
| 38 | 3300032004 | Ga0307414_10046945 | Ga0307414_100469454 | 80 |
| 39 | 3300032005 | Ga0307411_10001470 | Ga0307411_100014707 | 80 |
| 40 | 3300032126 | Ga0307415_100159101 | Ga0307415_1001591013 | 80 |
| 41 | 3300049515 | Ga0501292_014022 | Ga0501292_014022_524_766 | 80 |
| 42 | 3300049674 | Ga0501242_032322 | Ga0501242_032322_179_421 | 80 |
| 43 | 3300049679 | Ga0501249_078880 | Ga0501249_078880_161_403 | 80 |
| 44 | 3300049686 | Ga0501257_033197 | Ga0501257_033197_833_1075 | 80 |
| 45 | 3300049687 | Ga0501258_011939 | Ga0501258_011939_120_362 | 80 |
| 46 | 3300049704 | Ga0501221_013208 | Ga0501221_013208_733_975 | 80 |
| 47 | 3300049769 | Ga0501272_005218 | Ga0501272_005218_183_425 | 80 |
| 48 | 3300005289 | Ga0065704_10224818 | Ga0065704_102248183 | 81 |
| 49 | 3300005290 | Ga0065712_10129989 | Ga0065712_101299892 | 81 |
| 50 | 3300005293 | Ga0065715_10988937 | Ga0065715_109889372 | 81 |
| 51 | 3300005330 | Ga0070690_100257088 | Ga0070690_1002570881 | 81 |
| 52 | 3300005331 | Ga0070670_100002158 | Ga0070670_1000021582 | 81 |
| 53 | 3300005331 | Ga0070670_100063757 | Ga0070670_1000637572 | 81 |
| 54 | 3300005333 | Ga0070677_10255217 | Ga0070677_102552172 | 81 |
| 55 | 3300005333 | Ga0070677_10289275 | Ga0070677_102892752 | 81 |
| 56 | 3300005334 | Ga0068869_100164796 | Ga0068869_1001647963 | 81 |
| 57 | 3300005334 | Ga0068869_101078751 | Ga0068869_1010787512 | 81 |
| 58 | 3300005335 | Ga0070666_10030634 | Ga0070666_100306345 | 81 |
| 59 | 3300005338 | Ga0068868_100303402 | Ga0068868_1003034022 | 81 |
| 60 | 3300005338 | Ga0068868_100549872 | Ga0068868_1005498722 | 81 |
| 61 | 3300005340 | Ga0070689_100407055 | Ga0070689_1004070551 | 81 |
| 62 | 3300005345 | Ga0070692_10489263 | Ga0070692_104892632 | 81 |
| 63 | 3300005347 | Ga0070668_100161281 | Ga0070668_1001612812 | 81 |
| 64 | 3300005347 | Ga0070668_100235874 | Ga0070668_1002358742 | 81 |
| 65 | 3300005347 | Ga0070668_100383822 | Ga0070668_1003838223 | 81 |
| 66 | 3300005354 | Ga0070675_100012592 | Ga0070675_10001259210 | 81 |
| 67 | 3300005354 | Ga0070675_100097301 | Ga0070675_1000973013 | 81 |
| 68 | 3300005354 | Ga0070675_100370880 | Ga0070675_1003708802 | 81 |
| 69 | 3300005355 | Ga0070671_100247865 | Ga0070671_1002478653 | 81 |
| 70 | 3300005355 | Ga0070671_100275439 | Ga0070671_1002754392 | 81 |
| 71 | 3300005355 | Ga0070671_100419213 | Ga0070671_1004192132 | 81 |
| 72 | 3300005356 | Ga0070674_100014135 | Ga0070674_1000141352 | 81 |
| 73 | 3300005364 | Ga0070673_100095529 | Ga0070673_1000955292 | 81 |
| 74 | 3300005365 | Ga0070688_100735000 | Ga0070688_1007350002 | 81 |
| 75 | 3300005366 | Ga0070659_101089362 | Ga0070659_1010893622 | 81 |
| 76 | 3300005367 | Ga0070667_100018385 | Ga0070667_1000183856 | 81 |
| 77 | 3300005367 | Ga0070667_100233105 | Ga0070667_1002331052 | 81 |
| 78 | 3300005438 | Ga0070701_10363676 | Ga0070701_103636762 | 81 |
| 79 | 3300005455 | Ga0070663_100996178 | Ga0070663_1009961782 | 81 |
| 80 | 3300005456 | Ga0070678_100052484 | Ga0070678_1000524842 | 81 |
| 81 | 3300005456 | Ga0070678_100543759 | Ga0070678_1005437592 | 81 |
| 82 | 3300005457 | Ga0070662_100283923 | Ga0070662_1002839232 | 81 |
| 83 | 3300005459 | Ga0068867_100120024 | Ga0068867_1001200242 | 81 |
| 84 | 3300005459 | Ga0068867_100187963 | Ga0068867_1001879632 | 81 |
| 85 | 3300005459 | Ga0068867_100443675 | Ga0068867_1004436752 | 81 |
| 86 | 3300005459 | Ga0068867_101286579 | Ga0068867_1012865791 | 81 |
| 87 | 3300005459 | Ga0068867_102211133 | Ga0068867_1022111331 | 81 |
| 88 | 3300005466 | Ga0070685_10051358 | Ga0070685_100513584 | 81 |
| 89 | 3300005466 | Ga0070685_11101483 | Ga0070685_111014831 | 81 |
| 90 | 3300005530 | Ga0070679_101123177 | Ga0070679_1011231772 | 81 |
| 91 | 3300005535 | Ga0070684_100736731 | Ga0070684_1007367313 | 81 |
| 92 | 3300005535 | Ga0070684_101545610 | Ga0070684_1015456102 | 81 |
| 93 | 3300005539 | Ga0068853_100062432 | Ga0068853_1000624323 | 81 |
| 94 | 3300005543 | Ga0070672_100044127 | Ga0070672_1000441276 | 81 |
| 95 | 3300005543 | Ga0070672_100049218 | Ga0070672_1000492183 | 81 |
| 96 | 3300005544 | Ga0070686_100092081 | Ga0070686_1000920813 | 81 |
| 97 | 3300005546 | Ga0070696_100741622 | Ga0070696_1007416221 | 81 |
| 98 | 3300005563 | Ga0068855_100403025 | Ga0068855_1004030253 | 81 |
| 99 | 3300005564 | Ga0070664_100040892 | Ga0070664_1000408924 | 81 |
| 100 | 3300005564 | Ga0070664_100227758 | Ga0070664_1002277583 | 81 |
| 101 | 3300005564 | Ga0070664_100861576 | Ga0070664_1008615762 | 81 |
| 102 | 3300005577 | Ga0068857_100980503 | Ga0068857_1009805032 | 81 |
| 103 | 3300005578 | Ga0068854_102264558 | Ga0068854_1022645582 | 81 |
| 104 | 3300005615 | Ga0070702_100027864 | Ga0070702_1000278644 | 81 |
| 105 | 3300005616 | Ga0068852_100808943 | Ga0068852_1008089432 | 81 |
| 106 | 3300005617 | Ga0068859_100028886 | Ga0068859_1000288868 | 81 |
| 107 | 3300005617 | Ga0068859_100748102 | Ga0068859_1007481022 | 81 |
| 108 | 3300005618 | Ga0068864_100226039 | Ga0068864_1002260394 | 81 |
| 109 | 3300005618 | Ga0068864_100612672 | Ga0068864_1006126723 | 81 |
| 110 | 3300005618 | Ga0068864_101374645 | Ga0068864_1013746452 | 81 |
| 111 | 3300005718 | Ga0068866_11005045 | Ga0068866_110050452 | 81 |
| 112 | 3300005719 | Ga0068861_100743334 | Ga0068861_1007433342 | 81 |
| 113 | 3300005719 | Ga0068861_101359665 | Ga0068861_1013596652 | 81 |
| 114 | 3300005840 | Ga0068870_10664736 | Ga0068870_106647362 | 81 |
| 115 | 3300005841 | Ga0068863_100491758 | Ga0068863_1004917582 | 81 |
| 116 | 3300005841 | Ga0068863_100807993 | Ga0068863_1008079931 | 81 |
| 117 | 3300005841 | Ga0068863_102737876 | Ga0068863_1027378762 | 81 |
| 118 | 3300005842 | Ga0068858_100113671 | Ga0068858_1001136714 | 81 |
| 119 | 3300005842 | Ga0068858_100285193 | Ga0068858_1002851933 | 81 |
| 120 | 3300005842 | Ga0068858_100371581 | Ga0068858_1003715812 | 81 |
| 121 | 3300005843 | Ga0068860_100043733 | Ga0068860_1000437332 | 81 |
| 122 | 3300005843 | Ga0068860_100070878 | Ga0068860_1000708783 | 81 |
| 123 | 3300005843 | Ga0068860_100081286 | Ga0068860_1000812865 | 81 |
| 124 | 3300005843 | Ga0068860_100689325 | Ga0068860_1006893251 | 81 |
| 125 | 3300005844 | Ga0068862_100510987 | Ga0068862_1005109873 | 81 |
| 126 | 3300005844 | Ga0068862_100745040 | Ga0068862_1007450402 | 81 |
| 127 | 3300006237 | Ga0097621_100101460 | Ga0097621_1001014602 | 81 |
| 128 | 3300006237 | Ga0097621_100171739 | Ga0097621_1001717394 | 81 |
| 129 | 3300006237 | Ga0097621_100824757 | Ga0097621_1008247572 | 81 |
| 130 | 3300006358 | Ga0068871_100062040 | Ga0068871_1000620405 | 81 |
| 131 | 3300006358 | Ga0068871_100132219 | Ga0068871_1001322191 | 81 |
| 132 | 3300006358 | Ga0068871_100339619 | Ga0068871_1003396192 | 81 |
| 133 | 3300006844 | Ga0075428_101706582 | Ga0075428_1017065821 | 81 |
| 134 | 3300006881 | Ga0068865_100057112 | Ga0068865_1000571122 | 81 |
| 135 | 3300006881 | Ga0068865_100386981 | Ga0068865_1003869812 | 81 |
| 136 | 3300006881 | Ga0068865_100445661 | Ga0068865_1004456613 | 81 |
| 137 | 3300006931 | Ga0097620_100028886 | Ga0097620_1000288868 | 81 |
| 138 | 3300006931 | Ga0097620_100748102 | Ga0097620_1007481022 | 81 |
| 139 | 3300009093 | Ga0105240_11643064 | Ga0105240_116430642 | 81 |
| 140 | 3300009094 | Ga0111539_10021901 | Ga0111539_100219012 | 81 |
| 141 | 3300009098 | Ga0105245_11749096 | Ga0105245_117490962 | 81 |
| 142 | 3300009101 | Ga0105247_10011609 | Ga0105247_100116098 | 81 |
| 143 | 3300009174 | Ga0105241_11302895 | Ga0105241_113028952 | 81 |
| 144 | 3300009176 | Ga0105242_10104992 | Ga0105242_101049923 | 81 |
| 145 | 3300009176 | Ga0105242_10521359 | Ga0105242_105213592 | 81 |
| 146 | 3300009176 | Ga0105242_11644675 | Ga0105242_116446752 | 81 |
| 147 | 3300009176 | Ga0105242_11972115 | Ga0105242_119721152 | 81 |
| 148 | 3300009177 | Ga0105248_10141095 | Ga0105248_101410954 | 81 |
| 149 | 3300009177 | Ga0105248_10221020 | Ga0105248_102210202 | 81 |
| 150 | 3300009177 | Ga0105248_12038294 | Ga0105248_120382942 | 81 |
| 151 | 3300009545 | Ga0105237_11531729 | Ga0105237_115317292 | 81 |
| 152 | 3300009553 | Ga0105249_10062297 | Ga0105249_100622975 | 81 |
| 153 | 3300009553 | Ga0105249_10092131 | Ga0105249_100921312 | 81 |
| 154 | 3300009553 | Ga0105249_10146072 | Ga0105249_101460723 | 81 |
| 155 | 3300009553 | Ga0105249_10178666 | Ga0105249_101786662 | 81 |
| 156 | 3300010375 | Ga0105239_11023880 | Ga0105239_110238802 | 81 |
| 157 | 3300011119 | Ga0105246_10885757 | Ga0105246_108857572 | 81 |
| 158 | 3300011119 | Ga0105246_11436446 | Ga0105246_114364462 | 81 |
| 159 | 3300013102 | Ga0157371_10122033 | Ga0157371_101220333 | 81 |
| 160 | 3300013105 | Ga0157369_11351627 | Ga0157369_113516272 | 81 |
| 161 | 3300013296 | Ga0157374_11032147 | Ga0157374_110321472 | 81 |
| 162 | 3300013296 | Ga0157374_11307028 | Ga0157374_113070282 | 81 |
| 163 | 3300013296 | Ga0157374_12836307 | Ga0157374_128363072 | 81 |
| 164 | 3300013297 | Ga0157378_10561142 | Ga0157378_105611422 | 81 |
| 165 | 3300013297 | Ga0157378_11925263 | Ga0157378_119252632 | 81 |
| 166 | 3300013297 | Ga0157378_11974889 | Ga0157378_119748891 | 81 |
| 167 | 3300013297 | Ga0157378_12877036 | Ga0157378_128770362 | 81 |
| 168 | 3300013306 | Ga0163162_10043788 | Ga0163162_100437885 | 81 |
| 169 | 3300013306 | Ga0163162_10164524 | Ga0163162_101645243 | 81 |
| 170 | 3300013306 | Ga0163162_10202247 | Ga0163162_102022474 | 81 |
| 171 | 3300013306 | Ga0163162_10715635 | Ga0163162_107156351 | 81 |
| 172 | 3300013306 | Ga0163162_11725308 | Ga0163162_117253082 | 81 |
| 173 | 3300013307 | Ga0157372_10311429 | Ga0157372_103114293 | 81 |
| 174 | 3300013308 | Ga0157375_10135044 | Ga0157375_101350444 | 81 |
| 175 | 3300013308 | Ga0157375_10158199 | Ga0157375_101581993 | 81 |
| 176 | 3300013308 | Ga0157375_10232528 | Ga0157375_102325283 | 81 |
| 177 | 3300013308 | Ga0157375_10680199 | Ga0157375_106801992 | 81 |
| 178 | 3300013308 | Ga0157375_10684405 | Ga0157375_106844052 | 81 |
| 179 | 3300013308 | Ga0157375_13644799 | Ga0157375_136447992 | 81 |
| 180 | 3300013308 | Ga0157375_13644800 | Ga0157375_136448002 | 81 |
| 181 | 3300014325 | Ga0163163_10015220 | Ga0163163_1001522010 | 81 |
| 182 | 3300014325 | Ga0163163_10263905 | Ga0163163_102639052 | 81 |
| 183 | 3300014325 | Ga0163163_10501278 | Ga0163163_105012784 | 81 |
| 184 | 3300014325 | Ga0163163_10646002 | Ga0163163_106460022 | 81 |
| 185 | 3300014325 | Ga0163163_11851606 | Ga0163163_118516062 | 81 |
| 186 | 3300014326 | Ga0157380_10169324 | Ga0157380_101693242 | 81 |
| 187 | 3300014326 | Ga0157380_10340393 | Ga0157380_103403932 | 81 |
| 188 | 3300014326 | Ga0157380_10433909 | Ga0157380_104339093 | 81 |
| 189 | 3300014745 | Ga0157377_10100259 | Ga0157377_101002592 | 81 |
| 190 | 3300014745 | Ga0157377_11095152 | Ga0157377_110951522 | 81 |
| 191 | 3300014969 | Ga0157376_10034478 | Ga0157376_100344783 | 81 |
| 192 | 3300014969 | Ga0157376_10101954 | Ga0157376_101019542 | 81 |
| 193 | 3300014969 | Ga0157376_10422273 | Ga0157376_104222732 | 81 |
| 194 | 3300014969 | Ga0157376_10985435 | Ga0157376_109854352 | 81 |
| 195 | 3300014969 | Ga0157376_11121471 | Ga0157376_111214712 | 81 |
| 196 | 3300017792 | Ga0163161_10036276 | Ga0163161_100362762 | 81 |
| 197 | 3300017792 | Ga0163161_10080449 | Ga0163161_100804494 | 81 |
| 198 | 3300025315 | Ga0207697_10096294 | Ga0207697_100962943 | 81 |
| 199 | 3300025893 | Ga0207682_10049979 | Ga0207682_100499794 | 81 |
| 200 | 3300025899 | Ga0207642_10893335 | Ga0207642_108933352 | 81 |
| 201 | 3300025900 | Ga0207710_10015790 | Ga0207710_100157903 | 81 |
| 202 | 3300025908 | Ga0207643_10038796 | Ga0207643_100387965 | 81 |
| 203 | 3300025911 | Ga0207654_10405134 | Ga0207654_104051342 | 81 |
| 204 | 3300025921 | Ga0207652_10965372 | Ga0207652_109653722 | 81 |
| 205 | 3300025925 | Ga0207650_10031089 | Ga0207650_100310893 | 81 |
| 206 | 3300025925 | Ga0207650_10126450 | Ga0207650_101264504 | 81 |
| 207 | 3300025925 | Ga0207650_10615292 | Ga0207650_106152922 | 81 |
| 208 | 3300025926 | Ga0207659_10131632 | Ga0207659_101316322 | 81 |
| 209 | 3300025926 | Ga0207659_10396791 | Ga0207659_103967912 | 81 |
| 210 | 3300025926 | Ga0207659_10557900 | Ga0207659_105579002 | 81 |
| 211 | 3300025933 | Ga0207706_10133276 | Ga0207706_101332762 | 81 |
| 212 | 3300025936 | Ga0207670_10430750 | Ga0207670_104307502 | 81 |
| 213 | 3300025936 | Ga0207670_11186924 | Ga0207670_111869242 | 81 |
| 214 | 3300025937 | Ga0207669_10553647 | Ga0207669_105536472 | 81 |
| 215 | 3300025937 | Ga0207669_10701183 | Ga0207669_107011832 | 81 |
| 216 | 3300025938 | Ga0207704_10321466 | Ga0207704_103214662 | 81 |
| 217 | 3300025938 | Ga0207704_10444012 | Ga0207704_104440122 | 81 |
| 218 | 3300025938 | Ga0207704_10930372 | Ga0207704_109303722 | 81 |
| 219 | 3300025938 | Ga0207704_11434988 | Ga0207704_114349882 | 81 |
| 220 | 3300025938 | Ga0207704_11758723 | Ga0207704_117587232 | 81 |
| 221 | 3300025940 | Ga0207691_10035359 | Ga0207691_100353592 | 81 |
| 222 | 3300025940 | Ga0207691_10058984 | Ga0207691_100589842 | 81 |
| 223 | 3300025941 | Ga0207711_10310295 | Ga0207711_103102952 | 81 |
| 224 | 3300025942 | Ga0207689_10215777 | Ga0207689_102157773 | 81 |
| 225 | 3300025942 | Ga0207689_10421572 | Ga0207689_104215722 | 81 |
| 226 | 3300025942 | Ga0207689_10607764 | Ga0207689_106077641 | 81 |
| 227 | 3300025944 | Ga0207661_11067918 | Ga0207661_110679182 | 81 |
| 228 | 3300025945 | Ga0207679_10075990 | Ga0207679_100759902 | 81 |
| 229 | 3300025945 | Ga0207679_10741594 | Ga0207679_107415942 | 81 |
| 230 | 3300025949 | Ga0207667_10212263 | Ga0207667_102122633 | 81 |
| 231 | 3300025960 | Ga0207651_10251827 | Ga0207651_102518274 | 81 |
| 232 | 3300025960 | Ga0207651_10262357 | Ga0207651_102623573 | 81 |
| 233 | 3300025961 | Ga0207712_10016625 | Ga0207712_100166253 | 81 |
| 234 | 3300025961 | Ga0207712_10065375 | Ga0207712_100653754 | 81 |
| 235 | 3300025961 | Ga0207712_10067377 | Ga0207712_100673774 | 81 |
| 236 | 3300025961 | Ga0207712_10407687 | Ga0207712_104076873 | 81 |
| 237 | 3300025972 | Ga0207668_10141681 | Ga0207668_101416812 | 81 |
| 238 | 3300025972 | Ga0207668_10372367 | Ga0207668_103723673 | 81 |
| 239 | 3300025981 | Ga0207640_10910739 | Ga0207640_109107391 | 81 |
| 240 | 3300025981 | Ga0207640_12008459 | Ga0207640_120084591 | 81 |
| 241 | 3300025986 | Ga0207658_10203293 | Ga0207658_102032933 | 81 |
| 242 | 3300025986 | Ga0207658_10337818 | Ga0207658_103378182 | 81 |
| 243 | 3300026023 | Ga0207677_10051727 | Ga0207677_100517275 | 81 |
| 244 | 3300026023 | Ga0207677_10885650 | Ga0207677_108856502 | 81 |
| 245 | 3300026035 | Ga0207703_10130728 | Ga0207703_101307283 | 81 |
| 246 | 3300026035 | Ga0207703_10701910 | Ga0207703_107019103 | 81 |
| 247 | 3300026041 | Ga0207639_10005815 | Ga0207639_100058154 | 81 |
| 248 | 3300026067 | Ga0207678_10377254 | Ga0207678_103772542 | 81 |
| 249 | 3300026088 | Ga0207641_10107687 | Ga0207641_101076872 | 81 |
| 250 | 3300026088 | Ga0207641_12530329 | Ga0207641_125303292 | 81 |
| 251 | 3300026089 | Ga0207648_10112550 | Ga0207648_101125502 | 81 |
| 252 | 3300026089 | Ga0207648_10306938 | Ga0207648_103069382 | 81 |
| 253 | 3300026095 | Ga0207676_10041969 | Ga0207676_100419692 | 81 |
| 254 | 3300026095 | Ga0207676_10100893 | Ga0207676_101008932 | 81 |
| 255 | 3300026116 | Ga0207674_10095428 | Ga0207674_100954281 | 81 |
| 256 | 3300026118 | Ga0207675_101261917 | Ga0207675_1012619172 | 81 |
| 257 | 3300026121 | Ga0207683_10151683 | Ga0207683_101516834 | 81 |
| 258 | 3300026121 | Ga0207683_10564693 | Ga0207683_105646932 | 81 |
| 259 | 3300027876 | Ga0209974_10148298 | Ga0209974_101482983 | 81 |
| 260 | 3300027907 | Ga0207428_10377396 | Ga0207428_103773962 | 81 |
| 261 | 3300028380 | Ga0268265_10037227 | Ga0268265_100372276 | 81 |
| 262 | 3300028380 | Ga0268265_10784363 | Ga0268265_107843633 | 81 |
| 263 | 3300028380 | Ga0268265_11059250 | Ga0268265_110592502 | 81 |
| 264 | 3300028381 | Ga0268264_10012583 | Ga0268264_1001258311 | 81 |
| 265 | 3300028381 | Ga0268264_10023783 | Ga0268264_100237837 | 81 |
| 266 | 3300028381 | Ga0268264_10909941 | Ga0268264_109099413 | 81 |
| 267 | 3300028381 | Ga0268264_11030166 | Ga0268264_110301662 | 81 |
| 268 | 3300028381 | Ga0268264_11747932 | Ga0268264_117479321 | 81 |
| 269 | 3300028666 | Ga0265336_10104992 | Ga0265336_101049922 | 81 |
| 270 | 3300031548 | Ga0307408_100062020 | Ga0307408_1000620204 | 81 |
| 271 | 3300031548 | Ga0307408_100277210 | Ga0307408_1002772102 | 81 |
| 272 | 3300031548 | Ga0307408_100313658 | Ga0307408_1003136582 | 81 |
| 273 | 3300031548 | Ga0307408_100610687 | Ga0307408_1006106872 | 81 |
| 274 | 3300031731 | Ga0307405_10068905 | Ga0307405_100689052 | 81 |
| 275 | 3300031731 | Ga0307405_10101916 | Ga0307405_101019163 | 81 |
| 276 | 3300031731 | Ga0307405_10219433 | Ga0307405_102194332 | 81 |
| 277 | 3300031824 | Ga0307413_10004625 | Ga0307413_100046253 | 81 |
| 278 | 3300031824 | Ga0307413_10015890 | Ga0307413_100158903 | 81 |
| 279 | 3300031824 | Ga0307413_10028181 | Ga0307413_100281814 | 81 |
| 280 | 3300031852 | Ga0307410_10003713 | Ga0307410_100037132 | 81 |
| 281 | 3300031852 | Ga0307410_10011896 | Ga0307410_100118963 | 81 |
| 282 | 3300031852 | Ga0307410_10040173 | Ga0307410_100401733 | 81 |
| 283 | 3300031852 | Ga0307410_10167181 | Ga0307410_101671813 | 81 |
| 284 | 3300031852 | Ga0307410_10223596 | Ga0307410_102235963 | 81 |
| 285 | 3300031852 | Ga0307410_10351655 | Ga0307410_103516552 | 81 |
| 286 | 3300031852 | Ga0307410_10458548 | Ga0307410_104585483 | 81 |
| 287 | 3300031901 | Ga0307406_10008415 | Ga0307406_100084152 | 81 |
| 288 | 3300031901 | Ga0307406_10100866 | Ga0307406_101008662 | 81 |
| 289 | 3300031901 | Ga0307406_10146172 | Ga0307406_101461722 | 81 |
| 290 | 3300031901 | Ga0307406_10395780 | Ga0307406_103957802 | 81 |
| 291 | 3300031903 | Ga0307407_10084239 | Ga0307407_100842392 | 81 |
| 292 | 3300031903 | Ga0307407_10119086 | Ga0307407_101190862 | 81 |
| 293 | 3300031903 | Ga0307407_10147319 | Ga0307407_101473191 | 81 |
| 294 | 3300031903 | Ga0307407_10151533 | Ga0307407_101515332 | 81 |
| 295 | 3300031903 | Ga0307407_11009763 | Ga0307407_110097632 | 81 |
| 296 | 3300031911 | Ga0307412_10161827 | Ga0307412_101618272 | 81 |
| 297 | 3300031995 | Ga0307409_100016440 | Ga0307409_1000164405 | 81 |
| 298 | 3300031995 | Ga0307409_100020036 | Ga0307409_1000200365 | 81 |
| 299 | 3300031995 | Ga0307409_100022996 | Ga0307409_1000229962 | 81 |
| 300 | 3300031995 | Ga0307409_100050242 | Ga0307409_1000502424 | 81 |
| 301 | 3300031995 | Ga0307409_100483908 | Ga0307409_1004839082 | 81 |
| 302 | 3300032002 | Ga0307416_100011923 | Ga0307416_1000119237 | 81 |
| 303 | 3300032002 | Ga0307416_100288474 | Ga0307416_1002884742 | 81 |
| 304 | 3300032002 | Ga0307416_100300972 | Ga0307416_1003009722 | 81 |
| 305 | 3300032002 | Ga0307416_100654736 | Ga0307416_1006547362 | 81 |
| 306 | 3300032004 | Ga0307414_10035221 | Ga0307414_100352215 | 81 |
| 307 | 3300032004 | Ga0307414_10176544 | Ga0307414_101765442 | 81 |
| 308 | 3300032004 | Ga0307414_11280194 | Ga0307414_112801942 | 81 |
| 309 | 3300032004 | Ga0307414_12174825 | Ga0307414_121748252 | 81 |
| 310 | 3300032005 | Ga0307411_10006416 | Ga0307411_100064163 | 81 |
| 311 | 3300032005 | Ga0307411_10083590 | Ga0307411_100835903 | 81 |
| 312 | 3300032005 | Ga0307411_10174845 | Ga0307411_101748453 | 81 |
| 313 | 3300032005 | Ga0307411_11435578 | Ga0307411_114355782 | 81 |
| 314 | 3300032005 | Ga0307411_11553591 | Ga0307411_115535911 | 81 |
| 315 | 3300032126 | Ga0307415_100006754 | Ga0307415_1000067544 | 81 |
| 316 | 3300032126 | Ga0307415_100008783 | Ga0307415_1000087837 | 81 |
| 317 | 3300032126 | Ga0307415_100069751 | Ga0307415_1000697513 | 81 |
| 318 | 3300032126 | Ga0307415_100630662 | Ga0307415_1006306622 | 81 |
| 319 | 3300039453 | Ga0436362_1285648 | Ga0436362_1285648_449_697 | 81 |
| 320 | 3300041443 | Ga0451789_0603677 | Ga0451789_0603677_195_443 | 81 |
| 321 | 3300041451 | Ga0451791_1406720 | Ga0451791_1406720_414_665 | 81 |
| 322 | 3300041451 | Ga0451791_1531823 | Ga0451791_1531823_95_340 | 81 |
| 323 | 3300041486 | Ga0451807_1151657 | Ga0451807_1151657_467_715 | 81 |
| 324 | 3300041494 | Ga0451837_0063136 | Ga0451837_0063136_363_608 | 81 |
| 325 | 3300044693 | Ga0466961_0031519 | Ga0466961_0031519_444_698 | 81 |
| 326 | 3300045051 | Ga0451576_1676365 | Ga0451576_1676365_226_474 | 81 |
| 327 | 3300047320 | Ga0495672_0191506 | Ga0495672_0191506_303_551 | 81 |
| 328 | 3300048907 | Ga0496104_0844500 | Ga0496104_0844500_55_303 | 81 |
| 329 | 3300048908 | Ga0496105_0472228 | Ga0496105_0472228_207_455 | 81 |
| 330 | 3300048912 | Ga0496109_0340484 | Ga0496109_0340484_634_882 | 81 |
| 331 | 3300048914 | Ga0496111_0624403 | Ga0496111_0624403_513_761 | 81 |
| 332 | 3300048915 | Ga0496112_1356817 | Ga0496112_1356817_326_574 | 81 |
| 333 | 3300048917 | Ga0496114_0385970 | Ga0496114_0385970_457_705 | 81 |
| 334 | 3300049588 | Ga0501072_0002774 | Ga0501072_0002774_9057_9305 | 81 |
| 335 | 3300049660 | Ga0501216_004602 | Ga0501216_004602_1720_1968 | 81 |
| 336 | 3300049661 | Ga0501217_030293 | Ga0501217_030293_559_807 | 81 |
| 337 | 3300049668 | Ga0501233_253684 | Ga0501233_253684_172_417 | 81 |
| 338 | 3300049669 | Ga0501235_025127 | Ga0501235_025127_563_811 | 81 |
| 339 | 3300049674 | Ga0501242_016230 | Ga0501242_016230_489_737 | 81 |
| 340 | 3300049677 | Ga0501247_008872 | Ga0501247_008872_468_716 | 81 |
| 341 | 3300049686 | Ga0501257_065392 | Ga0501257_065392_96_344 | 81 |
| 342 | 3300049760 | Ga0501263_011189 | Ga0501263_011189_322_570 | 81 |
| 343 | 3300049765 | Ga0501268_001076 | Ga0501268_001076_127_375 | 81 |
| 344 | 3300049767 | Ga0501270_012726 | Ga0501270_012726_670_918 | 81 |
| 345 | 3300049770 | Ga0501273_013161 | Ga0501273_013161_706_954 | 81 |
| 346 | 3300050511 | nmdc:mga08y16_60998_c1 | nmdc:mga08y16_60998_c1_350_598 | 81 |
| 347 | 3300059421 | Ga0590071_170189 | Ga0590071_170189_172_417 | 81 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar