F417369
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 348 | 201 | 696 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10004365|Ga0055531_100043655 |
| Length | 255 |
| Sequence | LARLRLFETAQQPLDSSPVMPQHKQTRTGLIIRHVPHEGLAGYREPIEAAGYELARLDVADPNFGAADLGEPDLLIMMGGPMGVYEQDAHPWIACQMKRLARRIDAGRPTLGVCFGAQMMAAAMGARVYPGPAKEVGFHPLSFVDPVSPLRHLADVSVLHWHGDTFDLPDDVELLASTPAYPHQAFRRGNNILALQFHGEMGLDPRFDEWLRQWPDALDETGGSVEGMRDLHSRHGPPAVAAGRAMIAEWLAGLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 113 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 118 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 119 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 120 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 121 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 122 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 123 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 124 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 125 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 126 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 152 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 153 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 154 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 155 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 156 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 167 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 171 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 172 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 173 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 175 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 176 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 177 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 178 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 179 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 180 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 181 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 182 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 183 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 185 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 186 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 187 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 188 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 189 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 190 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 191 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 192 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 193 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 194 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 195 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 196 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 197 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 198 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 199 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 200 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 201 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.98 |
| Metatranscriptomes | 0 |
| Isolates | 4.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 16.09 |
| Nodule | 0.29 |
| Rhizoplane | 4.31 |
| Rhizosphere | 69.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055531_10004365 | 3300003794 | Bacteria | 8648 |
| 2 | SwRhRL2b_contig_507762 | 2162886007 | Bacteria | 2613 |
| 3 | SwRhRL2b_contig_890187 | 2162886007 | Bacteria | 4644 |
| 4 | JGI24736J21556_1000067 | 3300001904 | Bacteria | 17042 |
| 5 | JGI24741J21665_1000129 | 3300001915 | Bacteria | 20677 |
| 6 | JGI24752J21851_1000337 | 3300001976 | Bacteria | 6524 |
| 7 | JGI24740J21852_10007691 | 3300001979 | Bacteria | 4361 |
| 8 | JGI24740J21852_10017388 | 3300001979 | Bacteria | 2574 |
| 9 | JGI24739J22299_10006013 | 3300001989 | Bacteria | 4594 |
| 10 | JGI24739J22299_10015445 | 3300001989 | Bacteria | 2774 |
| 11 | JGI24737J22298_10002364 | 3300001990 | Bacteria | 6724 |
| 12 | JGI24735J21928_10006441 | 3300002067 | Bacteria | 3864 |
| 13 | Ga0055537_1001711 | 3300003773 | Bacteria | 8110 |
| 14 | Ga0055524_1000180 | 3300003775 | Bacteria | 71495 |
| 15 | Ga0055536_1002932 | 3300003781 | Bacteria | 9370 |
| 16 | Ga0055536_1009616 | 3300003781 | Bacteria | 3965 |
| 17 | Ga0055534_1009291 | 3300003784 | Bacteria | 2148 |
| 18 | Ga0055528_1030133 | 3300003790 | Bacteria | 1448 |
| 19 | Ga0055530_10014207 | 3300003791 | Bacteria | 2665 |
| 20 | Ga0055531_10017041 | 3300003794 | Bacteria | 3092 |
| 21 | Ga0055543_1006282 | 3300004625 | Bacteria | 2899 |
| 22 | Ga0065165_1002147 | 3300005262 | Bacteria | 17875 |
| 23 | Ga0065165_1007278 | 3300005262 | Bacteria | 5496 |
| 24 | Ga0065704_10073669 | 3300005289 | Bacteria | 6905 |
| 25 | Ga0065707_10161421 | 3300005295 | Bacteria | 1560 |
| 26 | Ga0070690_100048531 | 3300005330 | Bacteria | 2704 |
| 27 | Ga0070670_100000209 | 3300005331 | Bacteria | 54253 |
| 28 | Ga0070670_100122440 | 3300005331 | Bacteria | 2244 |
| 29 | Ga0070666_10001918 | 3300005335 | Bacteria | 12652 |
| 30 | Ga0070666_10296250 | 3300005335 | Bacteria | 1151 |
| 31 | Ga0070682_100269761 | 3300005337 | Bacteria | 1236 |
| 32 | Ga0070660_100018236 | 3300005339 | Bacteria | 5125 |
| 33 | Ga0070661_100014350 | 3300005344 | Bacteria | 5580 |
| 34 | Ga0070668_100000868 | 3300005347 | Bacteria | 21031 |
| 35 | Ga0070668_100005470 | 3300005347 | Bacteria | 9430 |
| 36 | Ga0070669_100000023 | 3300005353 | Bacteria | 174496 |
| 37 | Ga0070669_100001101 | 3300005353 | Bacteria | 19761 |
| 38 | Ga0070669_100006207 | 3300005353 | Bacteria | 8626 |
| 39 | Ga0070671_100000086 | 3300005355 | Bacteria | 59637 |
| 40 | Ga0070659_100006657 | 3300005366 | Bacteria | 8351 |
| 41 | Ga0070659_100009490 | 3300005366 | Bacteria | 7151 |
| 42 | Ga0070667_100000127 | 3300005367 | Bacteria | 95853 |
| 43 | Ga0070667_100000548 | 3300005367 | Bacteria | 37357 |
| 44 | Ga0070667_100002263 | 3300005367 | Bacteria | 16955 |
| 45 | Ga0070667_100002900 | 3300005367 | Bacteria | 14733 |
| 46 | Ga0070667_100084509 | 3300005367 | Bacteria | 2720 |
| 47 | Ga0070663_100000846 | 3300005455 | Bacteria | 16556 |
| 48 | Ga0070663_100090851 | 3300005455 | Bacteria | 2262 |
| 49 | Ga0070662_100002223 | 3300005457 | Bacteria | 11916 |
| 50 | Ga0070662_100304599 | 3300005457 | Bacteria | 1295 |
| 51 | Ga0070685_10201046 | 3300005466 | Bacteria | 1295 |
| 52 | Ga0070684_100143844 | 3300005535 | Bacteria | 2158 |
| 53 | Ga0068853_100006005 | 3300005539 | Bacteria | 9605 |
| 54 | Ga0068853_100028839 | 3300005539 | Bacteria | 4671 |
| 55 | Ga0068853_100105059 | 3300005539 | Bacteria | 2501 |
| 56 | Ga0070686_100004612 | 3300005544 | Bacteria | 7597 |
| 57 | Ga0070665_100004358 | 3300005548 | Bacteria | 14889 |
| 58 | Ga0070665_100497065 | 3300005548 | Bacteria | 1231 |
| 59 | Ga0068855_100213855 | 3300005563 | Bacteria | 2165 |
| 60 | Ga0070664_100293255 | 3300005564 | Bacteria | 1468 |
| 61 | Ga0068857_100025246 | 3300005577 | Bacteria | 5233 |
| 62 | Ga0068857_100123324 | 3300005577 | Bacteria | 2334 |
| 63 | Ga0068857_100246626 | 3300005577 | Bacteria | 1636 |
| 64 | Ga0068857_100594665 | 3300005577 | Bacteria | 1045 |
| 65 | Ga0068856_100003983 | 3300005614 | Bacteria | 14795 |
| 66 | Ga0068856_100046968 | 3300005614 | Bacteria | 4253 |
| 67 | Ga0068852_100025737 | 3300005616 | Bacteria | 4772 |
| 68 | Ga0068859_100023279 | 3300005617 | Bacteria | 6216 |
| 69 | Ga0068859_100099775 | 3300005617 | Bacteria | 2959 |
| 70 | Ga0068864_100000062 | 3300005618 | Bacteria | 121206 |
| 71 | Ga0068864_100003877 | 3300005618 | Bacteria | 12314 |
| 72 | Ga0068851_10016716 | 3300005834 | Bacteria | 3515 |
| 73 | Ga0068851_10277110 | 3300005834 | Bacteria | 958 |
| 74 | Ga0068863_100000064 | 3300005841 | Bacteria | 118153 |
| 75 | Ga0068863_100000103 | 3300005841 | Bacteria | 91380 |
| 76 | Ga0068863_100000225 | 3300005841 | Bacteria | 59865 |
| 77 | Ga0068858_100099067 | 3300005842 | Bacteria | 2718 |
| 78 | Ga0068858_100128849 | 3300005842 | Bacteria | 2372 |
| 79 | Ga0068860_100000093 | 3300005843 | Bacteria | 150034 |
| 80 | Ga0068860_100051175 | 3300005843 | Bacteria | 3930 |
| 81 | Ga0068860_100163781 | 3300005843 | Bacteria | 2145 |
| 82 | Ga0068860_100269478 | 3300005843 | Bacteria | 1661 |
| 83 | Ga0068862_100000063 | 3300005844 | Bacteria | 124662 |
| 84 | Ga0068862_100000079 | 3300005844 | Bacteria | 113551 |
| 85 | Ga0068862_100000425 | 3300005844 | Bacteria | 45885 |
| 86 | Ga0068862_100002732 | 3300005844 | Bacteria | 15487 |
| 87 | Ga0097620_100023280 | 3300006931 | Bacteria | 6216 |
| 88 | Ga0097620_100099773 | 3300006931 | Bacteria | 2959 |
| 89 | Ga0105251_10003959 | 3300009011 | Bacteria | 10495 |
| 90 | Ga0105240_10013008 | 3300009093 | Bacteria | 11459 |
| 91 | Ga0105247_10012293 | 3300009101 | Bacteria | 5143 |
| 92 | Ga0105241_10002171 | 3300009174 | Bacteria | 14777 |
| 93 | Ga0105241_10014391 | 3300009174 | Bacteria | 5792 |
| 94 | Ga0105241_10146656 | 3300009174 | Bacteria | 1926 |
| 95 | Ga0105248_10000014 | 3300009177 | Bacteria | 324729 |
| 96 | Ga0105248_10038576 | 3300009177 | Bacteria | 5347 |
| 97 | Ga0105248_10168380 | 3300009177 | Bacteria | 2469 |
| 98 | Ga0105237_10021045 | 3300009545 | Bacteria | 6712 |
| 99 | Ga0105237_10225479 | 3300009545 | Bacteria | 1874 |
| 100 | Ga0105238_10612378 | 3300009551 | Bacteria | 1097 |
| 101 | Ga0105249_10000103 | 3300009553 | Bacteria | 118397 |
| 102 | Ga0105249_10000907 | 3300009553 | Bacteria | 26174 |
| 103 | Ga0105249_10006886 | 3300009553 | Bacteria | 9908 |
| 104 | Ga0105249_10217435 | 3300009553 | Bacteria | 1878 |
| 105 | Ga0105239_10126170 | 3300010375 | Bacteria | 2844 |
| 106 | Ga0157373_10192199 | 3300013100 | Bacteria | 1438 |
| 107 | Ga0157371_10145673 | 3300013102 | Bacteria | 1688 |
| 108 | Ga0163162_10044267 | 3300013306 | Bacteria | 4458 |
| 109 | Ga0157372_10497134 | 3300013307 | Bacteria | 1422 |
| 110 | Ga0157379_10016305 | 3300014968 | Bacteria | 6536 |
| 111 | Ga0207425_1006174 | 3300025245 | Bacteria | 3308 |
| 112 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 113 | Ga0209673_1003940 | 3300025273 | Bacteria | 8297 |
| 114 | Ga0209675_1000235 | 3300025291 | Bacteria | 55378 |
| 115 | Ga0209675_1018775 | 3300025291 | Bacteria | 1925 |
| 116 | Ga0209676_1000045 | 3300025292 | Bacteria | 412331 |
| 117 | Ga0209676_1000641 | 3300025292 | Bacteria | 50312 |
| 118 | Ga0209025_1008395 | 3300025294 | Bacteria | 7444 |
| 119 | Ga0209564_1046018 | 3300025295 | Bacteria | 1116 |
| 120 | Ga0209758_1005936 | 3300025297 | Bacteria | 9064 |
| 121 | Ga0209050_1003217 | 3300025298 | Bacteria | 12356 |
| 122 | Ga0209050_1006065 | 3300025298 | Bacteria | 7313 |
| 123 | Ga0209050_1014150 | 3300025298 | Bacteria | 3465 |
| 124 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 125 | Ga0209257_1002214 | 3300025304 | Bacteria | 20037 |
| 126 | Ga0209257_1002738 | 3300025304 | Bacteria | 16712 |
| 127 | Ga0207697_10001233 | 3300025315 | Bacteria | 14016 |
| 128 | Ga0207656_10096099 | 3300025321 | Bacteria | 1352 |
| 129 | Ga0207713_1006508 | 3300025735 | Bacteria | 7103 |
| 130 | Ga0207680_10000062 | 3300025903 | Bacteria | 48850 |
| 131 | Ga0207680_10005345 | 3300025903 | Bacteria | 6131 |
| 132 | Ga0207680_10027383 | 3300025903 | Bacteria | 3173 |
| 133 | Ga0207705_10278375 | 3300025909 | Bacteria | 1280 |
| 134 | Ga0207654_10000931 | 3300025911 | Bacteria | 16142 |
| 135 | Ga0207654_10008026 | 3300025911 | Bacteria | 5322 |
| 136 | Ga0207695_10026121 | 3300025913 | Bacteria | 6522 |
| 137 | Ga0207695_10035516 | 3300025913 | Bacteria | 5405 |
| 138 | Ga0207671_10028923 | 3300025914 | Bacteria | 4140 |
| 139 | Ga0207657_10012417 | 3300025919 | Bacteria | 8416 |
| 140 | Ga0207657_10036691 | 3300025919 | Bacteria | 4384 |
| 141 | Ga0207649_10014871 | 3300025920 | Bacteria | 4365 |
| 142 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 143 | Ga0207681_10001495 | 3300025923 | Bacteria | 15086 |
| 144 | Ga0207681_10170211 | 3300025923 | Bacteria | 1650 |
| 145 | Ga0207694_10018672 | 3300025924 | Bacteria | 5243 |
| 146 | Ga0207694_10129335 | 3300025924 | Bacteria | 2023 |
| 147 | Ga0207650_10000367 | 3300025925 | Bacteria | 42933 |
| 148 | Ga0207650_10261943 | 3300025925 | Bacteria | 1403 |
| 149 | Ga0207644_10000011 | 3300025931 | Bacteria | 223950 |
| 150 | Ga0207690_10068710 | 3300025932 | Unclassified | 2435 |
| 151 | Ga0207690_10807906 | 3300025932 | Bacteria | 775 |
| 152 | Ga0207706_10027117 | 3300025933 | Bacteria | 5124 |
| 153 | Ga0207711_10000021 | 3300025941 | Bacteria | 355952 |
| 154 | Ga0207711_10667523 | 3300025941 | Bacteria | 970 |
| 155 | Ga0207679_10499478 | 3300025945 | Bacteria | 1085 |
| 156 | Ga0207667_10018821 | 3300025949 | Bacteria | 7733 |
| 157 | Ga0207667_10094343 | 3300025949 | Bacteria | 3089 |
| 158 | Ga0207712_10000069 | 3300025961 | Bacteria | 127318 |
| 159 | Ga0207712_10000687 | 3300025961 | Bacteria | 26162 |
| 160 | Ga0207712_10001707 | 3300025961 | Bacteria | 14745 |
| 161 | Ga0207712_10185307 | 3300025961 | Bacteria | 1638 |
| 162 | Ga0207668_10000370 | 3300025972 | Bacteria | 28629 |
| 163 | Ga0207668_10000384 | 3300025972 | Bacteria | 28142 |
| 164 | Ga0207668_10072325 | 3300025972 | Bacteria | 2467 |
| 165 | Ga0207668_10257234 | 3300025972 | Bacteria | 1421 |
| 166 | Ga0207640_10034529 | 3300025981 | Bacteria | 3157 |
| 167 | Ga0207640_10145175 | 3300025981 | Bacteria | 1735 |
| 168 | Ga0207640_10220813 | 3300025981 | Bacteria | 1451 |
| 169 | Ga0207658_10000424 | 3300025986 | Bacteria | 40038 |
| 170 | Ga0207658_10000472 | 3300025986 | Bacteria | 37417 |
| 171 | Ga0207658_10004711 | 3300025986 | Bacteria | 9447 |
| 172 | Ga0207658_10212991 | 3300025986 | Bacteria | 1620 |
| 173 | Ga0207703_10121225 | 3300026035 | Bacteria | 2245 |
| 174 | Ga0207703_10173090 | 3300026035 | Bacteria | 1900 |
| 175 | Ga0207639_10000169 | 3300026041 | Bacteria | 50659 |
| 176 | Ga0207639_10003655 | 3300026041 | Bacteria | 10337 |
| 177 | Ga0207639_10011333 | 3300026041 | Bacteria | 6189 |
| 178 | Ga0207678_10001016 | 3300026067 | Bacteria | 25610 |
| 179 | Ga0207678_10002260 | 3300026067 | Bacteria | 17440 |
| 180 | Ga0207702_10002789 | 3300026078 | Bacteria | 16378 |
| 181 | Ga0207702_10011415 | 3300026078 | Bacteria | 7405 |
| 182 | Ga0207641_10000107 | 3300026088 | Bacteria | 121220 |
| 183 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 184 | Ga0207641_10000367 | 3300026088 | Bacteria | 53540 |
| 185 | Ga0207641_10003191 | 3300026088 | Bacteria | 14682 |
| 186 | Ga0207641_10292791 | 3300026088 | Bacteria | 1535 |
| 187 | Ga0207676_10000057 | 3300026095 | Bacteria | 121220 |
| 188 | Ga0207676_10002371 | 3300026095 | Bacteria | 13449 |
| 189 | Ga0207674_10068249 | 3300026116 | Bacteria | 3578 |
| 190 | Ga0207674_10081793 | 3300026116 | Bacteria | 3231 |
| 191 | Ga0207674_10140171 | 3300026116 | Bacteria | 2377 |
| 192 | Ga0207698_10001722 | 3300026142 | Bacteria | 12747 |
| 193 | Ga0207698_10120937 | 3300026142 | Bacteria | 2216 |
| 194 | Ga0268266_10018088 | 3300028379 | Bacteria | 6007 |
| 195 | Ga0268266_10239732 | 3300028379 | Bacteria | 1673 |
| 196 | Ga0268265_10000046 | 3300028380 | Bacteria | 179361 |
| 197 | Ga0268265_10000055 | 3300028380 | Bacteria | 158947 |
| 198 | Ga0268265_10000080 | 3300028380 | Bacteria | 121220 |
| 199 | Ga0268265_10018635 | 3300028380 | Bacteria | 4813 |
| 200 | Ga0268264_10000067 | 3300028381 | Bacteria | 284445 |
| 201 | Ga0268264_10018866 | 3300028381 | Bacteria | 5640 |
| 202 | Ga0268264_10155011 | 3300028381 | Bacteria | 2058 |
| 203 | Ga0307408_100007397 | 3300031548 | Bacteria | 7265 |
| 204 | Ga0307408_100041091 | 3300031548 | Bacteria | 3277 |
| 205 | Ga0307408_100147115 | 3300031548 | Bacteria | 1856 |
| 206 | Ga0307408_100342690 | 3300031548 | Bacteria | 1265 |
| 207 | Ga0307405_10006629 | 3300031731 | Bacteria | 5713 |
| 208 | Ga0307405_10027704 | 3300031731 | Bacteria | 3289 |
| 209 | Ga0307405_10520387 | 3300031731 | Bacteria | 957 |
| 210 | Ga0307410_10093950 | 3300031852 | Bacteria | 2135 |
| 211 | Ga0307410_10345365 | 3300031852 | Bacteria | 1187 |
| 212 | Ga0307406_10068617 | 3300031901 | Bacteria | 2315 |
| 213 | Ga0307412_10006353 | 3300031911 | Bacteria | 6677 |
| 214 | Ga0307412_10009431 | 3300031911 | Bacteria | 5601 |
| 215 | Ga0307412_10115561 | 3300031911 | Bacteria | 1923 |
| 216 | Ga0307409_100150870 | 3300031995 | Bacteria | 2017 |
| 217 | Ga0307416_100071822 | 3300032002 | Bacteria | 2877 |
| 218 | Ga0307416_100072665 | 3300032002 | Bacteria | 2864 |
| 219 | Ga0307414_10437220 | 3300032004 | Bacteria | 1144 |
| 220 | Ga0237819_01506 | 3300038705 | Bacteria | 5943 |
| 221 | Ga0237816_00159 | 3300039145 | Bacteria | 5338 |
| 222 | Ga0439466_0071647 | 3300041411 | Bacteria | 1103 |
| 223 | Ga0451853_2875177 | 3300041512 | Bacteria | 1524 |
| 224 | Ga0439431_0008317 | 3300041997 | Bacteria | 2330 |
| 225 | Ga0439445_0004245 | 3300042004 | Bacteria | 3243 |
| 226 | Ga0439446_0001612 | 3300042156 | Bacteria | 5198 |
| 227 | Ga0439434_0121791 | 3300042435 | Bacteria | 851 |
| 228 | Ga0495627_000108 | 3300046453 | Bacteria | 102455 |
| 229 | Ga0495627_000159 | 3300046453 | Bacteria | 76595 |
| 230 | Ga0495650_0001292 | 3300046471 | Bacteria | 25491 |
| 231 | Ga0495650_0003429 | 3300046471 | Bacteria | 11568 |
| 232 | Ga0495650_0024511 | 3300046471 | Bacteria | 2847 |
| 233 | Ga0495596_0000113 | 3300046500 | Bacteria | 55405 |
| 234 | Ga0495607_0027755 | 3300046501 | Bacteria | 3497 |
| 235 | Ga0495583_0000443 | 3300046506 | Bacteria | 62113 |
| 236 | Ga0495583_0074243 | 3300046506 | Bacteria | 1489 |
| 237 | Ga0495583_0129069 | 3300046506 | Bacteria | 1059 |
| 238 | Ga0495606_0016763 | 3300046507 | Bacteria | 5570 |
| 239 | Ga0495610_0000044 | 3300046512 | Bacteria | 156847 |
| 240 | Ga0495610_0000615 | 3300046512 | Bacteria | 35218 |
| 241 | Ga0495610_0000883 | 3300046512 | Bacteria | 27894 |
| 242 | Ga0495610_0035457 | 3300046512 | Bacteria | 2561 |
| 243 | Ga0495616_0000576 | 3300046513 | Bacteria | 27654 |
| 244 | Ga0495620_0019690 | 3300046515 | Bacteria | 3313 |
| 245 | Ga0495632_0000220 | 3300046519 | Bacteria | 58010 |
| 246 | Ga0495632_0000272 | 3300046519 | Bacteria | 51232 |
| 247 | Ga0495643_0000448 | 3300046522 | Bacteria | 53058 |
| 248 | Ga0495643_0008015 | 3300046522 | Bacteria | 6734 |
| 249 | Ga0495643_0012812 | 3300046522 | Bacteria | 5046 |
| 250 | Ga0495643_0080777 | 3300046522 | Bacteria | 1692 |
| 251 | Ga0495648_0000020 | 3300046524 | Bacteria | 254330 |
| 252 | Ga0495663_0075123 | 3300046525 | Bacteria | 1081 |
| 253 | Ga0495609_0009931 | 3300046538 | Bacteria | 4586 |
| 254 | Ga0495622_0060623 | 3300046557 | Bacteria | 1752 |
| 255 | Ga0495633_0223448 | 3300046558 | Bacteria | 862 |
| 256 | Ga0495668_0000053 | 3300046616 | Bacteria | 209976 |
| 257 | Ga0495668_0031953 | 3300046616 | Bacteria | 2964 |
| 258 | Ga0495625_0000526 | 3300046660 | Bacteria | 56429 |
| 259 | Ga0495625_0023497 | 3300046660 | Bacteria | 4709 |
| 260 | Ga0495671_0000022 | 3300046692 | Bacteria | 255591 |
| 261 | Ga0495671_0030913 | 3300046692 | Bacteria | 2740 |
| 262 | Ga0495671_0228813 | 3300046692 | Bacteria | 899 |
| 263 | Ga0495672_0147314 | 3300047320 | Bacteria | 1224 |
| 264 | Ga0495673_0000051 | 3300047469 | Bacteria | 255511 |
| 265 | Ga0495681_0000014 | 3300047470 | Bacteria | 184395 |
| 266 | Ga0495681_0000103 | 3300047470 | Bacteria | 75088 |
| 267 | Ga0495681_0045504 | 3300047470 | Bacteria | 2100 |
| 268 | Ga0495681_0062324 | 3300047470 | Bacteria | 1715 |
| 269 | Ga0495681_0121872 | 3300047470 | Bacteria | 1118 |
| 270 | Ga0495615_0000168 | 3300048090 | Bacteria | 16242 |
| 271 | Ga0496100_0125137 | 3300048903 | Bacteria | 1803 |
| 272 | Ga0496101_0053251 | 3300048904 | Bacteria | 2919 |
| 273 | Ga0496101_0149021 | 3300048904 | Bacteria | 1788 |
| 274 | Ga0496103_0085714 | 3300048906 | Bacteria | 1985 |
| 275 | Ga0496104_0225432 | 3300048907 | Bacteria | 1786 |
| 276 | Ga0496105_0008568 | 3300048908 | Bacteria | 7943 |
| 277 | Ga0496105_0071388 | 3300048908 | Bacteria | 2870 |
| 278 | Ga0496106_0000482 | 3300048909 | Bacteria | 28307 |
| 279 | Ga0496107_0005568 | 3300048910 | Bacteria | 8625 |
| 280 | Ga0496108_0131488 | 3300048911 | Bacteria | 2151 |
| 281 | Ga0496110_0377690 | 3300048913 | Bacteria | 1291 |
| 282 | Ga0496112_0284960 | 3300048915 | Bacteria | 1598 |
| 283 | Ga0496113_0001602 | 3300048916 | Bacteria | 12730 |
| 284 | Ga0496116_0028677 | 3300048919 | Bacteria | 4028 |
| 285 | Ga0496117_0008867 | 3300048920 | Bacteria | 9490 |
| 286 | Ga0496117_0021189 | 3300048920 | Bacteria | 5269 |
| 287 | Ga0496117_0046858 | 3300048920 | Bacteria | 3106 |
| 288 | Ga0496118_0000597 | 3300048921 | Bacteria | 59798 |
| 289 | Ga0496118_0018043 | 3300048921 | Bacteria | 6389 |
| 290 | Ga0496118_0021490 | 3300048921 | Bacteria | 5677 |
| 291 | Ga0496119_0235681 | 3300048922 | Bacteria | 929 |
| 292 | Ga0496120_0109407 | 3300048923 | Bacteria | 1446 |
| 293 | Ga0496121_0000017 | 3300048924 | Bacteria | 546415 |
| 294 | Ga0496121_0000192 | 3300048924 | Bacteria | 136529 |
| 295 | Ga0496121_0000276 | 3300048924 | Bacteria | 107058 |
| 296 | Ga0496121_0058002 | 3300048924 | Bacteria | 3205 |
| 297 | Ga0496122_0004562 | 3300048925 | Bacteria | 17076 |
| 298 | Ga0496122_0006059 | 3300048925 | Bacteria | 14089 |
| 299 | Ga0496123_0001492 | 3300048926 | Bacteria | 32495 |
| 300 | Ga0496123_0002042 | 3300048926 | Bacteria | 26076 |
| 301 | Ga0496124_0021907 | 3300048927 | Bacteria | 5878 |
| 302 | Ga0496125_0012883 | 3300048928 | Bacteria | 8260 |
| 303 | Ga0496125_0053587 | 3300048928 | Bacteria | 3305 |
| 304 | Ga0496125_0071605 | 3300048928 | Bacteria | 2707 |
| 305 | Ga0496125_0164005 | 3300048928 | Bacteria | 1504 |
| 306 | Ga0496126_0005527 | 3300048929 | Bacteria | 14387 |
| 307 | Ga0500643_000065 | 3300053087 | Bacteria | 119995 |
| 308 | Ga0500643_000539 | 3300053087 | Bacteria | 26512 |
| 309 | Ga0500643_000659 | 3300053087 | Bacteria | 23124 |
| 310 | Ga0500643_010262 | 3300053087 | Bacteria | 3501 |
| 311 | Ga0500643_014748 | 3300053087 | Bacteria | 2703 |
| 312 | Ga0500643_035388 | 3300053087 | Bacteria | 1498 |
| 313 | Ga0500651_0115561 | 3300053093 | Bacteria | 1634 |
| 314 | Ga0500566_0012190 | 3300053094 | Bacteria | 5063 |
| 315 | Ga0500566_0062444 | 3300053094 | Bacteria | 2106 |
| 316 | Ga0500572_120578 | 3300053111 | Bacteria | 849 |
| 317 | Ga0500592_002591 | 3300053116 | Bacteria | 2903 |
| 318 | Ga0500607_000023 | 3300053121 | Bacteria | 97892 |
| 319 | Ga0500658_0001689 | 3300053134 | Bacteria | 8748 |
| 320 | Ga0500559_0000291 | 3300053136 | Bacteria | 38726 |
| 321 | Ga0500559_0001497 | 3300053136 | Bacteria | 13143 |
| 322 | Ga0500559_0007595 | 3300053136 | Bacteria | 4789 |
| 323 | Ga0500559_0009179 | 3300053136 | Bacteria | 4294 |
| 324 | Ga0500568_0001843 | 3300053139 | Bacteria | 13069 |
| 325 | Ga0500590_087208 | 3300053148 | Bacteria | 1521 |
| 326 | Ga0500590_155044 | 3300053148 | Bacteria | 1028 |
| 327 | Ga0500604_0002386 | 3300053151 | Bacteria | 5135 |
| 328 | Ga0500624_000190 | 3300053157 | Bacteria | 24336 |
| 329 | Ga0500627_0000027 | 3300053158 | Bacteria | 99420 |
| 330 | Ga0500627_0235669 | 3300053158 | Bacteria | 813 |
| 331 | Ga0500636_0015478 | 3300053177 | Bacteria | 4495 |
| 332 | Ga0500637_0019683 | 3300053178 | Bacteria | 3643 |
| 333 | Ga0500645_001040 | 3300053730 | Bacteria | 15492 |
| 334 | Ga0500661_004695 | 3300055283 | Bacteria | 2552 |
| 335 | 2511128770 | 2510917021 | Bacteria | 5705459 |
| 336 | 2599500450 | 2599185188 | Bacteria | 6164180 |
| 337 | 2599935044 | 2599185300 | Bacteria | 6062622 |
| 338 | 2643833808 | 2643221563 | Bacteria | 4726935 |
| 339 | 2643950628 | 2643221588 | Bacteria | 3692460 |
| 340 | 2644054734 | 2643221608 | Bacteria | 4724829 |
| 341 | 2644126950 | 2643221622 | Bacteria | 4212502 |
| 342 | 2778124475 | 2775507255 | Bacteria | 3945731 |
| 343 | 2842927359 | 2842922631 | Bacteria | 5824079 |
| 344 | 2919139302 | 2919138771 | Bacteria | 5281312 |
| 345 | 2919710862 | 2919709256 | Bacteria | 4318106 |
| 346 | 2990266507 | 2990265787 | Bacteria | 3943888 |
| 347 | 2993695695 | 2993693658 | Bacteria | 4040749 |
| 348 | 8024485338 | 8024479707 | Bacteria | 6954785 |
| 349 | Ga0055531_10004365 | |||
| 350 | SwRhRL2b_contig_507762 | |||
| 351 | SwRhRL2b_contig_890187 | |||
| 352 | JGI24736J21556_1000067 | |||
| 353 | JGI24741J21665_1000129 | |||
| 354 | JGI24752J21851_1000337 | |||
| 355 | JGI24740J21852_10007691 | |||
| 356 | JGI24740J21852_10017388 | |||
| 357 | JGI24739J22299_10006013 | |||
| 358 | JGI24739J22299_10015445 | |||
| 359 | JGI24737J22298_10002364 | |||
| 360 | JGI24735J21928_10006441 | |||
| 361 | Ga0055537_1001711 | |||
| 362 | Ga0055524_1000180 | |||
| 363 | Ga0055536_1002932 | |||
| 364 | Ga0055536_1009616 | |||
| 365 | Ga0055534_1009291 | |||
| 366 | Ga0055528_1030133 | |||
| 367 | Ga0055530_10014207 | |||
| 368 | Ga0055531_10017041 | |||
| 369 | Ga0055543_1006282 | |||
| 370 | Ga0065165_1002147 | |||
| 371 | Ga0065165_1007278 | |||
| 372 | Ga0065704_10073669 | |||
| 373 | Ga0065707_10161421 | |||
| 374 | Ga0070690_100048531 | |||
| 375 | Ga0070670_100000209 | |||
| 376 | Ga0070670_100122440 | |||
| 377 | Ga0070666_10001918 | |||
| 378 | Ga0070666_10296250 | |||
| 379 | Ga0070682_100269761 | |||
| 380 | Ga0070660_100018236 | |||
| 381 | Ga0070661_100014350 | |||
| 382 | Ga0070668_100000868 | |||
| 383 | Ga0070668_100005470 | |||
| 384 | Ga0070669_100000023 | |||
| 385 | Ga0070669_100001101 | |||
| 386 | Ga0070669_100006207 | |||
| 387 | Ga0070671_100000086 | |||
| 388 | Ga0070659_100006657 | |||
| 389 | Ga0070659_100009490 | |||
| 390 | Ga0070667_100000127 | |||
| 391 | Ga0070667_100000548 | |||
| 392 | Ga0070667_100002263 | |||
| 393 | Ga0070667_100002900 | |||
| 394 | Ga0070667_100084509 | |||
| 395 | Ga0070663_100000846 | |||
| 396 | Ga0070663_100090851 | |||
| 397 | Ga0070662_100002223 | |||
| 398 | Ga0070662_100304599 | |||
| 399 | Ga0070685_10201046 | |||
| 400 | Ga0070684_100143844 | |||
| 401 | Ga0068853_100006005 | |||
| 402 | Ga0068853_100028839 | |||
| 403 | Ga0068853_100105059 | |||
| 404 | Ga0070686_100004612 | |||
| 405 | Ga0070665_100004358 | |||
| 406 | Ga0070665_100497065 | |||
| 407 | Ga0068855_100213855 | |||
| 408 | Ga0070664_100293255 | |||
| 409 | Ga0068857_100025246 | |||
| 410 | Ga0068857_100123324 | |||
| 411 | Ga0068857_100246626 | |||
| 412 | Ga0068857_100594665 | |||
| 413 | Ga0068856_100003983 | |||
| 414 | Ga0068856_100046968 | |||
| 415 | Ga0068852_100025737 | |||
| 416 | Ga0068859_100023279 | |||
| 417 | Ga0068859_100099775 | |||
| 418 | Ga0068864_100000062 | |||
| 419 | Ga0068864_100003877 | |||
| 420 | Ga0068851_10016716 | |||
| 421 | Ga0068851_10277110 | |||
| 422 | Ga0068863_100000064 | |||
| 423 | Ga0068863_100000103 | |||
| 424 | Ga0068863_100000225 | |||
| 425 | Ga0068858_100099067 | |||
| 426 | Ga0068858_100128849 | |||
| 427 | Ga0068860_100000093 | |||
| 428 | Ga0068860_100051175 | |||
| 429 | Ga0068860_100163781 | |||
| 430 | Ga0068860_100269478 | |||
| 431 | Ga0068862_100000063 | |||
| 432 | Ga0068862_100000079 | |||
| 433 | Ga0068862_100000425 | |||
| 434 | Ga0068862_100002732 | |||
| 435 | Ga0097620_100023280 | |||
| 436 | Ga0097620_100099773 | |||
| 437 | Ga0105251_10003959 | |||
| 438 | Ga0105240_10013008 | |||
| 439 | Ga0105247_10012293 | |||
| 440 | Ga0105241_10002171 | |||
| 441 | Ga0105241_10014391 | |||
| 442 | Ga0105241_10146656 | |||
| 443 | Ga0105248_10000014 | |||
| 444 | Ga0105248_10038576 | |||
| 445 | Ga0105248_10168380 | |||
| 446 | Ga0105237_10021045 | |||
| 447 | Ga0105237_10225479 | |||
| 448 | Ga0105238_10612378 | |||
| 449 | Ga0105249_10000103 | |||
| 450 | Ga0105249_10000907 | |||
| 451 | Ga0105249_10006886 | |||
| 452 | Ga0105249_10217435 | |||
| 453 | Ga0105239_10126170 | |||
| 454 | Ga0157373_10192199 | |||
| 455 | Ga0157371_10145673 | |||
| 456 | Ga0163162_10044267 | |||
| 457 | Ga0157372_10497134 | |||
| 458 | Ga0157379_10016305 | |||
| 459 | Ga0207425_1006174 | |||
| 460 | Ga0209565_1000012 | |||
| 461 | Ga0209673_1003940 | |||
| 462 | Ga0209675_1000235 | |||
| 463 | Ga0209675_1018775 | |||
| 464 | Ga0209676_1000045 | |||
| 465 | Ga0209676_1000641 | |||
| 466 | Ga0209025_1008395 | |||
| 467 | Ga0209564_1046018 | |||
| 468 | Ga0209758_1005936 | |||
| 469 | Ga0209050_1003217 | |||
| 470 | Ga0209050_1006065 | |||
| 471 | Ga0209050_1014150 | |||
| 472 | Ga0209256_1000012 | |||
| 473 | Ga0209257_1002214 | |||
| 474 | Ga0209257_1002738 | |||
| 475 | Ga0207697_10001233 | |||
| 476 | Ga0207656_10096099 | |||
| 477 | Ga0207713_1006508 | |||
| 478 | Ga0207680_10000062 | |||
| 479 | Ga0207680_10005345 | |||
| 480 | Ga0207680_10027383 | |||
| 481 | Ga0207705_10278375 | |||
| 482 | Ga0207654_10000931 | |||
| 483 | Ga0207654_10008026 | |||
| 484 | Ga0207695_10026121 | |||
| 485 | Ga0207695_10035516 | |||
| 486 | Ga0207671_10028923 | |||
| 487 | Ga0207657_10012417 | |||
| 488 | Ga0207657_10036691 | |||
| 489 | Ga0207649_10014871 | |||
| 490 | Ga0207681_10000004 | |||
| 491 | Ga0207681_10001495 | |||
| 492 | Ga0207681_10170211 | |||
| 493 | Ga0207694_10018672 | |||
| 494 | Ga0207694_10129335 | |||
| 495 | Ga0207650_10000367 | |||
| 496 | Ga0207650_10261943 | |||
| 497 | Ga0207644_10000011 | |||
| 498 | Ga0207690_10068710 | |||
| 499 | Ga0207690_10807906 | |||
| 500 | Ga0207706_10027117 | |||
| 501 | Ga0207711_10000021 | |||
| 502 | Ga0207711_10667523 | |||
| 503 | Ga0207679_10499478 | |||
| 504 | Ga0207667_10018821 | |||
| 505 | Ga0207667_10094343 | |||
| 506 | Ga0207712_10000069 | |||
| 507 | Ga0207712_10000687 | |||
| 508 | Ga0207712_10001707 | |||
| 509 | Ga0207712_10185307 | |||
| 510 | Ga0207668_10000370 | |||
| 511 | Ga0207668_10000384 | |||
| 512 | Ga0207668_10072325 | |||
| 513 | Ga0207668_10257234 | |||
| 514 | Ga0207640_10034529 | |||
| 515 | Ga0207640_10145175 | |||
| 516 | Ga0207640_10220813 | |||
| 517 | Ga0207658_10000424 | |||
| 518 | Ga0207658_10000472 | |||
| 519 | Ga0207658_10004711 | |||
| 520 | Ga0207658_10212991 | |||
| 521 | Ga0207703_10121225 | |||
| 522 | Ga0207703_10173090 | |||
| 523 | Ga0207639_10000169 | |||
| 524 | Ga0207639_10003655 | |||
| 525 | Ga0207639_10011333 | |||
| 526 | Ga0207678_10001016 | |||
| 527 | Ga0207678_10002260 | |||
| 528 | Ga0207702_10002789 | |||
| 529 | Ga0207702_10011415 | |||
| 530 | Ga0207641_10000107 | |||
| 531 | Ga0207641_10000113 | |||
| 532 | Ga0207641_10000367 | |||
| 533 | Ga0207641_10003191 | |||
| 534 | Ga0207641_10292791 | |||
| 535 | Ga0207676_10000057 | |||
| 536 | Ga0207676_10002371 | |||
| 537 | Ga0207674_10068249 | |||
| 538 | Ga0207674_10081793 | |||
| 539 | Ga0207674_10140171 | |||
| 540 | Ga0207698_10001722 | |||
| 541 | Ga0207698_10120937 | |||
| 542 | Ga0268266_10018088 | |||
| 543 | Ga0268266_10239732 | |||
| 544 | Ga0268265_10000046 | |||
| 545 | Ga0268265_10000055 | |||
| 546 | Ga0268265_10000080 | |||
| 547 | Ga0268265_10018635 | |||
| 548 | Ga0268264_10000067 | |||
| 549 | Ga0268264_10018866 | |||
| 550 | Ga0268264_10155011 | |||
| 551 | Ga0307408_100007397 | |||
| 552 | Ga0307408_100041091 | |||
| 553 | Ga0307408_100147115 | |||
| 554 | Ga0307408_100342690 | |||
| 555 | Ga0307405_10006629 | |||
| 556 | Ga0307405_10027704 | |||
| 557 | Ga0307405_10520387 | |||
| 558 | Ga0307410_10093950 | |||
| 559 | Ga0307410_10345365 | |||
| 560 | Ga0307406_10068617 | |||
| 561 | Ga0307412_10006353 | |||
| 562 | Ga0307412_10009431 | |||
| 563 | Ga0307412_10115561 | |||
| 564 | Ga0307409_100150870 | |||
| 565 | Ga0307416_100071822 | |||
| 566 | Ga0307416_100072665 | |||
| 567 | Ga0307414_10437220 | |||
| 568 | Ga0237819_01506 | |||
| 569 | Ga0237816_00159 | |||
| 570 | Ga0439466_0071647 | |||
| 571 | Ga0451853_2875177 | |||
| 572 | Ga0439431_0008317 | |||
| 573 | Ga0439445_0004245 | |||
| 574 | Ga0439446_0001612 | |||
| 575 | Ga0439434_0121791 | |||
| 576 | Ga0495627_000108 | |||
| 577 | Ga0495627_000159 | |||
| 578 | Ga0495650_0001292 | |||
| 579 | Ga0495650_0003429 | |||
| 580 | Ga0495650_0024511 | |||
| 581 | Ga0495596_0000113 | |||
| 582 | Ga0495607_0027755 | |||
| 583 | Ga0495583_0000443 | |||
| 584 | Ga0495583_0074243 | |||
| 585 | Ga0495583_0129069 | |||
| 586 | Ga0495606_0016763 | |||
| 587 | Ga0495610_0000044 | |||
| 588 | Ga0495610_0000615 | |||
| 589 | Ga0495610_0000883 | |||
| 590 | Ga0495610_0035457 | |||
| 591 | Ga0495616_0000576 | |||
| 592 | Ga0495620_0019690 | |||
| 593 | Ga0495632_0000220 | |||
| 594 | Ga0495632_0000272 | |||
| 595 | Ga0495643_0000448 | |||
| 596 | Ga0495643_0008015 | |||
| 597 | Ga0495643_0012812 | |||
| 598 | Ga0495643_0080777 | |||
| 599 | Ga0495648_0000020 | |||
| 600 | Ga0495663_0075123 | |||
| 601 | Ga0495609_0009931 | |||
| 602 | Ga0495622_0060623 | |||
| 603 | Ga0495633_0223448 | |||
| 604 | Ga0495668_0000053 | |||
| 605 | Ga0495668_0031953 | |||
| 606 | Ga0495625_0000526 | |||
| 607 | Ga0495625_0023497 | |||
| 608 | Ga0495671_0000022 | |||
| 609 | Ga0495671_0030913 | |||
| 610 | Ga0495671_0228813 | |||
| 611 | Ga0495672_0147314 | |||
| 612 | Ga0495673_0000051 | |||
| 613 | Ga0495681_0000014 | |||
| 614 | Ga0495681_0000103 | |||
| 615 | Ga0495681_0045504 | |||
| 616 | Ga0495681_0062324 | |||
| 617 | Ga0495681_0121872 | |||
| 618 | Ga0495615_0000168 | |||
| 619 | Ga0496100_0125137 | |||
| 620 | Ga0496101_0053251 | |||
| 621 | Ga0496101_0149021 | |||
| 622 | Ga0496103_0085714 | |||
| 623 | Ga0496104_0225432 | |||
| 624 | Ga0496105_0008568 | |||
| 625 | Ga0496105_0071388 | |||
| 626 | Ga0496106_0000482 | |||
| 627 | Ga0496107_0005568 | |||
| 628 | Ga0496108_0131488 | |||
| 629 | Ga0496110_0377690 | |||
| 630 | Ga0496112_0284960 | |||
| 631 | Ga0496113_0001602 | |||
| 632 | Ga0496116_0028677 | |||
| 633 | Ga0496117_0008867 | |||
| 634 | Ga0496117_0021189 | |||
| 635 | Ga0496117_0046858 | |||
| 636 | Ga0496118_0000597 | |||
| 637 | Ga0496118_0018043 | |||
| 638 | Ga0496118_0021490 | |||
| 639 | Ga0496119_0235681 | |||
| 640 | Ga0496120_0109407 | |||
| 641 | Ga0496121_0000017 | |||
| 642 | Ga0496121_0000192 | |||
| 643 | Ga0496121_0000276 | |||
| 644 | Ga0496121_0058002 | |||
| 645 | Ga0496122_0004562 | |||
| 646 | Ga0496122_0006059 | |||
| 647 | Ga0496123_0001492 | |||
| 648 | Ga0496123_0002042 | |||
| 649 | Ga0496124_0021907 | |||
| 650 | Ga0496125_0012883 | |||
| 651 | Ga0496125_0053587 | |||
| 652 | Ga0496125_0071605 | |||
| 653 | Ga0496125_0164005 | |||
| 654 | Ga0496126_0005527 | |||
| 655 | Ga0500643_000065 | |||
| 656 | Ga0500643_000539 | |||
| 657 | Ga0500643_000659 | |||
| 658 | Ga0500643_010262 | |||
| 659 | Ga0500643_014748 | |||
| 660 | Ga0500643_035388 | |||
| 661 | Ga0500651_0115561 | |||
| 662 | Ga0500566_0012190 | |||
| 663 | Ga0500566_0062444 | |||
| 664 | Ga0500572_120578 | |||
| 665 | Ga0500592_002591 | |||
| 666 | Ga0500607_000023 | |||
| 667 | Ga0500658_0001689 | |||
| 668 | Ga0500559_0000291 | |||
| 669 | Ga0500559_0001497 | |||
| 670 | Ga0500559_0007595 | |||
| 671 | Ga0500559_0009179 | |||
| 672 | Ga0500568_0001843 | |||
| 673 | Ga0500590_087208 | |||
| 674 | Ga0500590_155044 | |||
| 675 | Ga0500604_0002386 | |||
| 676 | Ga0500624_000190 | |||
| 677 | Ga0500627_0000027 | |||
| 678 | Ga0500627_0235669 | |||
| 679 | Ga0500636_0015478 | |||
| 680 | Ga0500637_0019683 | |||
| 681 | Ga0500645_001040 | |||
| 682 | Ga0500661_004695 | |||
| 683 | 2511128770 | |||
| 684 | 2599500450 | |||
| 685 | 2599935044 | |||
| 686 | 2643833808 | |||
| 687 | 2643950628 | |||
| 688 | 2644054734 | |||
| 689 | 2644126950 | |||
| 690 | 2778124475 | |||
| 691 | 2842927359 | |||
| 692 | 2919139302 | |||
| 693 | 2919710862 | |||
| 694 | 2990266507 | |||
| 695 | 2993695695 | |||
| 696 | 8024485338 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d54-assembly1.cif.gz_B | crstal structure msgatase with gln | 0.8643 | 4 | 231 |
| 3l7n-assembly1.cif.gz_A | crystal structure of smu.1228c | 0.8519 | 5 | 229 |
| 1o1y-assembly1.cif.gz_A | crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution | 0.8477 | 1 | 231 |
| 1o1y-assembly1.cif.gz_A | crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution | 0.8409 | 1 | 231 |
| 3l7n-assembly1.cif.gz_A | crystal structure of smu.1228c | 0.8181 | 5 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8519 | 5 | 229 | 3.40.50.880 |
| af_Q59T45_76_269_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8498 | 53 | 192 | 3.40.50.880 |
| 3l83A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8368 | 6 | 232 | 3.40.50.880 |
| 1o1yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.833 | 1 | 229 | 3.40.50.880 |
| 1o1yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8228 | 1 | 229 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8HK46-F1-model_v4 | deleted | 0.9969 | 4 | 100 |
|
| AF-A0A1L6J8Q6-F1-model_v4 | Glutamine amidotransferase | 0.9926 | 4 | 232 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A4Q2ZVB6-F1-model_v4 | Glutamine amidotransferase | 0.9922 | 4 | 231 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A2N3D6T2-F1-model_v4 | Glutamine amidotransferase | 0.9918 | 4 | 232 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A0J7Y3S8-F1-model_v4 | Glutamine amidotransferase | 0.9899 | 4 | 232 |
GO:0005829
GO:0006541 GO:0016740 |