F417369

General Info

Members Datasets Scaffolds Average Seq Length
348 201 696 235

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10004365|Ga0055531_100043655
Length 255
Sequence LARLRLFETAQQPLDSSPVMPQHKQTRTGLIIRHVPHEGLAGYREPIEAAGYELARLDVADPNFGAADLGEPDLLIMMGGPMGVYEQDAHPWIACQMKRLARRIDAGRPTLGVCFGAQMMAAAMGARVYPGPAKEVGFHPLSFVDPVSPLRHLADVSVLHWHGDTFDLPDDVELLASTPAYPHQAFRRGNNILALQFHGEMGLDPRFDEWLRQWPDALDETGGSVEGMRDLHSRHGPPAVAAGRAMIAEWLAGLS

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
119 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
120 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
131 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
175 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
176 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
177 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
181 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
182 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
183 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
186 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
187 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
188 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
189 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
190 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
191 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
192 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
193 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
194 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
195 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
196 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
197 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
198 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
199 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
200 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
201 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.98
Metatranscriptomes 0
Isolates 4.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 16.09
Nodule 0.29
Rhizoplane 4.31
Rhizosphere 69.54
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10004365 3300003794 Bacteria 8648
2 SwRhRL2b_contig_507762 2162886007 Bacteria 2613
3 SwRhRL2b_contig_890187 2162886007 Bacteria 4644
4 JGI24736J21556_1000067 3300001904 Bacteria 17042
5 JGI24741J21665_1000129 3300001915 Bacteria 20677
6 JGI24752J21851_1000337 3300001976 Bacteria 6524
7 JGI24740J21852_10007691 3300001979 Bacteria 4361
8 JGI24740J21852_10017388 3300001979 Bacteria 2574
9 JGI24739J22299_10006013 3300001989 Bacteria 4594
10 JGI24739J22299_10015445 3300001989 Bacteria 2774
11 JGI24737J22298_10002364 3300001990 Bacteria 6724
12 JGI24735J21928_10006441 3300002067 Bacteria 3864
13 Ga0055537_1001711 3300003773 Bacteria 8110
14 Ga0055524_1000180 3300003775 Bacteria 71495
15 Ga0055536_1002932 3300003781 Bacteria 9370
16 Ga0055536_1009616 3300003781 Bacteria 3965
17 Ga0055534_1009291 3300003784 Bacteria 2148
18 Ga0055528_1030133 3300003790 Bacteria 1448
19 Ga0055530_10014207 3300003791 Bacteria 2665
20 Ga0055531_10017041 3300003794 Bacteria 3092
21 Ga0055543_1006282 3300004625 Bacteria 2899
22 Ga0065165_1002147 3300005262 Bacteria 17875
23 Ga0065165_1007278 3300005262 Bacteria 5496
24 Ga0065704_10073669 3300005289 Bacteria 6905
25 Ga0065707_10161421 3300005295 Bacteria 1560
26 Ga0070690_100048531 3300005330 Bacteria 2704
27 Ga0070670_100000209 3300005331 Bacteria 54253
28 Ga0070670_100122440 3300005331 Bacteria 2244
29 Ga0070666_10001918 3300005335 Bacteria 12652
30 Ga0070666_10296250 3300005335 Bacteria 1151
31 Ga0070682_100269761 3300005337 Bacteria 1236
32 Ga0070660_100018236 3300005339 Bacteria 5125
33 Ga0070661_100014350 3300005344 Bacteria 5580
34 Ga0070668_100000868 3300005347 Bacteria 21031
35 Ga0070668_100005470 3300005347 Bacteria 9430
36 Ga0070669_100000023 3300005353 Bacteria 174496
37 Ga0070669_100001101 3300005353 Bacteria 19761
38 Ga0070669_100006207 3300005353 Bacteria 8626
39 Ga0070671_100000086 3300005355 Bacteria 59637
40 Ga0070659_100006657 3300005366 Bacteria 8351
41 Ga0070659_100009490 3300005366 Bacteria 7151
42 Ga0070667_100000127 3300005367 Bacteria 95853
43 Ga0070667_100000548 3300005367 Bacteria 37357
44 Ga0070667_100002263 3300005367 Bacteria 16955
45 Ga0070667_100002900 3300005367 Bacteria 14733
46 Ga0070667_100084509 3300005367 Bacteria 2720
47 Ga0070663_100000846 3300005455 Bacteria 16556
48 Ga0070663_100090851 3300005455 Bacteria 2262
49 Ga0070662_100002223 3300005457 Bacteria 11916
50 Ga0070662_100304599 3300005457 Bacteria 1295
51 Ga0070685_10201046 3300005466 Bacteria 1295
52 Ga0070684_100143844 3300005535 Bacteria 2158
53 Ga0068853_100006005 3300005539 Bacteria 9605
54 Ga0068853_100028839 3300005539 Bacteria 4671
55 Ga0068853_100105059 3300005539 Bacteria 2501
56 Ga0070686_100004612 3300005544 Bacteria 7597
57 Ga0070665_100004358 3300005548 Bacteria 14889
58 Ga0070665_100497065 3300005548 Bacteria 1231
59 Ga0068855_100213855 3300005563 Bacteria 2165
60 Ga0070664_100293255 3300005564 Bacteria 1468
61 Ga0068857_100025246 3300005577 Bacteria 5233
62 Ga0068857_100123324 3300005577 Bacteria 2334
63 Ga0068857_100246626 3300005577 Bacteria 1636
64 Ga0068857_100594665 3300005577 Bacteria 1045
65 Ga0068856_100003983 3300005614 Bacteria 14795
66 Ga0068856_100046968 3300005614 Bacteria 4253
67 Ga0068852_100025737 3300005616 Bacteria 4772
68 Ga0068859_100023279 3300005617 Bacteria 6216
69 Ga0068859_100099775 3300005617 Bacteria 2959
70 Ga0068864_100000062 3300005618 Bacteria 121206
71 Ga0068864_100003877 3300005618 Bacteria 12314
72 Ga0068851_10016716 3300005834 Bacteria 3515
73 Ga0068851_10277110 3300005834 Bacteria 958
74 Ga0068863_100000064 3300005841 Bacteria 118153
75 Ga0068863_100000103 3300005841 Bacteria 91380
76 Ga0068863_100000225 3300005841 Bacteria 59865
77 Ga0068858_100099067 3300005842 Bacteria 2718
78 Ga0068858_100128849 3300005842 Bacteria 2372
79 Ga0068860_100000093 3300005843 Bacteria 150034
80 Ga0068860_100051175 3300005843 Bacteria 3930
81 Ga0068860_100163781 3300005843 Bacteria 2145
82 Ga0068860_100269478 3300005843 Bacteria 1661
83 Ga0068862_100000063 3300005844 Bacteria 124662
84 Ga0068862_100000079 3300005844 Bacteria 113551
85 Ga0068862_100000425 3300005844 Bacteria 45885
86 Ga0068862_100002732 3300005844 Bacteria 15487
87 Ga0097620_100023280 3300006931 Bacteria 6216
88 Ga0097620_100099773 3300006931 Bacteria 2959
89 Ga0105251_10003959 3300009011 Bacteria 10495
90 Ga0105240_10013008 3300009093 Bacteria 11459
91 Ga0105247_10012293 3300009101 Bacteria 5143
92 Ga0105241_10002171 3300009174 Bacteria 14777
93 Ga0105241_10014391 3300009174 Bacteria 5792
94 Ga0105241_10146656 3300009174 Bacteria 1926
95 Ga0105248_10000014 3300009177 Bacteria 324729
96 Ga0105248_10038576 3300009177 Bacteria 5347
97 Ga0105248_10168380 3300009177 Bacteria 2469
98 Ga0105237_10021045 3300009545 Bacteria 6712
99 Ga0105237_10225479 3300009545 Bacteria 1874
100 Ga0105238_10612378 3300009551 Bacteria 1097
101 Ga0105249_10000103 3300009553 Bacteria 118397
102 Ga0105249_10000907 3300009553 Bacteria 26174
103 Ga0105249_10006886 3300009553 Bacteria 9908
104 Ga0105249_10217435 3300009553 Bacteria 1878
105 Ga0105239_10126170 3300010375 Bacteria 2844
106 Ga0157373_10192199 3300013100 Bacteria 1438
107 Ga0157371_10145673 3300013102 Bacteria 1688
108 Ga0163162_10044267 3300013306 Bacteria 4458
109 Ga0157372_10497134 3300013307 Bacteria 1422
110 Ga0157379_10016305 3300014968 Bacteria 6536
111 Ga0207425_1006174 3300025245 Bacteria 3308
112 Ga0209565_1000012 3300025263 Bacteria 606500
113 Ga0209673_1003940 3300025273 Bacteria 8297
114 Ga0209675_1000235 3300025291 Bacteria 55378
115 Ga0209675_1018775 3300025291 Bacteria 1925
116 Ga0209676_1000045 3300025292 Bacteria 412331
117 Ga0209676_1000641 3300025292 Bacteria 50312
118 Ga0209025_1008395 3300025294 Bacteria 7444
119 Ga0209564_1046018 3300025295 Bacteria 1116
120 Ga0209758_1005936 3300025297 Bacteria 9064
121 Ga0209050_1003217 3300025298 Bacteria 12356
122 Ga0209050_1006065 3300025298 Bacteria 7313
123 Ga0209050_1014150 3300025298 Bacteria 3465
124 Ga0209256_1000012 3300025299 Bacteria 790371
125 Ga0209257_1002214 3300025304 Bacteria 20037
126 Ga0209257_1002738 3300025304 Bacteria 16712
127 Ga0207697_10001233 3300025315 Bacteria 14016
128 Ga0207656_10096099 3300025321 Bacteria 1352
129 Ga0207713_1006508 3300025735 Bacteria 7103
130 Ga0207680_10000062 3300025903 Bacteria 48850
131 Ga0207680_10005345 3300025903 Bacteria 6131
132 Ga0207680_10027383 3300025903 Bacteria 3173
133 Ga0207705_10278375 3300025909 Bacteria 1280
134 Ga0207654_10000931 3300025911 Bacteria 16142
135 Ga0207654_10008026 3300025911 Bacteria 5322
136 Ga0207695_10026121 3300025913 Bacteria 6522
137 Ga0207695_10035516 3300025913 Bacteria 5405
138 Ga0207671_10028923 3300025914 Bacteria 4140
139 Ga0207657_10012417 3300025919 Bacteria 8416
140 Ga0207657_10036691 3300025919 Bacteria 4384
141 Ga0207649_10014871 3300025920 Bacteria 4365
142 Ga0207681_10000004 3300025923 Bacteria 559005
143 Ga0207681_10001495 3300025923 Bacteria 15086
144 Ga0207681_10170211 3300025923 Bacteria 1650
145 Ga0207694_10018672 3300025924 Bacteria 5243
146 Ga0207694_10129335 3300025924 Bacteria 2023
147 Ga0207650_10000367 3300025925 Bacteria 42933
148 Ga0207650_10261943 3300025925 Bacteria 1403
149 Ga0207644_10000011 3300025931 Bacteria 223950
150 Ga0207690_10068710 3300025932 Unclassified 2435
151 Ga0207690_10807906 3300025932 Bacteria 775
152 Ga0207706_10027117 3300025933 Bacteria 5124
153 Ga0207711_10000021 3300025941 Bacteria 355952
154 Ga0207711_10667523 3300025941 Bacteria 970
155 Ga0207679_10499478 3300025945 Bacteria 1085
156 Ga0207667_10018821 3300025949 Bacteria 7733
157 Ga0207667_10094343 3300025949 Bacteria 3089
158 Ga0207712_10000069 3300025961 Bacteria 127318
159 Ga0207712_10000687 3300025961 Bacteria 26162
160 Ga0207712_10001707 3300025961 Bacteria 14745
161 Ga0207712_10185307 3300025961 Bacteria 1638
162 Ga0207668_10000370 3300025972 Bacteria 28629
163 Ga0207668_10000384 3300025972 Bacteria 28142
164 Ga0207668_10072325 3300025972 Bacteria 2467
165 Ga0207668_10257234 3300025972 Bacteria 1421
166 Ga0207640_10034529 3300025981 Bacteria 3157
167 Ga0207640_10145175 3300025981 Bacteria 1735
168 Ga0207640_10220813 3300025981 Bacteria 1451
169 Ga0207658_10000424 3300025986 Bacteria 40038
170 Ga0207658_10000472 3300025986 Bacteria 37417
171 Ga0207658_10004711 3300025986 Bacteria 9447
172 Ga0207658_10212991 3300025986 Bacteria 1620
173 Ga0207703_10121225 3300026035 Bacteria 2245
174 Ga0207703_10173090 3300026035 Bacteria 1900
175 Ga0207639_10000169 3300026041 Bacteria 50659
176 Ga0207639_10003655 3300026041 Bacteria 10337
177 Ga0207639_10011333 3300026041 Bacteria 6189
178 Ga0207678_10001016 3300026067 Bacteria 25610
179 Ga0207678_10002260 3300026067 Bacteria 17440
180 Ga0207702_10002789 3300026078 Bacteria 16378
181 Ga0207702_10011415 3300026078 Bacteria 7405
182 Ga0207641_10000107 3300026088 Bacteria 121220
183 Ga0207641_10000113 3300026088 Bacteria 119188
184 Ga0207641_10000367 3300026088 Bacteria 53540
185 Ga0207641_10003191 3300026088 Bacteria 14682
186 Ga0207641_10292791 3300026088 Bacteria 1535
187 Ga0207676_10000057 3300026095 Bacteria 121220
188 Ga0207676_10002371 3300026095 Bacteria 13449
189 Ga0207674_10068249 3300026116 Bacteria 3578
190 Ga0207674_10081793 3300026116 Bacteria 3231
191 Ga0207674_10140171 3300026116 Bacteria 2377
192 Ga0207698_10001722 3300026142 Bacteria 12747
193 Ga0207698_10120937 3300026142 Bacteria 2216
194 Ga0268266_10018088 3300028379 Bacteria 6007
195 Ga0268266_10239732 3300028379 Bacteria 1673
196 Ga0268265_10000046 3300028380 Bacteria 179361
197 Ga0268265_10000055 3300028380 Bacteria 158947
198 Ga0268265_10000080 3300028380 Bacteria 121220
199 Ga0268265_10018635 3300028380 Bacteria 4813
200 Ga0268264_10000067 3300028381 Bacteria 284445
201 Ga0268264_10018866 3300028381 Bacteria 5640
202 Ga0268264_10155011 3300028381 Bacteria 2058
203 Ga0307408_100007397 3300031548 Bacteria 7265
204 Ga0307408_100041091 3300031548 Bacteria 3277
205 Ga0307408_100147115 3300031548 Bacteria 1856
206 Ga0307408_100342690 3300031548 Bacteria 1265
207 Ga0307405_10006629 3300031731 Bacteria 5713
208 Ga0307405_10027704 3300031731 Bacteria 3289
209 Ga0307405_10520387 3300031731 Bacteria 957
210 Ga0307410_10093950 3300031852 Bacteria 2135
211 Ga0307410_10345365 3300031852 Bacteria 1187
212 Ga0307406_10068617 3300031901 Bacteria 2315
213 Ga0307412_10006353 3300031911 Bacteria 6677
214 Ga0307412_10009431 3300031911 Bacteria 5601
215 Ga0307412_10115561 3300031911 Bacteria 1923
216 Ga0307409_100150870 3300031995 Bacteria 2017
217 Ga0307416_100071822 3300032002 Bacteria 2877
218 Ga0307416_100072665 3300032002 Bacteria 2864
219 Ga0307414_10437220 3300032004 Bacteria 1144
220 Ga0237819_01506 3300038705 Bacteria 5943
221 Ga0237816_00159 3300039145 Bacteria 5338
222 Ga0439466_0071647 3300041411 Bacteria 1103
223 Ga0451853_2875177 3300041512 Bacteria 1524
224 Ga0439431_0008317 3300041997 Bacteria 2330
225 Ga0439445_0004245 3300042004 Bacteria 3243
226 Ga0439446_0001612 3300042156 Bacteria 5198
227 Ga0439434_0121791 3300042435 Bacteria 851
228 Ga0495627_000108 3300046453 Bacteria 102455
229 Ga0495627_000159 3300046453 Bacteria 76595
230 Ga0495650_0001292 3300046471 Bacteria 25491
231 Ga0495650_0003429 3300046471 Bacteria 11568
232 Ga0495650_0024511 3300046471 Bacteria 2847
233 Ga0495596_0000113 3300046500 Bacteria 55405
234 Ga0495607_0027755 3300046501 Bacteria 3497
235 Ga0495583_0000443 3300046506 Bacteria 62113
236 Ga0495583_0074243 3300046506 Bacteria 1489
237 Ga0495583_0129069 3300046506 Bacteria 1059
238 Ga0495606_0016763 3300046507 Bacteria 5570
239 Ga0495610_0000044 3300046512 Bacteria 156847
240 Ga0495610_0000615 3300046512 Bacteria 35218
241 Ga0495610_0000883 3300046512 Bacteria 27894
242 Ga0495610_0035457 3300046512 Bacteria 2561
243 Ga0495616_0000576 3300046513 Bacteria 27654
244 Ga0495620_0019690 3300046515 Bacteria 3313
245 Ga0495632_0000220 3300046519 Bacteria 58010
246 Ga0495632_0000272 3300046519 Bacteria 51232
247 Ga0495643_0000448 3300046522 Bacteria 53058
248 Ga0495643_0008015 3300046522 Bacteria 6734
249 Ga0495643_0012812 3300046522 Bacteria 5046
250 Ga0495643_0080777 3300046522 Bacteria 1692
251 Ga0495648_0000020 3300046524 Bacteria 254330
252 Ga0495663_0075123 3300046525 Bacteria 1081
253 Ga0495609_0009931 3300046538 Bacteria 4586
254 Ga0495622_0060623 3300046557 Bacteria 1752
255 Ga0495633_0223448 3300046558 Bacteria 862
256 Ga0495668_0000053 3300046616 Bacteria 209976
257 Ga0495668_0031953 3300046616 Bacteria 2964
258 Ga0495625_0000526 3300046660 Bacteria 56429
259 Ga0495625_0023497 3300046660 Bacteria 4709
260 Ga0495671_0000022 3300046692 Bacteria 255591
261 Ga0495671_0030913 3300046692 Bacteria 2740
262 Ga0495671_0228813 3300046692 Bacteria 899
263 Ga0495672_0147314 3300047320 Bacteria 1224
264 Ga0495673_0000051 3300047469 Bacteria 255511
265 Ga0495681_0000014 3300047470 Bacteria 184395
266 Ga0495681_0000103 3300047470 Bacteria 75088
267 Ga0495681_0045504 3300047470 Bacteria 2100
268 Ga0495681_0062324 3300047470 Bacteria 1715
269 Ga0495681_0121872 3300047470 Bacteria 1118
270 Ga0495615_0000168 3300048090 Bacteria 16242
271 Ga0496100_0125137 3300048903 Bacteria 1803
272 Ga0496101_0053251 3300048904 Bacteria 2919
273 Ga0496101_0149021 3300048904 Bacteria 1788
274 Ga0496103_0085714 3300048906 Bacteria 1985
275 Ga0496104_0225432 3300048907 Bacteria 1786
276 Ga0496105_0008568 3300048908 Bacteria 7943
277 Ga0496105_0071388 3300048908 Bacteria 2870
278 Ga0496106_0000482 3300048909 Bacteria 28307
279 Ga0496107_0005568 3300048910 Bacteria 8625
280 Ga0496108_0131488 3300048911 Bacteria 2151
281 Ga0496110_0377690 3300048913 Bacteria 1291
282 Ga0496112_0284960 3300048915 Bacteria 1598
283 Ga0496113_0001602 3300048916 Bacteria 12730
284 Ga0496116_0028677 3300048919 Bacteria 4028
285 Ga0496117_0008867 3300048920 Bacteria 9490
286 Ga0496117_0021189 3300048920 Bacteria 5269
287 Ga0496117_0046858 3300048920 Bacteria 3106
288 Ga0496118_0000597 3300048921 Bacteria 59798
289 Ga0496118_0018043 3300048921 Bacteria 6389
290 Ga0496118_0021490 3300048921 Bacteria 5677
291 Ga0496119_0235681 3300048922 Bacteria 929
292 Ga0496120_0109407 3300048923 Bacteria 1446
293 Ga0496121_0000017 3300048924 Bacteria 546415
294 Ga0496121_0000192 3300048924 Bacteria 136529
295 Ga0496121_0000276 3300048924 Bacteria 107058
296 Ga0496121_0058002 3300048924 Bacteria 3205
297 Ga0496122_0004562 3300048925 Bacteria 17076
298 Ga0496122_0006059 3300048925 Bacteria 14089
299 Ga0496123_0001492 3300048926 Bacteria 32495
300 Ga0496123_0002042 3300048926 Bacteria 26076
301 Ga0496124_0021907 3300048927 Bacteria 5878
302 Ga0496125_0012883 3300048928 Bacteria 8260
303 Ga0496125_0053587 3300048928 Bacteria 3305
304 Ga0496125_0071605 3300048928 Bacteria 2707
305 Ga0496125_0164005 3300048928 Bacteria 1504
306 Ga0496126_0005527 3300048929 Bacteria 14387
307 Ga0500643_000065 3300053087 Bacteria 119995
308 Ga0500643_000539 3300053087 Bacteria 26512
309 Ga0500643_000659 3300053087 Bacteria 23124
310 Ga0500643_010262 3300053087 Bacteria 3501
311 Ga0500643_014748 3300053087 Bacteria 2703
312 Ga0500643_035388 3300053087 Bacteria 1498
313 Ga0500651_0115561 3300053093 Bacteria 1634
314 Ga0500566_0012190 3300053094 Bacteria 5063
315 Ga0500566_0062444 3300053094 Bacteria 2106
316 Ga0500572_120578 3300053111 Bacteria 849
317 Ga0500592_002591 3300053116 Bacteria 2903
318 Ga0500607_000023 3300053121 Bacteria 97892
319 Ga0500658_0001689 3300053134 Bacteria 8748
320 Ga0500559_0000291 3300053136 Bacteria 38726
321 Ga0500559_0001497 3300053136 Bacteria 13143
322 Ga0500559_0007595 3300053136 Bacteria 4789
323 Ga0500559_0009179 3300053136 Bacteria 4294
324 Ga0500568_0001843 3300053139 Bacteria 13069
325 Ga0500590_087208 3300053148 Bacteria 1521
326 Ga0500590_155044 3300053148 Bacteria 1028
327 Ga0500604_0002386 3300053151 Bacteria 5135
328 Ga0500624_000190 3300053157 Bacteria 24336
329 Ga0500627_0000027 3300053158 Bacteria 99420
330 Ga0500627_0235669 3300053158 Bacteria 813
331 Ga0500636_0015478 3300053177 Bacteria 4495
332 Ga0500637_0019683 3300053178 Bacteria 3643
333 Ga0500645_001040 3300053730 Bacteria 15492
334 Ga0500661_004695 3300055283 Bacteria 2552
335 2511128770 2510917021 Bacteria 5705459
336 2599500450 2599185188 Bacteria 6164180
337 2599935044 2599185300 Bacteria 6062622
338 2643833808 2643221563 Bacteria 4726935
339 2643950628 2643221588 Bacteria 3692460
340 2644054734 2643221608 Bacteria 4724829
341 2644126950 2643221622 Bacteria 4212502
342 2778124475 2775507255 Bacteria 3945731
343 2842927359 2842922631 Bacteria 5824079
344 2919139302 2919138771 Bacteria 5281312
345 2919710862 2919709256 Bacteria 4318106
346 2990266507 2990265787 Bacteria 3943888
347 2993695695 2993693658 Bacteria 4040749
348 8024485338 8024479707 Bacteria 6954785
349 Ga0055531_10004365
350 SwRhRL2b_contig_507762
351 SwRhRL2b_contig_890187
352 JGI24736J21556_1000067
353 JGI24741J21665_1000129
354 JGI24752J21851_1000337
355 JGI24740J21852_10007691
356 JGI24740J21852_10017388
357 JGI24739J22299_10006013
358 JGI24739J22299_10015445
359 JGI24737J22298_10002364
360 JGI24735J21928_10006441
361 Ga0055537_1001711
362 Ga0055524_1000180
363 Ga0055536_1002932
364 Ga0055536_1009616
365 Ga0055534_1009291
366 Ga0055528_1030133
367 Ga0055530_10014207
368 Ga0055531_10017041
369 Ga0055543_1006282
370 Ga0065165_1002147
371 Ga0065165_1007278
372 Ga0065704_10073669
373 Ga0065707_10161421
374 Ga0070690_100048531
375 Ga0070670_100000209
376 Ga0070670_100122440
377 Ga0070666_10001918
378 Ga0070666_10296250
379 Ga0070682_100269761
380 Ga0070660_100018236
381 Ga0070661_100014350
382 Ga0070668_100000868
383 Ga0070668_100005470
384 Ga0070669_100000023
385 Ga0070669_100001101
386 Ga0070669_100006207
387 Ga0070671_100000086
388 Ga0070659_100006657
389 Ga0070659_100009490
390 Ga0070667_100000127
391 Ga0070667_100000548
392 Ga0070667_100002263
393 Ga0070667_100002900
394 Ga0070667_100084509
395 Ga0070663_100000846
396 Ga0070663_100090851
397 Ga0070662_100002223
398 Ga0070662_100304599
399 Ga0070685_10201046
400 Ga0070684_100143844
401 Ga0068853_100006005
402 Ga0068853_100028839
403 Ga0068853_100105059
404 Ga0070686_100004612
405 Ga0070665_100004358
406 Ga0070665_100497065
407 Ga0068855_100213855
408 Ga0070664_100293255
409 Ga0068857_100025246
410 Ga0068857_100123324
411 Ga0068857_100246626
412 Ga0068857_100594665
413 Ga0068856_100003983
414 Ga0068856_100046968
415 Ga0068852_100025737
416 Ga0068859_100023279
417 Ga0068859_100099775
418 Ga0068864_100000062
419 Ga0068864_100003877
420 Ga0068851_10016716
421 Ga0068851_10277110
422 Ga0068863_100000064
423 Ga0068863_100000103
424 Ga0068863_100000225
425 Ga0068858_100099067
426 Ga0068858_100128849
427 Ga0068860_100000093
428 Ga0068860_100051175
429 Ga0068860_100163781
430 Ga0068860_100269478
431 Ga0068862_100000063
432 Ga0068862_100000079
433 Ga0068862_100000425
434 Ga0068862_100002732
435 Ga0097620_100023280
436 Ga0097620_100099773
437 Ga0105251_10003959
438 Ga0105240_10013008
439 Ga0105247_10012293
440 Ga0105241_10002171
441 Ga0105241_10014391
442 Ga0105241_10146656
443 Ga0105248_10000014
444 Ga0105248_10038576
445 Ga0105248_10168380
446 Ga0105237_10021045
447 Ga0105237_10225479
448 Ga0105238_10612378
449 Ga0105249_10000103
450 Ga0105249_10000907
451 Ga0105249_10006886
452 Ga0105249_10217435
453 Ga0105239_10126170
454 Ga0157373_10192199
455 Ga0157371_10145673
456 Ga0163162_10044267
457 Ga0157372_10497134
458 Ga0157379_10016305
459 Ga0207425_1006174
460 Ga0209565_1000012
461 Ga0209673_1003940
462 Ga0209675_1000235
463 Ga0209675_1018775
464 Ga0209676_1000045
465 Ga0209676_1000641
466 Ga0209025_1008395
467 Ga0209564_1046018
468 Ga0209758_1005936
469 Ga0209050_1003217
470 Ga0209050_1006065
471 Ga0209050_1014150
472 Ga0209256_1000012
473 Ga0209257_1002214
474 Ga0209257_1002738
475 Ga0207697_10001233
476 Ga0207656_10096099
477 Ga0207713_1006508
478 Ga0207680_10000062
479 Ga0207680_10005345
480 Ga0207680_10027383
481 Ga0207705_10278375
482 Ga0207654_10000931
483 Ga0207654_10008026
484 Ga0207695_10026121
485 Ga0207695_10035516
486 Ga0207671_10028923
487 Ga0207657_10012417
488 Ga0207657_10036691
489 Ga0207649_10014871
490 Ga0207681_10000004
491 Ga0207681_10001495
492 Ga0207681_10170211
493 Ga0207694_10018672
494 Ga0207694_10129335
495 Ga0207650_10000367
496 Ga0207650_10261943
497 Ga0207644_10000011
498 Ga0207690_10068710
499 Ga0207690_10807906
500 Ga0207706_10027117
501 Ga0207711_10000021
502 Ga0207711_10667523
503 Ga0207679_10499478
504 Ga0207667_10018821
505 Ga0207667_10094343
506 Ga0207712_10000069
507 Ga0207712_10000687
508 Ga0207712_10001707
509 Ga0207712_10185307
510 Ga0207668_10000370
511 Ga0207668_10000384
512 Ga0207668_10072325
513 Ga0207668_10257234
514 Ga0207640_10034529
515 Ga0207640_10145175
516 Ga0207640_10220813
517 Ga0207658_10000424
518 Ga0207658_10000472
519 Ga0207658_10004711
520 Ga0207658_10212991
521 Ga0207703_10121225
522 Ga0207703_10173090
523 Ga0207639_10000169
524 Ga0207639_10003655
525 Ga0207639_10011333
526 Ga0207678_10001016
527 Ga0207678_10002260
528 Ga0207702_10002789
529 Ga0207702_10011415
530 Ga0207641_10000107
531 Ga0207641_10000113
532 Ga0207641_10000367
533 Ga0207641_10003191
534 Ga0207641_10292791
535 Ga0207676_10000057
536 Ga0207676_10002371
537 Ga0207674_10068249
538 Ga0207674_10081793
539 Ga0207674_10140171
540 Ga0207698_10001722
541 Ga0207698_10120937
542 Ga0268266_10018088
543 Ga0268266_10239732
544 Ga0268265_10000046
545 Ga0268265_10000055
546 Ga0268265_10000080
547 Ga0268265_10018635
548 Ga0268264_10000067
549 Ga0268264_10018866
550 Ga0268264_10155011
551 Ga0307408_100007397
552 Ga0307408_100041091
553 Ga0307408_100147115
554 Ga0307408_100342690
555 Ga0307405_10006629
556 Ga0307405_10027704
557 Ga0307405_10520387
558 Ga0307410_10093950
559 Ga0307410_10345365
560 Ga0307406_10068617
561 Ga0307412_10006353
562 Ga0307412_10009431
563 Ga0307412_10115561
564 Ga0307409_100150870
565 Ga0307416_100071822
566 Ga0307416_100072665
567 Ga0307414_10437220
568 Ga0237819_01506
569 Ga0237816_00159
570 Ga0439466_0071647
571 Ga0451853_2875177
572 Ga0439431_0008317
573 Ga0439445_0004245
574 Ga0439446_0001612
575 Ga0439434_0121791
576 Ga0495627_000108
577 Ga0495627_000159
578 Ga0495650_0001292
579 Ga0495650_0003429
580 Ga0495650_0024511
581 Ga0495596_0000113
582 Ga0495607_0027755
583 Ga0495583_0000443
584 Ga0495583_0074243
585 Ga0495583_0129069
586 Ga0495606_0016763
587 Ga0495610_0000044
588 Ga0495610_0000615
589 Ga0495610_0000883
590 Ga0495610_0035457
591 Ga0495616_0000576
592 Ga0495620_0019690
593 Ga0495632_0000220
594 Ga0495632_0000272
595 Ga0495643_0000448
596 Ga0495643_0008015
597 Ga0495643_0012812
598 Ga0495643_0080777
599 Ga0495648_0000020
600 Ga0495663_0075123
601 Ga0495609_0009931
602 Ga0495622_0060623
603 Ga0495633_0223448
604 Ga0495668_0000053
605 Ga0495668_0031953
606 Ga0495625_0000526
607 Ga0495625_0023497
608 Ga0495671_0000022
609 Ga0495671_0030913
610 Ga0495671_0228813
611 Ga0495672_0147314
612 Ga0495673_0000051
613 Ga0495681_0000014
614 Ga0495681_0000103
615 Ga0495681_0045504
616 Ga0495681_0062324
617 Ga0495681_0121872
618 Ga0495615_0000168
619 Ga0496100_0125137
620 Ga0496101_0053251
621 Ga0496101_0149021
622 Ga0496103_0085714
623 Ga0496104_0225432
624 Ga0496105_0008568
625 Ga0496105_0071388
626 Ga0496106_0000482
627 Ga0496107_0005568
628 Ga0496108_0131488
629 Ga0496110_0377690
630 Ga0496112_0284960
631 Ga0496113_0001602
632 Ga0496116_0028677
633 Ga0496117_0008867
634 Ga0496117_0021189
635 Ga0496117_0046858
636 Ga0496118_0000597
637 Ga0496118_0018043
638 Ga0496118_0021490
639 Ga0496119_0235681
640 Ga0496120_0109407
641 Ga0496121_0000017
642 Ga0496121_0000192
643 Ga0496121_0000276
644 Ga0496121_0058002
645 Ga0496122_0004562
646 Ga0496122_0006059
647 Ga0496123_0001492
648 Ga0496123_0002042
649 Ga0496124_0021907
650 Ga0496125_0012883
651 Ga0496125_0053587
652 Ga0496125_0071605
653 Ga0496125_0164005
654 Ga0496126_0005527
655 Ga0500643_000065
656 Ga0500643_000539
657 Ga0500643_000659
658 Ga0500643_010262
659 Ga0500643_014748
660 Ga0500643_035388
661 Ga0500651_0115561
662 Ga0500566_0012190
663 Ga0500566_0062444
664 Ga0500572_120578
665 Ga0500592_002591
666 Ga0500607_000023
667 Ga0500658_0001689
668 Ga0500559_0000291
669 Ga0500559_0001497
670 Ga0500559_0007595
671 Ga0500559_0009179
672 Ga0500568_0001843
673 Ga0500590_087208
674 Ga0500590_155044
675 Ga0500604_0002386
676 Ga0500624_000190
677 Ga0500627_0000027
678 Ga0500627_0235669
679 Ga0500636_0015478
680 Ga0500637_0019683
681 Ga0500645_001040
682 Ga0500661_004695
683 2511128770
684 2599500450
685 2599935044
686 2643833808
687 2643950628
688 2644054734
689 2644126950
690 2778124475
691 2842927359
692 2919139302
693 2919710862
694 2990266507
695 2993695695
696 8024485338

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

43

215

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d54-assembly1.cif.gz_B crstal structure msgatase with gln 0.8643 4 231
3l7n-assembly1.cif.gz_A crystal structure of smu.1228c 0.8519 5 229
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8477 1 231
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8409 1 231
3l7n-assembly1.cif.gz_A crystal structure of smu.1228c 0.8181 5 229
ID Description Score Start End Superfamily
3l7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8519 5 229 3.40.50.880
af_Q59T45_76_269_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8498 53 192 3.40.50.880
3l83A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8368 6 232 3.40.50.880
1o1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.833 1 229 3.40.50.880
1o1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8228 1 229 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V8HK46-F1-model_v4 deleted 0.9969 4 100
AF-A0A1L6J8Q6-F1-model_v4 Glutamine amidotransferase 0.9926 4 232 GO:0005829
GO:0006541
GO:0016740
AF-A0A4Q2ZVB6-F1-model_v4 Glutamine amidotransferase 0.9922 4 231 GO:0005829
GO:0006541
GO:0016740
AF-A0A2N3D6T2-F1-model_v4 Glutamine amidotransferase 0.9918 4 232 GO:0005829
GO:0006541
GO:0016740
AF-A0A0J7Y3S8-F1-model_v4 Glutamine amidotransferase 0.9899 4 232 GO:0005829
GO:0006541
GO:0016740

Map