F417291

General Info

Members Datasets Scaffolds Average Seq Length
347 182 694 218

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0059273|Ga0496125_0059273_1850_2614
Length 249
Sequence VLEVAMAGFPATGLSARSGSQEATRDDYMTRSVIVTGGFGVLGQAVAEAFAARGDKVARVDFAPQAGSALPDALDIGGVDLTNPSATQAALARVVETHGGIDVLINVAGGFQWETLGDGDIGTWARMHAMNVMTAATITQLALPELTKSSQGRIVNIGAGAAIRAGYAASKSGVHRLTEALAEELAGTSVTVNAVLPSIIDTPTNRADMPDADVSQWVKPAAVADVILFLASPSASAVTGALIPVTRGG

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
94 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
127 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
162 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
163 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
164 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
165 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
169 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
170 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
171 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
172 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
173 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
174 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
175 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
176 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
177 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
178 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
179 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
180 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
181 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
182 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.39
Metatranscriptomes 0.29
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.1
Nodule 2.02
Rhizoplane 3.46
Rhizosphere 67.72
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0059273 3300048928 Bacteria 3086
2 SwRhRL2b_contig_2237776 2162886007 Bacteria 72079
3 SwRhRL2b_contig_609907 2162886007 Bacteria 8323
4 JGI24748J21848_1003142 3300002074 Bacteria 1883
5 JGI24034J26672_10010584 3300002239 Bacteria 1373
6 Ga0065704_10070144 3300005289 Bacteria 333223
7 Ga0065704_10070353 3300005289 Bacteria 30695
8 Ga0065704_10079357 3300005289 Bacteria 4186
9 Ga0065704_10100451 3300005289 Bacteria 2273
10 Ga0070658_10000662 3300005327 Bacteria 29749
11 Ga0070670_100001014 3300005331 Bacteria 22159
12 Ga0070670_100001295 3300005331 Bacteria 19949
13 Ga0070670_100056295 3300005331 Bacteria 3375
14 Ga0070666_10043538 3300005335 Bacteria 3007
15 Ga0070666_10211868 3300005335 Bacteria 1365
16 Ga0070680_100157499 3300005336 Bacteria 1908
17 Ga0070680_100334013 3300005336 Bacteria 1287
18 Ga0070660_100197554 3300005339 Bacteria 1631
19 Ga0070668_100000294 3300005347 Bacteria 32833
20 Ga0070668_100004132 3300005347 Bacteria 10752
21 Ga0070668_100008751 3300005347 Bacteria 7519
22 Ga0070668_100038911 3300005347 Bacteria 3637
23 Ga0070668_100103895 3300005347 Bacteria 2254
24 Ga0070669_100000088 3300005353 Bacteria 88307
25 Ga0070669_100012983 3300005353 Bacteria 5915
26 Ga0070671_100002304 3300005355 Bacteria 14739
27 Ga0070671_100105426 3300005355 Bacteria 2366
28 Ga0070667_100001243 3300005367 Bacteria 23143
29 Ga0070667_100001874 3300005367 Bacteria 18692
30 Ga0070667_100002797 3300005367 Bacteria 15061
31 Ga0070667_100003992 3300005367 Bacteria 12500
32 Ga0070681_10058264 3300005458 Bacteria 3843
33 Ga0070681_10400995 3300005458 Bacteria 1283
34 Ga0070685_10013010 3300005466 Bacteria 4382
35 Ga0070679_100249338 3300005530 Bacteria 1732
36 Ga0068853_100529673 3300005539 Bacteria 1114
37 Ga0070665_100000107 3300005548 Bacteria 156048
38 Ga0070665_100002409 3300005548 Bacteria 20630
39 Ga0070665_100003086 3300005548 Bacteria 17942
40 Ga0070665_100068076 3300005548 Bacteria 3570
41 Ga0068855_100000377 3300005563 Bacteria 55242
42 Ga0068855_100001717 3300005563 Bacteria 27389
43 Ga0068855_100003476 3300005563 Bacteria 19279
44 Ga0068855_100078423 3300005563 Bacteria 3832
45 Ga0068855_100362048 3300005563 Bacteria 1596
46 Ga0068857_100489594 3300005577 Bacteria 1153
47 Ga0068854_100001304 3300005578 Bacteria 15034
48 Ga0068854_100097603 3300005578 Bacteria 2197
49 Ga0068856_100001641 3300005614 Bacteria 23439
50 Ga0068856_100372618 3300005614 Bacteria 1447
51 Ga0068852_100000175 3300005616 Bacteria 43326
52 Ga0068852_100079610 3300005616 Bacteria 2903
53 Ga0068859_100031243 3300005617 Bacteria 5346
54 Ga0068859_100286011 3300005617 Bacteria 1742
55 Ga0068859_100388365 3300005617 Bacteria 1491
56 Ga0068859_100580037 3300005617 Bacteria 1215
57 Ga0068864_100000359 3300005618 Bacteria 39955
58 Ga0068864_100000529 3300005618 Bacteria 32834
59 Ga0068863_100001076 3300005841 Bacteria 27308
60 Ga0068863_100001341 3300005841 Bacteria 24489
61 Ga0068863_100003979 3300005841 Bacteria 14592
62 Ga0068863_100640032 3300005841 Bacteria 1054
63 Ga0068858_100016492 3300005842 Bacteria 6937
64 Ga0068858_100078817 3300005842 Bacteria 3061
65 Ga0068858_100405712 3300005842 Bacteria 1310
66 Ga0068860_100000501 3300005843 Bacteria 48658
67 Ga0068860_100031267 3300005843 Bacteria 5118
68 Ga0068860_100039967 3300005843 Bacteria 4485
69 Ga0068860_100141427 3300005843 Bacteria 2313
70 Ga0068862_100000874 3300005844 Bacteria 29378
71 Ga0068862_100001643 3300005844 Bacteria 20325
72 Ga0068862_100001714 3300005844 Bacteria 19837
73 Ga0068862_100004078 3300005844 Bacteria 12388
74 Ga0068862_100014985 3300005844 Bacteria 6438
75 Ga0081455_10009170 3300005937 Bacteria 10198
76 Ga0075365_10010364 3300006038 Bacteria 5422
77 Ga0075368_10015954 3300006042 Bacteria 2792
78 Ga0075363_100005520 3300006048 Bacteria 5638
79 Ga0075363_100022440 3300006048 Bacteria 3191
80 Ga0075364_10005319 3300006051 Bacteria 7469
81 Ga0075362_10000021 3300006177 Bacteria 62684
82 Ga0075362_10002807 3300006177 Bacteria 5943
83 Ga0075362_10049740 3300006177 Bacteria 1873
84 Ga0075367_10003503 3300006178 Bacteria 7496
85 Ga0075369_10044667 3300006186 Bacteria 1904
86 Ga0075366_10001055 3300006195 Bacteria 13520
87 Ga0075366_10001558 3300006195 Bacteria 11460
88 Ga0075370_10000061 3300006353 Bacteria 32363
89 Ga0097620_100031244 3300006931 Bacteria 5346
90 Ga0097620_100286023 3300006931 Bacteria 1742
91 Ga0097620_100388364 3300006931 Bacteria 1491
92 Ga0097620_100580108 3300006931 Bacteria 1215
93 Ga0079104_1025486 3300006946 Bacteria 1543
94 Ga0079104_1035920 3300006946 Bacteria 1193
95 Ga0105251_10000610 3300009011 Bacteria 32792
96 Ga0105251_10004321 3300009011 Bacteria 9733
97 Ga0105250_10010627 3300009092 Bacteria 3835
98 Ga0105240_10001747 3300009093 Bacteria 36697
99 Ga0105240_10017212 3300009093 Bacteria 9750
100 Ga0105240_10058512 3300009093 Bacteria 4811
101 Ga0105240_10085955 3300009093 Bacteria 3853
102 Ga0105240_10088533 3300009093 Bacteria 3788
103 Ga0105240_10223451 3300009093 Bacteria 2193
104 Ga0105240_10911215 3300009093 Bacteria 945
105 Ga0105247_10014562 3300009101 Bacteria 4717
106 Ga0105247_10110566 3300009101 Bacteria 1768
107 Ga0105248_10000684 3300009177 Bacteria 38302
108 Ga0105248_10012619 3300009177 Bacteria 9323
109 Ga0105248_10013141 3300009177 Bacteria 9116
110 Ga0105248_10138622 3300009177 Bacteria 2744
111 Ga0105237_10013090 3300009545 Bacteria 8711
112 Ga0105237_10028057 3300009545 Bacteria 5735
113 Ga0105249_10000667 3300009553 Bacteria 31155
114 Ga0105249_10453278 3300009553 Bacteria 1322
115 Ga0157370_10375866 3300013104 Bacteria 1309
116 Ga0157369_10001351 3300013105 Bacteria 30295
117 Ga0163162_10031040 3300013306 Bacteria 5298
118 Ga0163163_10317302 3300014325 Bacteria 1612
119 Ga0163163_11094222 3300014325 Unclassified 860
120 Ga0157380_10107619 3300014326 Bacteria 2335
121 Ga0157380_10576521 3300014326 Bacteria 1109
122 Ga0157379_10029060 3300014968 Bacteria 4915
123 Ga0157379_10034013 3300014968 Bacteria 4543
124 Ga0206356_11112170 3300020070 Bacteria 2814
125 Ga0209050_1000961 3300025298 Bacteria 37162
126 Ga0207696_1013221 3300025711 Bacteria 2888
127 Ga0207713_1000654 3300025735 Bacteria 33016
128 Ga0207713_1004171 3300025735 Bacteria 9482
129 Ga0207713_1004973 3300025735 Bacteria 8489
130 Ga0207710_10015788 3300025900 Bacteria 3193
131 Ga0207680_10227424 3300025903 Bacteria 1281
132 Ga0207705_10000009 3300025909 Bacteria 576128
133 Ga0207707_10044443 3300025912 Bacteria 3874
134 Ga0207707_10680240 3300025912 Bacteria 865
135 Ga0207695_10001602 3300025913 Bacteria 36745
136 Ga0207695_10002541 3300025913 Bacteria 26799
137 Ga0207695_10093590 3300025913 Bacteria 3014
138 Ga0207695_10177753 3300025913 Bacteria 2050
139 Ga0207695_10480505 3300025913 Bacteria 1125
140 Ga0207660_10118268 3300025917 Bacteria 2004
141 Ga0207657_10239686 3300025919 Bacteria 1448
142 Ga0207681_10000307 3300025923 Bacteria 35939
143 Ga0207681_10000336 3300025923 Bacteria 33758
144 Ga0207650_10000014 3300025925 Bacteria 398063
145 Ga0207650_10000540 3300025925 Bacteria 30938
146 Ga0207644_10007680 3300025931 Bacteria 7035
147 Ga0207711_10000027 3300025941 Bacteria 236548
148 Ga0207711_10012600 3300025941 Bacteria 7023
149 Ga0207711_10153778 3300025941 Bacteria 2078
150 Ga0207711_10158542 3300025941 Bacteria 2047
151 Ga0207667_10000537 3300025949 Bacteria 50070
152 Ga0207667_10005357 3300025949 Bacteria 15638
153 Ga0207667_10020357 3300025949 Bacteria 7383
154 Ga0207667_10063857 3300025949 Bacteria 3846
155 Ga0207667_10309379 3300025949 Bacteria 1614
156 Ga0207712_10000632 3300025961 Bacteria 27823
157 Ga0207712_10016615 3300025961 Bacteria 4771
158 Ga0207668_10000307 3300025972 Bacteria 32051
159 Ga0207668_10001525 3300025972 Bacteria 13545
160 Ga0207668_10001543 3300025972 Bacteria 13467
161 Ga0207668_10012241 3300025972 Bacteria 5245
162 Ga0207668_10046135 3300025972 Bacteria 2976
163 Ga0207640_10000334 3300025981 Bacteria 31339
164 Ga0207640_10076947 3300025981 Bacteria 2267
165 Ga0207658_10000402 3300025986 Bacteria 41365
166 Ga0207658_10001082 3300025986 Bacteria 22072
167 Ga0207658_10002871 3300025986 Bacteria 12343
168 Ga0207658_10024605 3300025986 Bacteria 4213
169 Ga0207658_10065998 3300025986 Bacteria 2720
170 Ga0207703_10007039 3300026035 Bacteria 8948
171 Ga0207703_10029233 3300026035 Bacteria 4347
172 Ga0207703_10359951 3300026035 Bacteria 1342
173 Ga0207639_10080280 3300026041 Bacteria 2580
174 Ga0207702_10004898 3300026078 Bacteria 11784
175 Ga0207702_10271457 3300026078 Bacteria 1600
176 Ga0207641_10000474 3300026088 Bacteria 45487
177 Ga0207641_10001186 3300026088 Bacteria 26142
178 Ga0207641_10006434 3300026088 Bacteria 9902
179 Ga0207641_11000836 3300026088 Bacteria 832
180 Ga0207676_10000164 3300026095 Bacteria 57910
181 Ga0207676_10000186 3300026095 Bacteria 54426
182 Ga0207674_10635638 3300026116 Bacteria 1031
183 Ga0207675_100501909 3300026118 Bacteria 1208
184 Ga0207698_10000200 3300026142 Bacteria 37521
185 Ga0209281_1019874 3300027111 Bacteria 1321
186 Ga0209281_1034179 3300027111 Bacteria 889
187 Ga0209813_10000227 3300027866 Bacteria 17227
188 Ga0268266_10000462 3300028379 Bacteria 59105
189 Ga0268266_10001390 3300028379 Bacteria 29066
190 Ga0268266_10007737 3300028379 Bacteria 9642
191 Ga0268266_10008593 3300028379 Bacteria 9071
192 Ga0268265_10001350 3300028380 Bacteria 20910
193 Ga0268265_10003016 3300028380 Bacteria 12291
194 Ga0268265_10005352 3300028380 Bacteria 8793
195 Ga0268265_10014004 3300028380 Bacteria 5462
196 Ga0268265_10058027 3300028380 Bacteria 2953
197 Ga0268264_10000396 3300028381 Bacteria 62748
198 Ga0268264_10025983 3300028381 Bacteria 4781
199 Ga0268264_10026630 3300028381 Bacteria 4725
200 Ga0268264_10080827 3300028381 Bacteria 2776
201 Ga0265327_10001770 3300031251 Bacteria 25518
202 Ga0307508_10015787 3300031616 Bacteria 6881
203 Ga0307516_10000002 3300031730 Bacteria 467851
204 Ga0307414_10005336 3300032004 Bacteria 7071
205 Ga0307414_10054943 3300032004 Bacteria 2785
206 Ga0307414_10084906 3300032004 Bacteria 2330
207 Ga0307414_10105950 3300032004 Bacteria 2127
208 Ga0307414_10608047 3300032004 Bacteria 981
209 Ga0373948_0009706 3300034817 Bacteria 1666
210 Ga0373932_0099496 3300035112 Bacteria 944
211 Ga0373936_0007094 3300035113 Bacteria 4215
212 Ga0373931_0330976 3300035691 Bacteria 949
213 Ga0395898_0309563 3300037466 Bacteria 1507
214 Ga0395905_0001990 3300037471 Bacteria 23354
215 Ga0395901_0111937 3300038443 Bacteria 2867
216 Ga0436365_0441048 3300039437 Bacteria 1242
217 Ga0436363_1423806 3300039450 Bacteria 1360
218 Ga0436362_1081834 3300039453 Bacteria 704
219 Ga0451841_1444619 3300041498 Bacteria 853
220 Ga0466969_0002347 3300044656 Bacteria 10111
221 Ga0466966_0011107 3300044684 Bacteria 5974
222 Ga0466966_0057313 3300044684 Bacteria 2463
223 Ga0466961_0008070 3300044693 Bacteria 6709
224 Ga0466964_0040301 3300044706 Bacteria 1885
225 Ga0466971_0041733 3300044719 Bacteria 2061
226 Ga0466971_0048641 3300044719 Bacteria 1906
227 Ga0466970_0010288 3300044765 Bacteria 4746
228 Ga0466959_0005198 3300045049 Bacteria 8877
229 Ga0466959_0027556 3300045049 Bacteria 4213
230 Ga0495596_0003969 3300046500 Bacteria 7313
231 Ga0495596_0016870 3300046500 Bacteria 3030
232 Ga0495607_0001817 3300046501 Bacteria 18207
233 Ga0495607_0085845 3300046501 Bacteria 1718
234 Ga0495583_0021605 3300046506 Bacteria 3307
235 Ga0495606_0050521 3300046507 Bacteria 2720
236 Ga0495610_0000433 3300046512 Bacteria 42994
237 Ga0495632_0074646 3300046519 Bacteria 1624
238 Ga0495632_0120473 3300046519 Bacteria 1226
239 Ga0495643_0000027 3300046522 Bacteria 266446
240 Ga0495643_0025426 3300046522 Bacteria 3349
241 Ga0495643_0058680 3300046522 Bacteria 2047
242 Ga0495644_0229732 3300046523 Bacteria 718
243 Ga0495609_0037734 3300046538 Bacteria 2179
244 Ga0495625_0004268 3300046660 Bacteria 13603
245 Ga0495669_0016997 3300046684 Bacteria 3120
246 Ga0495613_0217690 3300046689 Bacteria 1341
247 Ga0495671_0087479 3300046692 Bacteria 1526
248 Ga0495673_0000039 3300047469 Bacteria 301943
249 Ga0495686_0054163 3300047472 Bacteria 2513
250 Ga0495686_0104538 3300047472 Bacteria 1705
251 Ga0495615_0001011 3300048090 Bacteria 3997
252 Ga0495626_0016318 3300048091 Bacteria 3775
253 Ga0496101_0142161 3300048904 Bacteria 1830
254 Ga0496102_0000366 3300048905 Bacteria 54318
255 Ga0496102_0046995 3300048905 Bacteria 3921
256 Ga0496103_0000505 3300048906 Bacteria 32245
257 Ga0496103_0007892 3300048906 Bacteria 6330
258 Ga0496103_0059513 3300048906 Bacteria 2373
259 Ga0496104_0000601 3300048907 Bacteria 30849
260 Ga0496105_0000325 3300048908 Bacteria 31227
261 Ga0496106_0230458 3300048909 Bacteria 1479
262 Ga0496107_0030706 3300048910 Bacteria 3831
263 Ga0496112_0073952 3300048915 Bacteria 3369
264 Ga0496113_0129304 3300048916 Bacteria 1980
265 Ga0496116_0000028 3300048919 Bacteria 424086
266 Ga0496116_0057149 3300048919 Bacteria 2552
267 Ga0496116_0059658 3300048919 Bacteria 2480
268 Ga0496117_0022884 3300048920 Bacteria 5003
269 Ga0496117_0025954 3300048920 Bacteria 4594
270 Ga0496117_0134189 3300048920 Bacteria 1494
271 Ga0496118_0000666 3300048921 Bacteria 56142
272 Ga0496118_0010534 3300048921 Bacteria 9144
273 Ga0496118_0015131 3300048921 Bacteria 7164
274 Ga0496118_0159023 3300048921 Bacteria 1400
275 Ga0496119_0000123 3300048922 Bacteria 108805
276 Ga0496120_0000362 3300048923 Bacteria 73745
277 Ga0496120_0102559 3300048923 Bacteria 1509
278 Ga0496121_0001209 3300048924 Bacteria 45122
279 Ga0496121_0002014 3300048924 Bacteria 32249
280 Ga0496121_0008330 3300048924 Bacteria 12246
281 Ga0496121_0078154 3300048924 Bacteria 2632
282 Ga0496122_0002442 3300048925 Bacteria 26362
283 Ga0496122_0005825 3300048925 Bacteria 14481
284 Ga0496122_0079927 3300048925 Bacteria 2282
285 Ga0496122_0123041 3300048925 Bacteria 1668
286 Ga0496123_0002512 3300048926 Bacteria 22543
287 Ga0496123_0019548 3300048926 Bacteria 5336
288 Ga0496123_0024028 3300048926 Bacteria 4646
289 Ga0496123_0136843 3300048926 Bacteria 1347
290 Ga0496124_0002340 3300048927 Bacteria 25012
291 Ga0496124_0003964 3300048927 Bacteria 17651
292 Ga0496124_0006128 3300048927 Bacteria 13199
293 Ga0496124_0033170 3300048927 Bacteria 4545
294 Ga0496124_0301364 3300048927 Bacteria 1157
295 Ga0496125_0007634 3300048928 Bacteria 11472
296 Ga0496125_0033264 3300048928 Bacteria 4565
297 Ga0496125_0043011 3300048928 Bacteria 3840
298 Ga0496125_0103194 3300048928 Bacteria 2093
299 Ga0496126_0000045 3300048929 Bacteria 331225
300 Ga0496126_0000124 3300048929 Bacteria 180422
301 Ga0501033_0494259 3300049570 Bacteria 847
302 Ga0501224_011207 3300049664 Bacteria 1318
303 Ga0501044_0001405 3300049823 Bacteria 28253
304 nmdc:mga03683_2670_c1 3300050489 Bacteria 5586
305 nmdc:mga03683_69_c1 3300050489 Bacteria 38507
306 nmdc:mga03n38_13753_c1 3300050490 Bacteria 3084
307 nmdc:mga00v17_12845_c1 3300050491 Bacteria 4632
308 nmdc:mga00v17_133455_c1 3300050491 Bacteria 1588
309 nmdc:mga00v17_18828_c1 3300050491 Bacteria 3930
310 nmdc:mga00v17_44970_c1 3300050491 Bacteria 2665
311 nmdc:mga0k408_21465_c1 3300050493 Bacteria 3627
312 nmdc:mga0k408_45_c1 3300050493 Bacteria 63055
313 nmdc:mga06z11_339_c1 3300050494 Bacteria 17739
314 nmdc:mga04h51_67_c1 3300050495 Bacteria 33109
315 nmdc:mga07m45_39_c1 3300050496 Bacteria 63381
316 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
317 nmdc:mga0sz30_200_c1 3300050516 Bacteria 22358
318 nmdc:mga0sz30_4738_c1 3300050516 Bacteria 4938
319 Ga0500635_0000454 3300053080 Bacteria 11802
320 Ga0500647_0033700 3300053091 Bacteria 2444
321 Ga0500641_0129260 3300053096 Bacteria 1090
322 Ga0500607_000162 3300053121 Bacteria 57883
323 Ga0500607_000828 3300053121 Bacteria 29784
324 Ga0500607_214977 3300053121 Bacteria 808
325 Ga0500559_0000350 3300053136 Bacteria 34594
326 Ga0500577_0000640 3300053142 Bacteria 8987
327 Ga0500624_030183 3300053157 Bacteria 927
328 Ga0500637_0003965 3300053178 Bacteria 6928
329 Ga0500637_0157601 3300053178 Bacteria 1309
330 Ga0500645_003263 3300053730 Bacteria 6695
331 Ga0466962_0000419 3300061719 Bacteria 18341
332 Ga0466962_0032865 3300061719 Bacteria 2483
333 2511128310 2510917021 Bacteria 5705459
334 2643884331 2643221574 Bacteria 2789653
335 2643999073 2643221598 Bacteria 4578346
336 2644086216 2643221614 Bacteria 4260023
337 2644344714 2643221661 Bacteria 4267604
338 2644367457 2643221666 Bacteria 4265935
339 2644548718 2643221699 Bacteria 5731501
340 2819553452 2818991438 Bacteria 5793701
341 2842039027 2842038055 Bacteria 8002051
342 2842048026 2842045827 Bacteria 8006841
343 2874627794 2874620515 Bacteria 8290088
344 2876764125 2876761206 Bacteria 10111113
345 2904672886 2904666416 Bacteria 8226587
346 2941487255 2941485952 Bacteria 3591484
347 8054302546 8054302542 Bacteria 5698134
348 Ga0496125_0059273
349 SwRhRL2b_contig_2237776
350 SwRhRL2b_contig_609907
351 JGI24748J21848_1003142
352 JGI24034J26672_10010584
353 Ga0065704_10070144
354 Ga0065704_10070353
355 Ga0065704_10079357
356 Ga0065704_10100451
357 Ga0070658_10000662
358 Ga0070670_100001014
359 Ga0070670_100001295
360 Ga0070670_100056295
361 Ga0070666_10043538
362 Ga0070666_10211868
363 Ga0070680_100157499
364 Ga0070680_100334013
365 Ga0070660_100197554
366 Ga0070668_100000294
367 Ga0070668_100004132
368 Ga0070668_100008751
369 Ga0070668_100038911
370 Ga0070668_100103895
371 Ga0070669_100000088
372 Ga0070669_100012983
373 Ga0070671_100002304
374 Ga0070671_100105426
375 Ga0070667_100001243
376 Ga0070667_100001874
377 Ga0070667_100002797
378 Ga0070667_100003992
379 Ga0070681_10058264
380 Ga0070681_10400995
381 Ga0070685_10013010
382 Ga0070679_100249338
383 Ga0068853_100529673
384 Ga0070665_100000107
385 Ga0070665_100002409
386 Ga0070665_100003086
387 Ga0070665_100068076
388 Ga0068855_100000377
389 Ga0068855_100001717
390 Ga0068855_100003476
391 Ga0068855_100078423
392 Ga0068855_100362048
393 Ga0068857_100489594
394 Ga0068854_100001304
395 Ga0068854_100097603
396 Ga0068856_100001641
397 Ga0068856_100372618
398 Ga0068852_100000175
399 Ga0068852_100079610
400 Ga0068859_100031243
401 Ga0068859_100286011
402 Ga0068859_100388365
403 Ga0068859_100580037
404 Ga0068864_100000359
405 Ga0068864_100000529
406 Ga0068863_100001076
407 Ga0068863_100001341
408 Ga0068863_100003979
409 Ga0068863_100640032
410 Ga0068858_100016492
411 Ga0068858_100078817
412 Ga0068858_100405712
413 Ga0068860_100000501
414 Ga0068860_100031267
415 Ga0068860_100039967
416 Ga0068860_100141427
417 Ga0068862_100000874
418 Ga0068862_100001643
419 Ga0068862_100001714
420 Ga0068862_100004078
421 Ga0068862_100014985
422 Ga0081455_10009170
423 Ga0075365_10010364
424 Ga0075368_10015954
425 Ga0075363_100005520
426 Ga0075363_100022440
427 Ga0075364_10005319
428 Ga0075362_10000021
429 Ga0075362_10002807
430 Ga0075362_10049740
431 Ga0075367_10003503
432 Ga0075369_10044667
433 Ga0075366_10001055
434 Ga0075366_10001558
435 Ga0075370_10000061
436 Ga0097620_100031244
437 Ga0097620_100286023
438 Ga0097620_100388364
439 Ga0097620_100580108
440 Ga0079104_1025486
441 Ga0079104_1035920
442 Ga0105251_10000610
443 Ga0105251_10004321
444 Ga0105250_10010627
445 Ga0105240_10001747
446 Ga0105240_10017212
447 Ga0105240_10058512
448 Ga0105240_10085955
449 Ga0105240_10088533
450 Ga0105240_10223451
451 Ga0105240_10911215
452 Ga0105247_10014562
453 Ga0105247_10110566
454 Ga0105248_10000684
455 Ga0105248_10012619
456 Ga0105248_10013141
457 Ga0105248_10138622
458 Ga0105237_10013090
459 Ga0105237_10028057
460 Ga0105249_10000667
461 Ga0105249_10453278
462 Ga0157370_10375866
463 Ga0157369_10001351
464 Ga0163162_10031040
465 Ga0163163_10317302
466 Ga0163163_11094222
467 Ga0157380_10107619
468 Ga0157380_10576521
469 Ga0157379_10029060
470 Ga0157379_10034013
471 Ga0206356_11112170
472 Ga0209050_1000961
473 Ga0207696_1013221
474 Ga0207713_1000654
475 Ga0207713_1004171
476 Ga0207713_1004973
477 Ga0207710_10015788
478 Ga0207680_10227424
479 Ga0207705_10000009
480 Ga0207707_10044443
481 Ga0207707_10680240
482 Ga0207695_10001602
483 Ga0207695_10002541
484 Ga0207695_10093590
485 Ga0207695_10177753
486 Ga0207695_10480505
487 Ga0207660_10118268
488 Ga0207657_10239686
489 Ga0207681_10000307
490 Ga0207681_10000336
491 Ga0207650_10000014
492 Ga0207650_10000540
493 Ga0207644_10007680
494 Ga0207711_10000027
495 Ga0207711_10012600
496 Ga0207711_10153778
497 Ga0207711_10158542
498 Ga0207667_10000537
499 Ga0207667_10005357
500 Ga0207667_10020357
501 Ga0207667_10063857
502 Ga0207667_10309379
503 Ga0207712_10000632
504 Ga0207712_10016615
505 Ga0207668_10000307
506 Ga0207668_10001525
507 Ga0207668_10001543
508 Ga0207668_10012241
509 Ga0207668_10046135
510 Ga0207640_10000334
511 Ga0207640_10076947
512 Ga0207658_10000402
513 Ga0207658_10001082
514 Ga0207658_10002871
515 Ga0207658_10024605
516 Ga0207658_10065998
517 Ga0207703_10007039
518 Ga0207703_10029233
519 Ga0207703_10359951
520 Ga0207639_10080280
521 Ga0207702_10004898
522 Ga0207702_10271457
523 Ga0207641_10000474
524 Ga0207641_10001186
525 Ga0207641_10006434
526 Ga0207641_11000836
527 Ga0207676_10000164
528 Ga0207676_10000186
529 Ga0207674_10635638
530 Ga0207675_100501909
531 Ga0207698_10000200
532 Ga0209281_1019874
533 Ga0209281_1034179
534 Ga0209813_10000227
535 Ga0268266_10000462
536 Ga0268266_10001390
537 Ga0268266_10007737
538 Ga0268266_10008593
539 Ga0268265_10001350
540 Ga0268265_10003016
541 Ga0268265_10005352
542 Ga0268265_10014004
543 Ga0268265_10058027
544 Ga0268264_10000396
545 Ga0268264_10025983
546 Ga0268264_10026630
547 Ga0268264_10080827
548 Ga0265327_10001770
549 Ga0307508_10015787
550 Ga0307516_10000002
551 Ga0307414_10005336
552 Ga0307414_10054943
553 Ga0307414_10084906
554 Ga0307414_10105950
555 Ga0307414_10608047
556 Ga0373948_0009706
557 Ga0373932_0099496
558 Ga0373936_0007094
559 Ga0373931_0330976
560 Ga0395898_0309563
561 Ga0395905_0001990
562 Ga0395901_0111937
563 Ga0436365_0441048
564 Ga0436363_1423806
565 Ga0436362_1081834
566 Ga0451841_1444619
567 Ga0466969_0002347
568 Ga0466966_0011107
569 Ga0466966_0057313
570 Ga0466961_0008070
571 Ga0466964_0040301
572 Ga0466971_0041733
573 Ga0466971_0048641
574 Ga0466970_0010288
575 Ga0466959_0005198
576 Ga0466959_0027556
577 Ga0495596_0003969
578 Ga0495596_0016870
579 Ga0495607_0001817
580 Ga0495607_0085845
581 Ga0495583_0021605
582 Ga0495606_0050521
583 Ga0495610_0000433
584 Ga0495632_0074646
585 Ga0495632_0120473
586 Ga0495643_0000027
587 Ga0495643_0025426
588 Ga0495643_0058680
589 Ga0495644_0229732
590 Ga0495609_0037734
591 Ga0495625_0004268
592 Ga0495669_0016997
593 Ga0495613_0217690
594 Ga0495671_0087479
595 Ga0495673_0000039
596 Ga0495686_0054163
597 Ga0495686_0104538
598 Ga0495615_0001011
599 Ga0495626_0016318
600 Ga0496101_0142161
601 Ga0496102_0000366
602 Ga0496102_0046995
603 Ga0496103_0000505
604 Ga0496103_0007892
605 Ga0496103_0059513
606 Ga0496104_0000601
607 Ga0496105_0000325
608 Ga0496106_0230458
609 Ga0496107_0030706
610 Ga0496112_0073952
611 Ga0496113_0129304
612 Ga0496116_0000028
613 Ga0496116_0057149
614 Ga0496116_0059658
615 Ga0496117_0022884
616 Ga0496117_0025954
617 Ga0496117_0134189
618 Ga0496118_0000666
619 Ga0496118_0010534
620 Ga0496118_0015131
621 Ga0496118_0159023
622 Ga0496119_0000123
623 Ga0496120_0000362
624 Ga0496120_0102559
625 Ga0496121_0001209
626 Ga0496121_0002014
627 Ga0496121_0008330
628 Ga0496121_0078154
629 Ga0496122_0002442
630 Ga0496122_0005825
631 Ga0496122_0079927
632 Ga0496122_0123041
633 Ga0496123_0002512
634 Ga0496123_0019548
635 Ga0496123_0024028
636 Ga0496123_0136843
637 Ga0496124_0002340
638 Ga0496124_0003964
639 Ga0496124_0006128
640 Ga0496124_0033170
641 Ga0496124_0301364
642 Ga0496125_0007634
643 Ga0496125_0033264
644 Ga0496125_0043011
645 Ga0496125_0103194
646 Ga0496126_0000045
647 Ga0496126_0000124
648 Ga0501033_0494259
649 Ga0501224_011207
650 Ga0501044_0001405
651 nmdc:mga03683_2670_c1
652 nmdc:mga03683_69_c1
653 nmdc:mga03n38_13753_c1
654 nmdc:mga00v17_12845_c1
655 nmdc:mga00v17_133455_c1
656 nmdc:mga00v17_18828_c1
657 nmdc:mga00v17_44970_c1
658 nmdc:mga0k408_21465_c1
659 nmdc:mga0k408_45_c1
660 nmdc:mga06z11_339_c1
661 nmdc:mga04h51_67_c1
662 nmdc:mga07m45_39_c1
663 nmdc:mga07m45_5_c2
664 nmdc:mga0sz30_200_c1
665 nmdc:mga0sz30_4738_c1
666 Ga0500635_0000454
667 Ga0500647_0033700
668 Ga0500641_0129260
669 Ga0500607_000162
670 Ga0500607_000828
671 Ga0500607_214977
672 Ga0500559_0000350
673 Ga0500577_0000640
674 Ga0500624_030183
675 Ga0500637_0003965
676 Ga0500637_0157601
677 Ga0500645_003263
678 Ga0466962_0000419
679 Ga0466962_0032865
680 2511128310
681 2643884331
682 2643999073
683 2644086216
684 2644344714
685 2644367457
686 2644548718
687 2819553452
688 2842039027
689 2842048026
690 2874627794
691 2876764125
692 2904672886
693 2941487255
694 8054302546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

213

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

249

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

212

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dqx-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9289 2 214
4dqx-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9184 2 214
4dqx-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9165 2 214
6zzs-assembly2.cif.gz_F-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9112 3 211
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9108 3 214
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9431 3 32 3.40.50.720
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9153 3 211 3.40.50.720
af_A0A0R0JBZ9_6_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9073 77 211 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9057 2 211 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9055 3 214 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A258Y2J8-F1-model_v4 Short-chain dehydrogenase 0.9756 3 111 GO:0016616
GO:0030497
AF-A0A4Y7B5X3-F1-model_v4 deleted 0.9708 3 211
AF-B9TK45-F1-model_v4 Short-chain dehydrogenase, putative 0.9671 3 125
AF-A0A258Y2J8-F1-model_v4 Short-chain dehydrogenase 0.9499 3 111 GO:0016616
GO:0030497
AF-A0A357FTK2-F1-model_v4 Oxidoreductase 0.9479 3 126 GO:0000140
GO:0004806
GO:0005811
GO:0006654
GO:0019433

Map