F417188

General Info

Members Datasets Scaffolds Average Seq Length
347 163 347 82

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10012583|Ga0268264_1001258311
Length 94
Sequence LTDVEIRNYNVVMKSQIIQIGNSQGIRIPKVLLEESGLRGDVDLELCPEGVLIRNIQKPRAGWDEAFKTMTENEDDDLQGSDVSTAFEKKEWQW

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
152 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
153 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
158 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
159 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
160 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
161 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.88
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10224818 3300005289 Unclassified 1062
2 Ga0065712_10129989 3300005290 Bacteria 1561
3 Ga0065715_10988937 3300005293 Bacteria 548
4 Ga0070690_100257088 3300005330 Bacteria 1237
5 Ga0070670_100002158 3300005331 Bacteria 16150
6 Ga0070670_100063757 3300005331 Bacteria 3162
7 Ga0070677_10255217 3300005333 Bacteria 872
8 Ga0070677_10267277 3300005333 Bacteria 856
9 Ga0070677_10289275 3300005333 Bacteria 828
10 Ga0068869_100164796 3300005334 Bacteria 1728
11 Ga0068869_101078751 3300005334 Bacteria 702
12 Ga0070666_10030634 3300005335 Bacteria 3546
13 Ga0068868_100303402 3300005338 Bacteria 1357
14 Ga0068868_100549872 3300005338 Bacteria 1017
15 Ga0070689_100407055 3300005340 Bacteria 1151
16 Ga0070692_10489263 3300005345 Bacteria 795
17 Ga0070668_100161281 3300005347 Bacteria 1820
18 Ga0070668_100235874 3300005347 Bacteria 1514
19 Ga0070668_100383822 3300005347 Bacteria 1196
20 Ga0070675_100012592 3300005354 Bacteria 6632
21 Ga0070675_100097301 3300005354 Bacteria 2474
22 Ga0070675_100370880 3300005354 Bacteria 1272
23 Ga0070671_100247865 3300005355 Bacteria 1513
24 Ga0070671_100275439 3300005355 Bacteria 1430
25 Ga0070671_100419213 3300005355 Bacteria 1146
26 Ga0070671_100828717 3300005355 Bacteria 806
27 Ga0070674_100014135 3300005356 Bacteria 4956
28 Ga0070674_100138966 3300005356 Bacteria 1821
29 Ga0070673_100095529 3300005364 Bacteria 2438
30 Ga0070673_102290344 3300005364 Unclassified 513
31 Ga0070688_100735000 3300005365 Bacteria 767
32 Ga0070659_101089362 3300005366 Unclassified 704
33 Ga0070667_100018385 3300005367 Bacteria 5797
34 Ga0070667_100233105 3300005367 Bacteria 1642
35 Ga0070701_10363676 3300005438 Bacteria 907
36 Ga0070663_100996178 3300005455 Bacteria 728
37 Ga0070678_100052484 3300005456 Bacteria 2961
38 Ga0070678_100543759 3300005456 Bacteria 1030
39 Ga0070678_100546409 3300005456 Bacteria 1028
40 Ga0070662_100283923 3300005457 Bacteria 1340
41 Ga0068867_100120024 3300005459 Bacteria 2031
42 Ga0068867_100187963 3300005459 Bacteria 1647
43 Ga0068867_100443675 3300005459 Bacteria 1104
44 Ga0068867_101286579 3300005459 Unclassified 674
45 Ga0068867_102211133 3300005459 Unclassified 522
46 Ga0070685_10051358 3300005466 Bacteria 2384
47 Ga0070685_11101483 3300005466 Unclassified 600
48 Ga0070698_100074861 3300005471 Bacteria 3391
49 Ga0070679_101123177 3300005530 Bacteria 731
50 Ga0070684_100736731 3300005535 Unclassified 920
51 Ga0070684_101545610 3300005535 Bacteria 626
52 Ga0068853_100062432 3300005539 Bacteria 3224
53 Ga0070672_100044127 3300005543 Bacteria 3442
54 Ga0070672_100049218 3300005543 Bacteria 3278
55 Ga0070672_101409497 3300005543 Unclassified 623
56 Ga0070686_100092081 3300005544 Bacteria 2029
57 Ga0070696_100741622 3300005546 Bacteria 804
58 Ga0068855_100403025 3300005563 Bacteria 1499
59 Ga0070664_100040892 3300005564 Bacteria 3911
60 Ga0070664_100227758 3300005564 Bacteria 1670
61 Ga0070664_100861576 3300005564 Bacteria 848
62 Ga0068857_100980503 3300005577 Bacteria 813
63 Ga0068854_101378480 3300005578 Bacteria 637
64 Ga0068854_102264558 3300005578 Bacteria 503
65 Ga0070702_100027864 3300005615 Bacteria 3054
66 Ga0068852_100401202 3300005616 Bacteria 1349
67 Ga0068852_100808943 3300005616 Bacteria 952
68 Ga0068859_100028886 3300005617 Bacteria 5562
69 Ga0068859_100748102 3300005617 Bacteria 1066
70 Ga0068864_100226039 3300005618 Bacteria 1729
71 Ga0068864_100612672 3300005618 Bacteria 1057
72 Ga0068864_101374645 3300005618 Bacteria 707
73 Ga0068866_11005045 3300005718 Bacteria 593
74 Ga0068861_100743334 3300005719 Bacteria 916
75 Ga0068861_101359665 3300005719 Bacteria 692
76 Ga0068870_10664736 3300005840 Bacteria 715
77 Ga0068863_100491758 3300005841 Bacteria 1207
78 Ga0068863_100807993 3300005841 Unclassified 935
79 Ga0068863_102737876 3300005841 Bacteria 502
80 Ga0068858_100113671 3300005842 Bacteria 2528
81 Ga0068858_100285193 3300005842 Bacteria 1573
82 Ga0068858_100371581 3300005842 Bacteria 1371
83 Ga0068860_100043733 3300005843 Bacteria 4271
84 Ga0068860_100070878 3300005843 Bacteria 3313
85 Ga0068860_100081286 3300005843 Bacteria 3081
86 Ga0068860_100689325 3300005843 Bacteria 1031
87 Ga0068862_100510987 3300005844 Bacteria 1142
88 Ga0068862_100745040 3300005844 Unclassified 953
89 Ga0097621_100101460 3300006237 Bacteria 2421
90 Ga0097621_100171739 3300006237 Unclassified 1869
91 Ga0097621_100824757 3300006237 Bacteria 860
92 Ga0068871_100062040 3300006358 Bacteria 3054
93 Ga0068871_100132219 3300006358 Bacteria 2116
94 Ga0068871_100339619 3300006358 Bacteria 1326
95 Ga0068871_101477074 3300006358 Unclassified 642
96 Ga0075428_101706582 3300006844 Bacteria 657
97 Ga0068865_100057112 3300006881 Bacteria 2722
98 Ga0068865_100386981 3300006881 Bacteria 1142
99 Ga0068865_100445661 3300006881 Bacteria 1069
100 Ga0097620_100028886 3300006931 Bacteria 5562
101 Ga0097620_100748102 3300006931 Bacteria 1066
102 Ga0105240_11643064 3300009093 Unclassified 672
103 Ga0111539_10021901 3300009094 Bacteria 7856
104 Ga0105245_11749096 3300009098 Bacteria 674
105 Ga0105247_10011609 3300009101 Bacteria 5307
106 Ga0105241_11302895 3300009174 Unclassified 692
107 Ga0105242_10104992 3300009176 Bacteria 2399
108 Ga0105242_10521359 3300009176 Bacteria 1134
109 Ga0105242_11644675 3300009176 Bacteria 677
110 Ga0105242_11972115 3300009176 Unclassified 626
111 Ga0105248_10141095 3300009177 Bacteria 2718
112 Ga0105248_10221020 3300009177 Unclassified 2133
113 Ga0105248_12038294 3300009177 Unclassified 652
114 Ga0105237_11531729 3300009545 Bacteria 673
115 Ga0105249_10062297 3300009553 Bacteria 3425
116 Ga0105249_10092131 3300009553 Bacteria 2837
117 Ga0105249_10146072 3300009553 Bacteria 2272
118 Ga0105249_10178666 3300009553 Bacteria 2063
119 Ga0105239_11023880 3300010375 Bacteria 950
120 Ga0105246_10885757 3300011119 Unclassified 799
121 Ga0105246_11436446 3300011119 Bacteria 645
122 Ga0157371_10122033 3300013102 Bacteria 1853
123 Ga0157370_10831118 3300013104 Unclassified 840
124 Ga0157369_11351627 3300013105 Bacteria 726
125 Ga0157374_10052744 3300013296 Bacteria 3789
126 Ga0157374_11032147 3300013296 Bacteria 842
127 Ga0157374_11307028 3300013296 Bacteria 747
128 Ga0157374_12836307 3300013296 Bacteria 512
129 Ga0157378_10561142 3300013297 Unclassified 1148
130 Ga0157378_11925263 3300013297 Bacteria 640
131 Ga0157378_11974889 3300013297 Bacteria 633
132 Ga0157378_12877036 3300013297 Bacteria 534
133 Ga0163162_10043788 3300013306 Bacteria 4482
134 Ga0163162_10164524 3300013306 Bacteria 2342
135 Ga0163162_10202247 3300013306 Bacteria 2115
136 Ga0163162_10711471 3300013306 Unclassified 1125
137 Ga0163162_10715635 3300013306 Bacteria 1122
138 Ga0163162_11725308 3300013306 Bacteria 715
139 Ga0157372_10311429 3300013307 Bacteria 1832
140 Ga0157375_10057210 3300013308 Bacteria 3853
141 Ga0157375_10135044 3300013308 Bacteria 2590
142 Ga0157375_10158199 3300013308 Bacteria 2406
143 Ga0157375_10232528 3300013308 Bacteria 2002
144 Ga0157375_10680199 3300013308 Unclassified 1184
145 Ga0157375_10684405 3300013308 Bacteria 1180
146 Ga0157375_13644799 3300013308 Unclassified 512
147 Ga0157375_13644800 3300013308 Bacteria 512
148 Ga0163163_10015220 3300014325 Bacteria 7106
149 Ga0163163_10263905 3300014325 Bacteria 1773
150 Ga0163163_10501278 3300014325 Bacteria 1276
151 Ga0163163_10646002 3300014325 Bacteria 1121
152 Ga0163163_11851606 3300014325 Bacteria 664
153 Ga0157380_10169324 3300014326 Bacteria 1907
154 Ga0157380_10340393 3300014326 Bacteria 1399
155 Ga0157380_10433909 3300014326 Bacteria 1257
156 Ga0157377_10100259 3300014745 Bacteria 1724
157 Ga0157377_11095152 3300014745 Bacteria 610
158 Ga0157376_10034478 3300014969 Bacteria 4087
159 Ga0157376_10101954 3300014969 Bacteria 2509
160 Ga0157376_10422273 3300014969 Unclassified 1294
161 Ga0157376_10985435 3300014969 Bacteria 865
162 Ga0157376_11121471 3300014969 Bacteria 813
163 Ga0157376_11388311 3300014969 Bacteria 734
164 Ga0163161_10001466 3300017792 Bacteria 17447
165 Ga0163161_10036276 3300017792 Bacteria 3531
166 Ga0163161_10080449 3300017792 Bacteria 2398
167 Ga0207697_10096294 3300025315 Bacteria 1258
168 Ga0207682_10049979 3300025893 Bacteria 1727
169 Ga0207642_10893335 3300025899 Unclassified 569
170 Ga0207710_10015790 3300025900 Bacteria 3193
171 Ga0207643_10038796 3300025908 Bacteria 2677
172 Ga0207705_10002127 3300025909 Bacteria 15372
173 Ga0207654_10405134 3300025911 Bacteria 949
174 Ga0207652_10965372 3300025921 Bacteria 750
175 Ga0207650_10031089 3300025925 Bacteria 3853
176 Ga0207650_10126450 3300025925 Bacteria 1996
177 Ga0207650_10336809 3300025925 Bacteria 1238
178 Ga0207650_10615292 3300025925 Bacteria 914
179 Ga0207650_11003007 3300025925 Bacteria 710
180 Ga0207659_10131632 3300025926 Bacteria 1932
181 Ga0207659_10396791 3300025926 Bacteria 1153
182 Ga0207659_10557900 3300025926 Bacteria 974
183 Ga0207644_10754648 3300025931 Bacteria 813
184 Ga0207644_11128096 3300025931 Unclassified 659
185 Ga0207706_10133276 3300025933 Bacteria 2185
186 Ga0207670_10430750 3300025936 Bacteria 1060
187 Ga0207670_11186924 3300025936 Bacteria 646
188 Ga0207669_10150411 3300025937 Bacteria 1630
189 Ga0207669_10553647 3300025937 Bacteria 928
190 Ga0207669_10701183 3300025937 Bacteria 832
191 Ga0207704_10321466 3300025938 Bacteria 1194
192 Ga0207704_10444012 3300025938 Bacteria 1034
193 Ga0207704_10930372 3300025938 Bacteria 732
194 Ga0207704_11434988 3300025938 Bacteria 592
195 Ga0207704_11758723 3300025938 Unclassified 533
196 Ga0207691_10035359 3300025940 Bacteria 4638
197 Ga0207691_10058984 3300025940 Bacteria 3490
198 Ga0207691_10362754 3300025940 Unclassified 1238
199 Ga0207711_10310295 3300025941 Bacteria 1456
200 Ga0207689_10215777 3300025942 Bacteria 1585
201 Ga0207689_10421572 3300025942 Bacteria 1114
202 Ga0207689_10607764 3300025942 Bacteria 920
203 Ga0207661_11067918 3300025944 Bacteria 744
204 Ga0207679_10075990 3300025945 Bacteria 2551
205 Ga0207679_10741594 3300025945 Bacteria 893
206 Ga0207667_10212263 3300025949 Bacteria 1984
207 Ga0207651_10251827 3300025960 Bacteria 1445
208 Ga0207651_10262357 3300025960 Bacteria 1419
209 Ga0207651_11834337 3300025960 Unclassified 546
210 Ga0207712_10016625 3300025961 Bacteria 4770
211 Ga0207712_10065375 3300025961 Bacteria 2596
212 Ga0207712_10067377 3300025961 Bacteria 2562
213 Ga0207712_10407687 3300025961 Unclassified 1144
214 Ga0207668_10141681 3300025972 Bacteria 1850
215 Ga0207668_10372367 3300025972 Bacteria 1200
216 Ga0207640_10910739 3300025981 Bacteria 769
217 Ga0207640_12008459 3300025981 Unclassified 524
218 Ga0207658_10203293 3300025986 Bacteria 1655
219 Ga0207658_10337818 3300025986 Bacteria 1308
220 Ga0207677_10051727 3300026023 Bacteria 2787
221 Ga0207677_10885650 3300026023 Bacteria 804
222 Ga0207703_10130728 3300026035 Bacteria 2168
223 Ga0207703_10701910 3300026035 Bacteria 962
224 Ga0207639_10005815 3300026041 Bacteria 8357
225 Ga0207639_12195410 3300026041 Unclassified 513
226 Ga0207678_10377254 3300026067 Bacteria 1226
227 Ga0207641_10107687 3300026088 Bacteria 2465
228 Ga0207641_12530329 3300026088 Unclassified 511
229 Ga0207648_10112550 3300026089 Bacteria 2390
230 Ga0207648_10306938 3300026089 Bacteria 1424
231 Ga0207676_10041969 3300026095 Bacteria 3516
232 Ga0207676_10100893 3300026095 Bacteria 2392
233 Ga0207674_10095428 3300026116 Bacteria 2960
234 Ga0207675_101261917 3300026118 Bacteria 759
235 Ga0207683_10151683 3300026121 Bacteria 2091
236 Ga0207683_10564693 3300026121 Unclassified 1052
237 Ga0207683_10914892 3300026121 Bacteria 814
238 Ga0207698_10686070 3300026142 Bacteria 1018
239 Ga0207698_10984127 3300026142 Bacteria 854
240 Ga0209974_10148298 3300027876 Unclassified 845
241 Ga0207428_10377396 3300027907 Bacteria 1040
242 Ga0268265_10037227 3300028380 Bacteria 3569
243 Ga0268265_10784363 3300028380 Bacteria 927
244 Ga0268265_11059250 3300028380 Bacteria 803
245 Ga0268264_10012583 3300028381 Bacteria 6969
246 Ga0268264_10023783 3300028381 Bacteria 4998
247 Ga0268264_10909941 3300028381 Unclassified 883
248 Ga0268264_11030166 3300028381 Unclassified 830
249 Ga0268264_11747932 3300028381 Bacteria 632
250 Ga0265336_10104992 3300028666 Unclassified 841
251 Ga0307408_100062020 3300031548 Bacteria 2731
252 Ga0307408_100083808 3300031548 Unclassified 2390
253 Ga0307408_100277210 3300031548 Unclassified 1395
254 Ga0307408_100313658 3300031548 Bacteria 1318
255 Ga0307408_100610687 3300031548 Bacteria 970
256 Ga0307405_10068905 3300031731 Bacteria 2266
257 Ga0307405_10101916 3300031731 Bacteria 1927
258 Ga0307405_10219433 3300031731 Bacteria 1394
259 Ga0307405_11137482 3300031731 Unclassified 672
260 Ga0307413_10004625 3300031824 Bacteria 6017
261 Ga0307413_10015890 3300031824 Bacteria 3871
262 Ga0307413_10028181 3300031824 Bacteria 3123
263 Ga0307413_10079153 3300031824 Bacteria 2100
264 Ga0307410_10003713 3300031852 Bacteria 7727
265 Ga0307410_10003862 3300031852 Bacteria 7618
266 Ga0307410_10011896 3300031852 Bacteria 5002
267 Ga0307410_10040173 3300031852 Bacteria 3077
268 Ga0307410_10167181 3300031852 Bacteria 1654
269 Ga0307410_10223596 3300031852 Bacteria 1449
270 Ga0307410_10351655 3300031852 Bacteria 1178
271 Ga0307410_10458548 3300031852 Bacteria 1041
272 Ga0307406_10008415 3300031901 Bacteria 5753
273 Ga0307406_10075785 3300031901 Unclassified 2220
274 Ga0307406_10100866 3300031901 Bacteria 1966
275 Ga0307406_10146172 3300031901 Bacteria 1680
276 Ga0307406_10395780 3300031901 Bacteria 1093
277 Ga0307407_10084239 3300031903 Bacteria 1931
278 Ga0307407_10119086 3300031903 Bacteria 1670
279 Ga0307407_10137176 3300031903 Bacteria 1573
280 Ga0307407_10147319 3300031903 Bacteria 1526
281 Ga0307407_10151533 3300031903 Bacteria 1507
282 Ga0307407_11009763 3300031903 Unclassified 643
283 Ga0307412_10021792 3300031911 Bacteria 3919
284 Ga0307412_10161827 3300031911 Bacteria 1664
285 Ga0307409_100016440 3300031995 Bacteria 4895
286 Ga0307409_100020036 3300031995 Bacteria 4547
287 Ga0307409_100022996 3300031995 Bacteria 4309
288 Ga0307409_100050242 3300031995 Bacteria 3184
289 Ga0307409_100401331 3300031995 Bacteria 1309
290 Ga0307409_100483908 3300031995 Bacteria 1201
291 Ga0307416_100011923 3300032002 Bacteria 5831
292 Ga0307416_100256601 3300032002 Bacteria 1705
293 Ga0307416_100288474 3300032002 Bacteria 1623
294 Ga0307416_100300972 3300032002 Bacteria 1594
295 Ga0307416_100654736 3300032002 Bacteria 1135
296 Ga0307414_10035221 3300032004 Bacteria 3329
297 Ga0307414_10046945 3300032004 Bacteria 2969
298 Ga0307414_10176544 3300032004 Bacteria 1714
299 Ga0307414_11280194 3300032004 Unclassified 680
300 Ga0307414_12174825 3300032004 Bacteria 518
301 Ga0307411_10001470 3300032005 Bacteria 9670
302 Ga0307411_10006416 3300032005 Bacteria 5884
303 Ga0307411_10083590 3300032005 Bacteria 2205
304 Ga0307411_10174845 3300032005 Bacteria 1623
305 Ga0307411_11435578 3300032005 Bacteria 632
306 Ga0307411_11553591 3300032005 Unclassified 609
307 Ga0307415_100006754 3300032126 Bacteria 6220
308 Ga0307415_100008783 3300032126 Bacteria 5624
309 Ga0307415_100069751 3300032126 Bacteria 2466
310 Ga0307415_100159101 3300032126 Bacteria 1748
311 Ga0307415_100630662 3300032126 Bacteria 958
312 Ga0436362_1285648 3300039453 Bacteria 1222
313 Ga0451789_0603677 3300041443 Bacteria 582
314 Ga0451791_1406720 3300041451 Bacteria 1082
315 Ga0451791_1531823 3300041451 Bacteria 743
316 Ga0451807_1151657 3300041486 Bacteria 855
317 Ga0451837_0063136 3300041494 Bacteria 2956
318 Ga0466961_0031519 3300044693 Bacteria 3408
319 Ga0451576_1676365 3300045051 Bacteria 659
320 Ga0495672_0191506 3300047320 Bacteria 1028
321 Ga0496104_0844500 3300048907 Bacteria 821
322 Ga0496105_0472228 3300048908 Bacteria 988
323 Ga0496109_0340484 3300048912 Bacteria 1416
324 Ga0496111_0624403 3300048914 Bacteria 788
325 Ga0496112_1356817 3300048915 Bacteria 626
326 Ga0496114_0385970 3300048917 Bacteria 1240
327 Ga0501292_014022 3300049515 Unclassified 1238
328 Ga0501072_0002774 3300049588 Bacteria 13167
329 Ga0501216_004602 3300049660 Unclassified 2052
330 Ga0501217_030293 3300049661 Bacteria 1328
331 Ga0501233_253684 3300049668 Unclassified 530
332 Ga0501235_025127 3300049669 Bacteria 1332
333 Ga0501242_016230 3300049674 Bacteria 931
334 Ga0501242_032322 3300049674 Bacteria 713
335 Ga0501247_008872 3300049677 Bacteria 1180
336 Ga0501249_078880 3300049679 Unclassified 773
337 Ga0501257_033197 3300049686 Bacteria 1250
338 Ga0501257_065392 3300049686 Unclassified 923
339 Ga0501258_011939 3300049687 Unclassified 937
340 Ga0501221_013208 3300049704 Bacteria 1516
341 Ga0501263_011189 3300049760 Bacteria 1110
342 Ga0501268_001076 3300049765 Bacteria 3277
343 Ga0501270_012726 3300049767 Bacteria 1154
344 Ga0501272_005218 3300049769 Bacteria 1364
345 Ga0501273_013161 3300049770 Unclassified 1052
346 nmdc:mga08y16_60998_c1 3300050511 Bacteria 3938
347 Ga0590071_170189 3300059421 Archaea 569

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100828717 Ga0070671_1008287171 79
2 3300025925 Ga0207650_11003007 Ga0207650_110030072 79
3 3300025931 Ga0207644_10754648 Ga0207644_107546483 79
4 3300026121 Ga0207683_10914892 Ga0207683_109148922 79
5 3300005333 Ga0070677_10267277 Ga0070677_102672773 80
6 3300005356 Ga0070674_100138966 Ga0070674_1001389662 80
7 3300005364 Ga0070673_102290344 Ga0070673_1022903441 80
8 3300005456 Ga0070678_100546409 Ga0070678_1005464092 80
9 3300005471 Ga0070698_100074861 Ga0070698_1000748613 80
10 3300005543 Ga0070672_101409497 Ga0070672_1014094972 80
11 3300005578 Ga0068854_101378480 Ga0068854_1013784802 80
12 3300005616 Ga0068852_100401202 Ga0068852_1004012023 80
13 3300006358 Ga0068871_101477074 Ga0068871_1014770742 80
14 3300013104 Ga0157370_10831118 Ga0157370_108311182 80
15 3300013296 Ga0157374_10052744 Ga0157374_100527442 80
16 3300013306 Ga0163162_10711471 Ga0163162_107114712 80
17 3300013308 Ga0157375_10057210 Ga0157375_100572104 80
18 3300014969 Ga0157376_11388311 Ga0157376_113883112 80
19 3300017792 Ga0163161_10001466 Ga0163161_100014663 80
20 3300025909 Ga0207705_10002127 Ga0207705_100021276 80
21 3300025925 Ga0207650_10336809 Ga0207650_103368092 80
22 3300025931 Ga0207644_11128096 Ga0207644_111280962 80
23 3300025937 Ga0207669_10150411 Ga0207669_101504112 80
24 3300025940 Ga0207691_10362754 Ga0207691_103627542 80
25 3300025960 Ga0207651_11834337 Ga0207651_118343372 80
26 3300026041 Ga0207639_12195410 Ga0207639_121954102 80
27 3300026142 Ga0207698_10686070 Ga0207698_106860702 80
28 3300026142 Ga0207698_10984127 Ga0207698_109841272 80
29 3300031548 Ga0307408_100083808 Ga0307408_1000838083 80
30 3300031731 Ga0307405_11137482 Ga0307405_111374822 80
31 3300031824 Ga0307413_10079153 Ga0307413_100791534 80
32 3300031852 Ga0307410_10003862 Ga0307410_100038624 80
33 3300031901 Ga0307406_10075785 Ga0307406_100757853 80
34 3300031903 Ga0307407_10137176 Ga0307407_101371763 80
35 3300031911 Ga0307412_10021792 Ga0307412_100217924 80
36 3300031995 Ga0307409_100401331 Ga0307409_1004013311 80
37 3300032002 Ga0307416_100256601 Ga0307416_1002566012 80
38 3300032004 Ga0307414_10046945 Ga0307414_100469454 80
39 3300032005 Ga0307411_10001470 Ga0307411_100014707 80
40 3300032126 Ga0307415_100159101 Ga0307415_1001591013 80
41 3300049515 Ga0501292_014022 Ga0501292_014022_524_766 80
42 3300049674 Ga0501242_032322 Ga0501242_032322_179_421 80
43 3300049679 Ga0501249_078880 Ga0501249_078880_161_403 80
44 3300049686 Ga0501257_033197 Ga0501257_033197_833_1075 80
45 3300049687 Ga0501258_011939 Ga0501258_011939_120_362 80
46 3300049704 Ga0501221_013208 Ga0501221_013208_733_975 80
47 3300049769 Ga0501272_005218 Ga0501272_005218_183_425 80
48 3300005289 Ga0065704_10224818 Ga0065704_102248183 81
49 3300005290 Ga0065712_10129989 Ga0065712_101299892 81
50 3300005293 Ga0065715_10988937 Ga0065715_109889372 81
51 3300005330 Ga0070690_100257088 Ga0070690_1002570881 81
52 3300005331 Ga0070670_100002158 Ga0070670_1000021582 81
53 3300005331 Ga0070670_100063757 Ga0070670_1000637572 81
54 3300005333 Ga0070677_10255217 Ga0070677_102552172 81
55 3300005333 Ga0070677_10289275 Ga0070677_102892752 81
56 3300005334 Ga0068869_100164796 Ga0068869_1001647963 81
57 3300005334 Ga0068869_101078751 Ga0068869_1010787512 81
58 3300005335 Ga0070666_10030634 Ga0070666_100306345 81
59 3300005338 Ga0068868_100303402 Ga0068868_1003034022 81
60 3300005338 Ga0068868_100549872 Ga0068868_1005498722 81
61 3300005340 Ga0070689_100407055 Ga0070689_1004070551 81
62 3300005345 Ga0070692_10489263 Ga0070692_104892632 81
63 3300005347 Ga0070668_100161281 Ga0070668_1001612812 81
64 3300005347 Ga0070668_100235874 Ga0070668_1002358742 81
65 3300005347 Ga0070668_100383822 Ga0070668_1003838223 81
66 3300005354 Ga0070675_100012592 Ga0070675_10001259210 81
67 3300005354 Ga0070675_100097301 Ga0070675_1000973013 81
68 3300005354 Ga0070675_100370880 Ga0070675_1003708802 81
69 3300005355 Ga0070671_100247865 Ga0070671_1002478653 81
70 3300005355 Ga0070671_100275439 Ga0070671_1002754392 81
71 3300005355 Ga0070671_100419213 Ga0070671_1004192132 81
72 3300005356 Ga0070674_100014135 Ga0070674_1000141352 81
73 3300005364 Ga0070673_100095529 Ga0070673_1000955292 81
74 3300005365 Ga0070688_100735000 Ga0070688_1007350002 81
75 3300005366 Ga0070659_101089362 Ga0070659_1010893622 81
76 3300005367 Ga0070667_100018385 Ga0070667_1000183856 81
77 3300005367 Ga0070667_100233105 Ga0070667_1002331052 81
78 3300005438 Ga0070701_10363676 Ga0070701_103636762 81
79 3300005455 Ga0070663_100996178 Ga0070663_1009961782 81
80 3300005456 Ga0070678_100052484 Ga0070678_1000524842 81
81 3300005456 Ga0070678_100543759 Ga0070678_1005437592 81
82 3300005457 Ga0070662_100283923 Ga0070662_1002839232 81
83 3300005459 Ga0068867_100120024 Ga0068867_1001200242 81
84 3300005459 Ga0068867_100187963 Ga0068867_1001879632 81
85 3300005459 Ga0068867_100443675 Ga0068867_1004436752 81
86 3300005459 Ga0068867_101286579 Ga0068867_1012865791 81
87 3300005459 Ga0068867_102211133 Ga0068867_1022111331 81
88 3300005466 Ga0070685_10051358 Ga0070685_100513584 81
89 3300005466 Ga0070685_11101483 Ga0070685_111014831 81
90 3300005530 Ga0070679_101123177 Ga0070679_1011231772 81
91 3300005535 Ga0070684_100736731 Ga0070684_1007367313 81
92 3300005535 Ga0070684_101545610 Ga0070684_1015456102 81
93 3300005539 Ga0068853_100062432 Ga0068853_1000624323 81
94 3300005543 Ga0070672_100044127 Ga0070672_1000441276 81
95 3300005543 Ga0070672_100049218 Ga0070672_1000492183 81
96 3300005544 Ga0070686_100092081 Ga0070686_1000920813 81
97 3300005546 Ga0070696_100741622 Ga0070696_1007416221 81
98 3300005563 Ga0068855_100403025 Ga0068855_1004030253 81
99 3300005564 Ga0070664_100040892 Ga0070664_1000408924 81
100 3300005564 Ga0070664_100227758 Ga0070664_1002277583 81
101 3300005564 Ga0070664_100861576 Ga0070664_1008615762 81
102 3300005577 Ga0068857_100980503 Ga0068857_1009805032 81
103 3300005578 Ga0068854_102264558 Ga0068854_1022645582 81
104 3300005615 Ga0070702_100027864 Ga0070702_1000278644 81
105 3300005616 Ga0068852_100808943 Ga0068852_1008089432 81
106 3300005617 Ga0068859_100028886 Ga0068859_1000288868 81
107 3300005617 Ga0068859_100748102 Ga0068859_1007481022 81
108 3300005618 Ga0068864_100226039 Ga0068864_1002260394 81
109 3300005618 Ga0068864_100612672 Ga0068864_1006126723 81
110 3300005618 Ga0068864_101374645 Ga0068864_1013746452 81
111 3300005718 Ga0068866_11005045 Ga0068866_110050452 81
112 3300005719 Ga0068861_100743334 Ga0068861_1007433342 81
113 3300005719 Ga0068861_101359665 Ga0068861_1013596652 81
114 3300005840 Ga0068870_10664736 Ga0068870_106647362 81
115 3300005841 Ga0068863_100491758 Ga0068863_1004917582 81
116 3300005841 Ga0068863_100807993 Ga0068863_1008079931 81
117 3300005841 Ga0068863_102737876 Ga0068863_1027378762 81
118 3300005842 Ga0068858_100113671 Ga0068858_1001136714 81
119 3300005842 Ga0068858_100285193 Ga0068858_1002851933 81
120 3300005842 Ga0068858_100371581 Ga0068858_1003715812 81
121 3300005843 Ga0068860_100043733 Ga0068860_1000437332 81
122 3300005843 Ga0068860_100070878 Ga0068860_1000708783 81
123 3300005843 Ga0068860_100081286 Ga0068860_1000812865 81
124 3300005843 Ga0068860_100689325 Ga0068860_1006893251 81
125 3300005844 Ga0068862_100510987 Ga0068862_1005109873 81
126 3300005844 Ga0068862_100745040 Ga0068862_1007450402 81
127 3300006237 Ga0097621_100101460 Ga0097621_1001014602 81
128 3300006237 Ga0097621_100171739 Ga0097621_1001717394 81
129 3300006237 Ga0097621_100824757 Ga0097621_1008247572 81
130 3300006358 Ga0068871_100062040 Ga0068871_1000620405 81
131 3300006358 Ga0068871_100132219 Ga0068871_1001322191 81
132 3300006358 Ga0068871_100339619 Ga0068871_1003396192 81
133 3300006844 Ga0075428_101706582 Ga0075428_1017065821 81
134 3300006881 Ga0068865_100057112 Ga0068865_1000571122 81
135 3300006881 Ga0068865_100386981 Ga0068865_1003869812 81
136 3300006881 Ga0068865_100445661 Ga0068865_1004456613 81
137 3300006931 Ga0097620_100028886 Ga0097620_1000288868 81
138 3300006931 Ga0097620_100748102 Ga0097620_1007481022 81
139 3300009093 Ga0105240_11643064 Ga0105240_116430642 81
140 3300009094 Ga0111539_10021901 Ga0111539_100219012 81
141 3300009098 Ga0105245_11749096 Ga0105245_117490962 81
142 3300009101 Ga0105247_10011609 Ga0105247_100116098 81
143 3300009174 Ga0105241_11302895 Ga0105241_113028952 81
144 3300009176 Ga0105242_10104992 Ga0105242_101049923 81
145 3300009176 Ga0105242_10521359 Ga0105242_105213592 81
146 3300009176 Ga0105242_11644675 Ga0105242_116446752 81
147 3300009176 Ga0105242_11972115 Ga0105242_119721152 81
148 3300009177 Ga0105248_10141095 Ga0105248_101410954 81
149 3300009177 Ga0105248_10221020 Ga0105248_102210202 81
150 3300009177 Ga0105248_12038294 Ga0105248_120382942 81
151 3300009545 Ga0105237_11531729 Ga0105237_115317292 81
152 3300009553 Ga0105249_10062297 Ga0105249_100622975 81
153 3300009553 Ga0105249_10092131 Ga0105249_100921312 81
154 3300009553 Ga0105249_10146072 Ga0105249_101460723 81
155 3300009553 Ga0105249_10178666 Ga0105249_101786662 81
156 3300010375 Ga0105239_11023880 Ga0105239_110238802 81
157 3300011119 Ga0105246_10885757 Ga0105246_108857572 81
158 3300011119 Ga0105246_11436446 Ga0105246_114364462 81
159 3300013102 Ga0157371_10122033 Ga0157371_101220333 81
160 3300013105 Ga0157369_11351627 Ga0157369_113516272 81
161 3300013296 Ga0157374_11032147 Ga0157374_110321472 81
162 3300013296 Ga0157374_11307028 Ga0157374_113070282 81
163 3300013296 Ga0157374_12836307 Ga0157374_128363072 81
164 3300013297 Ga0157378_10561142 Ga0157378_105611422 81
165 3300013297 Ga0157378_11925263 Ga0157378_119252632 81
166 3300013297 Ga0157378_11974889 Ga0157378_119748891 81
167 3300013297 Ga0157378_12877036 Ga0157378_128770362 81
168 3300013306 Ga0163162_10043788 Ga0163162_100437885 81
169 3300013306 Ga0163162_10164524 Ga0163162_101645243 81
170 3300013306 Ga0163162_10202247 Ga0163162_102022474 81
171 3300013306 Ga0163162_10715635 Ga0163162_107156351 81
172 3300013306 Ga0163162_11725308 Ga0163162_117253082 81
173 3300013307 Ga0157372_10311429 Ga0157372_103114293 81
174 3300013308 Ga0157375_10135044 Ga0157375_101350444 81
175 3300013308 Ga0157375_10158199 Ga0157375_101581993 81
176 3300013308 Ga0157375_10232528 Ga0157375_102325283 81
177 3300013308 Ga0157375_10680199 Ga0157375_106801992 81
178 3300013308 Ga0157375_10684405 Ga0157375_106844052 81
179 3300013308 Ga0157375_13644799 Ga0157375_136447992 81
180 3300013308 Ga0157375_13644800 Ga0157375_136448002 81
181 3300014325 Ga0163163_10015220 Ga0163163_1001522010 81
182 3300014325 Ga0163163_10263905 Ga0163163_102639052 81
183 3300014325 Ga0163163_10501278 Ga0163163_105012784 81
184 3300014325 Ga0163163_10646002 Ga0163163_106460022 81
185 3300014325 Ga0163163_11851606 Ga0163163_118516062 81
186 3300014326 Ga0157380_10169324 Ga0157380_101693242 81
187 3300014326 Ga0157380_10340393 Ga0157380_103403932 81
188 3300014326 Ga0157380_10433909 Ga0157380_104339093 81
189 3300014745 Ga0157377_10100259 Ga0157377_101002592 81
190 3300014745 Ga0157377_11095152 Ga0157377_110951522 81
191 3300014969 Ga0157376_10034478 Ga0157376_100344783 81
192 3300014969 Ga0157376_10101954 Ga0157376_101019542 81
193 3300014969 Ga0157376_10422273 Ga0157376_104222732 81
194 3300014969 Ga0157376_10985435 Ga0157376_109854352 81
195 3300014969 Ga0157376_11121471 Ga0157376_111214712 81
196 3300017792 Ga0163161_10036276 Ga0163161_100362762 81
197 3300017792 Ga0163161_10080449 Ga0163161_100804494 81
198 3300025315 Ga0207697_10096294 Ga0207697_100962943 81
199 3300025893 Ga0207682_10049979 Ga0207682_100499794 81
200 3300025899 Ga0207642_10893335 Ga0207642_108933352 81
201 3300025900 Ga0207710_10015790 Ga0207710_100157903 81
202 3300025908 Ga0207643_10038796 Ga0207643_100387965 81
203 3300025911 Ga0207654_10405134 Ga0207654_104051342 81
204 3300025921 Ga0207652_10965372 Ga0207652_109653722 81
205 3300025925 Ga0207650_10031089 Ga0207650_100310893 81
206 3300025925 Ga0207650_10126450 Ga0207650_101264504 81
207 3300025925 Ga0207650_10615292 Ga0207650_106152922 81
208 3300025926 Ga0207659_10131632 Ga0207659_101316322 81
209 3300025926 Ga0207659_10396791 Ga0207659_103967912 81
210 3300025926 Ga0207659_10557900 Ga0207659_105579002 81
211 3300025933 Ga0207706_10133276 Ga0207706_101332762 81
212 3300025936 Ga0207670_10430750 Ga0207670_104307502 81
213 3300025936 Ga0207670_11186924 Ga0207670_111869242 81
214 3300025937 Ga0207669_10553647 Ga0207669_105536472 81
215 3300025937 Ga0207669_10701183 Ga0207669_107011832 81
216 3300025938 Ga0207704_10321466 Ga0207704_103214662 81
217 3300025938 Ga0207704_10444012 Ga0207704_104440122 81
218 3300025938 Ga0207704_10930372 Ga0207704_109303722 81
219 3300025938 Ga0207704_11434988 Ga0207704_114349882 81
220 3300025938 Ga0207704_11758723 Ga0207704_117587232 81
221 3300025940 Ga0207691_10035359 Ga0207691_100353592 81
222 3300025940 Ga0207691_10058984 Ga0207691_100589842 81
223 3300025941 Ga0207711_10310295 Ga0207711_103102952 81
224 3300025942 Ga0207689_10215777 Ga0207689_102157773 81
225 3300025942 Ga0207689_10421572 Ga0207689_104215722 81
226 3300025942 Ga0207689_10607764 Ga0207689_106077641 81
227 3300025944 Ga0207661_11067918 Ga0207661_110679182 81
228 3300025945 Ga0207679_10075990 Ga0207679_100759902 81
229 3300025945 Ga0207679_10741594 Ga0207679_107415942 81
230 3300025949 Ga0207667_10212263 Ga0207667_102122633 81
231 3300025960 Ga0207651_10251827 Ga0207651_102518274 81
232 3300025960 Ga0207651_10262357 Ga0207651_102623573 81
233 3300025961 Ga0207712_10016625 Ga0207712_100166253 81
234 3300025961 Ga0207712_10065375 Ga0207712_100653754 81
235 3300025961 Ga0207712_10067377 Ga0207712_100673774 81
236 3300025961 Ga0207712_10407687 Ga0207712_104076873 81
237 3300025972 Ga0207668_10141681 Ga0207668_101416812 81
238 3300025972 Ga0207668_10372367 Ga0207668_103723673 81
239 3300025981 Ga0207640_10910739 Ga0207640_109107391 81
240 3300025981 Ga0207640_12008459 Ga0207640_120084591 81
241 3300025986 Ga0207658_10203293 Ga0207658_102032933 81
242 3300025986 Ga0207658_10337818 Ga0207658_103378182 81
243 3300026023 Ga0207677_10051727 Ga0207677_100517275 81
244 3300026023 Ga0207677_10885650 Ga0207677_108856502 81
245 3300026035 Ga0207703_10130728 Ga0207703_101307283 81
246 3300026035 Ga0207703_10701910 Ga0207703_107019103 81
247 3300026041 Ga0207639_10005815 Ga0207639_100058154 81
248 3300026067 Ga0207678_10377254 Ga0207678_103772542 81
249 3300026088 Ga0207641_10107687 Ga0207641_101076872 81
250 3300026088 Ga0207641_12530329 Ga0207641_125303292 81
251 3300026089 Ga0207648_10112550 Ga0207648_101125502 81
252 3300026089 Ga0207648_10306938 Ga0207648_103069382 81
253 3300026095 Ga0207676_10041969 Ga0207676_100419692 81
254 3300026095 Ga0207676_10100893 Ga0207676_101008932 81
255 3300026116 Ga0207674_10095428 Ga0207674_100954281 81
256 3300026118 Ga0207675_101261917 Ga0207675_1012619172 81
257 3300026121 Ga0207683_10151683 Ga0207683_101516834 81
258 3300026121 Ga0207683_10564693 Ga0207683_105646932 81
259 3300027876 Ga0209974_10148298 Ga0209974_101482983 81
260 3300027907 Ga0207428_10377396 Ga0207428_103773962 81
261 3300028380 Ga0268265_10037227 Ga0268265_100372276 81
262 3300028380 Ga0268265_10784363 Ga0268265_107843633 81
263 3300028380 Ga0268265_11059250 Ga0268265_110592502 81
264 3300028381 Ga0268264_10012583 Ga0268264_1001258311 81
265 3300028381 Ga0268264_10023783 Ga0268264_100237837 81
266 3300028381 Ga0268264_10909941 Ga0268264_109099413 81
267 3300028381 Ga0268264_11030166 Ga0268264_110301662 81
268 3300028381 Ga0268264_11747932 Ga0268264_117479321 81
269 3300028666 Ga0265336_10104992 Ga0265336_101049922 81
270 3300031548 Ga0307408_100062020 Ga0307408_1000620204 81
271 3300031548 Ga0307408_100277210 Ga0307408_1002772102 81
272 3300031548 Ga0307408_100313658 Ga0307408_1003136582 81
273 3300031548 Ga0307408_100610687 Ga0307408_1006106872 81
274 3300031731 Ga0307405_10068905 Ga0307405_100689052 81
275 3300031731 Ga0307405_10101916 Ga0307405_101019163 81
276 3300031731 Ga0307405_10219433 Ga0307405_102194332 81
277 3300031824 Ga0307413_10004625 Ga0307413_100046253 81
278 3300031824 Ga0307413_10015890 Ga0307413_100158903 81
279 3300031824 Ga0307413_10028181 Ga0307413_100281814 81
280 3300031852 Ga0307410_10003713 Ga0307410_100037132 81
281 3300031852 Ga0307410_10011896 Ga0307410_100118963 81
282 3300031852 Ga0307410_10040173 Ga0307410_100401733 81
283 3300031852 Ga0307410_10167181 Ga0307410_101671813 81
284 3300031852 Ga0307410_10223596 Ga0307410_102235963 81
285 3300031852 Ga0307410_10351655 Ga0307410_103516552 81
286 3300031852 Ga0307410_10458548 Ga0307410_104585483 81
287 3300031901 Ga0307406_10008415 Ga0307406_100084152 81
288 3300031901 Ga0307406_10100866 Ga0307406_101008662 81
289 3300031901 Ga0307406_10146172 Ga0307406_101461722 81
290 3300031901 Ga0307406_10395780 Ga0307406_103957802 81
291 3300031903 Ga0307407_10084239 Ga0307407_100842392 81
292 3300031903 Ga0307407_10119086 Ga0307407_101190862 81
293 3300031903 Ga0307407_10147319 Ga0307407_101473191 81
294 3300031903 Ga0307407_10151533 Ga0307407_101515332 81
295 3300031903 Ga0307407_11009763 Ga0307407_110097632 81
296 3300031911 Ga0307412_10161827 Ga0307412_101618272 81
297 3300031995 Ga0307409_100016440 Ga0307409_1000164405 81
298 3300031995 Ga0307409_100020036 Ga0307409_1000200365 81
299 3300031995 Ga0307409_100022996 Ga0307409_1000229962 81
300 3300031995 Ga0307409_100050242 Ga0307409_1000502424 81
301 3300031995 Ga0307409_100483908 Ga0307409_1004839082 81
302 3300032002 Ga0307416_100011923 Ga0307416_1000119237 81
303 3300032002 Ga0307416_100288474 Ga0307416_1002884742 81
304 3300032002 Ga0307416_100300972 Ga0307416_1003009722 81
305 3300032002 Ga0307416_100654736 Ga0307416_1006547362 81
306 3300032004 Ga0307414_10035221 Ga0307414_100352215 81
307 3300032004 Ga0307414_10176544 Ga0307414_101765442 81
308 3300032004 Ga0307414_11280194 Ga0307414_112801942 81
309 3300032004 Ga0307414_12174825 Ga0307414_121748252 81
310 3300032005 Ga0307411_10006416 Ga0307411_100064163 81
311 3300032005 Ga0307411_10083590 Ga0307411_100835903 81
312 3300032005 Ga0307411_10174845 Ga0307411_101748453 81
313 3300032005 Ga0307411_11435578 Ga0307411_114355782 81
314 3300032005 Ga0307411_11553591 Ga0307411_115535911 81
315 3300032126 Ga0307415_100006754 Ga0307415_1000067544 81
316 3300032126 Ga0307415_100008783 Ga0307415_1000087837 81
317 3300032126 Ga0307415_100069751 Ga0307415_1000697513 81
318 3300032126 Ga0307415_100630662 Ga0307415_1006306622 81
319 3300039453 Ga0436362_1285648 Ga0436362_1285648_449_697 81
320 3300041443 Ga0451789_0603677 Ga0451789_0603677_195_443 81
321 3300041451 Ga0451791_1406720 Ga0451791_1406720_414_665 81
322 3300041451 Ga0451791_1531823 Ga0451791_1531823_95_340 81
323 3300041486 Ga0451807_1151657 Ga0451807_1151657_467_715 81
324 3300041494 Ga0451837_0063136 Ga0451837_0063136_363_608 81
325 3300044693 Ga0466961_0031519 Ga0466961_0031519_444_698 81
326 3300045051 Ga0451576_1676365 Ga0451576_1676365_226_474 81
327 3300047320 Ga0495672_0191506 Ga0495672_0191506_303_551 81
328 3300048907 Ga0496104_0844500 Ga0496104_0844500_55_303 81
329 3300048908 Ga0496105_0472228 Ga0496105_0472228_207_455 81
330 3300048912 Ga0496109_0340484 Ga0496109_0340484_634_882 81
331 3300048914 Ga0496111_0624403 Ga0496111_0624403_513_761 81
332 3300048915 Ga0496112_1356817 Ga0496112_1356817_326_574 81
333 3300048917 Ga0496114_0385970 Ga0496114_0385970_457_705 81
334 3300049588 Ga0501072_0002774 Ga0501072_0002774_9057_9305 81
335 3300049660 Ga0501216_004602 Ga0501216_004602_1720_1968 81
336 3300049661 Ga0501217_030293 Ga0501217_030293_559_807 81
337 3300049668 Ga0501233_253684 Ga0501233_253684_172_417 81
338 3300049669 Ga0501235_025127 Ga0501235_025127_563_811 81
339 3300049674 Ga0501242_016230 Ga0501242_016230_489_737 81
340 3300049677 Ga0501247_008872 Ga0501247_008872_468_716 81
341 3300049686 Ga0501257_065392 Ga0501257_065392_96_344 81
342 3300049760 Ga0501263_011189 Ga0501263_011189_322_570 81
343 3300049765 Ga0501268_001076 Ga0501268_001076_127_375 81
344 3300049767 Ga0501270_012726 Ga0501270_012726_670_918 81
345 3300049770 Ga0501273_013161 Ga0501273_013161_706_954 81
346 3300050511 nmdc:mga08y16_60998_c1 nmdc:mga08y16_60998_c1_350_598 81
347 3300059421 Ga0590071_170189 Ga0590071_170189_172_417 81

Feature Viewer

pLDDT pTM Quality
73.07 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map