F417504

General Info

Members Datasets Scaffolds Average Seq Length
348 201 333 319

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10011910|Ga0105240_100119102
Length 344
Sequence MIRFIVKSGSQSSSRRKEMITGKVTTLSGLAAAALFALSSLPAPAAAQQKFVTIGTGGVTGVYYAVGGAVCRLMNKDRAKTGIRCSVESTGGSVFNANAIGTGEQEFGLAQSDVQFNAAKGEAQFKGKAIADLRAVFSVHPEPFTVLARKEANIAKFEDFKGKRFNIGNPGSGTLASMEELLKQMGWTRADFSLAAELKADEQGTALCDNKIDGFFYGVGHPSAAIQDPTTACGAKLVPLTGSAVDALVAAHPYYAKVAIPGGMYANNPNPTPTYGVLATMMTSAKVPDQVVYDLAKAVFENFDEFKKLHPAFANLDPRHMVKDGLSAPLHPGAIKYYKEKGWM

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
3 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
4 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
7 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
8 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
9 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
10 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
11 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
12 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
13 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
14 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
200 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
201 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0.57
Isolates 4.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 2.3
Rhizoplane 0.29
Rhizosphere 91.38
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002447 3300000549 Bacteria 2580
2 Ga0070658_10021237 3300005327 Bacteria 5201
3 Ga0070658_10028900 3300005327 Bacteria 4451
4 Ga0070683_100018847 3300005329 Bacteria 6123
5 Ga0070680_100022626 3300005336 Bacteria 5008
6 Ga0070680_100028568 3300005336 Bacteria 4474
7 Ga0070680_100029149 3300005336 Bacteria 4433
8 Ga0070680_100120490 3300005336 Bacteria 2190
9 Ga0070660_100014784 3300005339 Bacteria 5631
10 Ga0070691_10117164 3300005341 Bacteria 1338
11 Ga0070661_100064974 3300005344 Bacteria 2681
12 Ga0070675_100155745 3300005354 Bacteria 1962
13 Ga0070688_100212628 3300005365 Bacteria 1359
14 Ga0070659_100118746 3300005366 Bacteria 2140
15 Ga0070659_100206012 3300005366 Bacteria 1620
16 Ga0070659_100387109 3300005366 Bacteria 1178
17 Ga0070714_100083261 3300005435 Bacteria 2789
18 Ga0070662_100053447 3300005457 Bacteria 2924
19 Ga0070681_10003118 3300005458 Bacteria 15399
20 Ga0070681_10084259 3300005458 Bacteria 3131
21 Ga0070681_10210676 3300005458 Bacteria 1860
22 Ga0070699_100156603 3300005518 Bacteria 2016
23 Ga0070679_100002575 3300005530 Bacteria 16471
24 Ga0070679_100044649 3300005530 Bacteria 4415
25 Ga0070679_100056561 3300005530 Bacteria 3908
26 Ga0070679_100107224 3300005530 Bacteria 2779
27 Ga0070684_100060818 3300005535 Bacteria 3304
28 Ga0070684_100285110 3300005535 Bacteria 1514
29 Ga0068853_100002117 3300005539 Bacteria 14743
30 Ga0068853_100008111 3300005539 Bacteria 8430
31 Ga0070693_100006849 3300005547 Bacteria 5540
32 Ga0070693_100008954 3300005547 Bacteria 4966
33 Ga0068855_100011862 3300005563 Bacteria 10537
34 Ga0068855_100014231 3300005563 Bacteria 9583
35 Ga0068855_100025923 3300005563 Bacteria 7013
36 Ga0068855_100054267 3300005563 Bacteria 4710
37 Ga0068855_100435572 3300005563 Bacteria 1432
38 Ga0070664_100105162 3300005564 Bacteria 2458
39 Ga0068857_100035960 3300005577 Bacteria 4388
40 Ga0068854_100001452 3300005578 Bacteria 14343
41 Ga0068854_100021820 3300005578 Bacteria 4352
42 Ga0068856_100000024 3300005614 Bacteria 141222
43 Ga0068856_100065386 3300005614 Bacteria 3594
44 Ga0068856_100152949 3300005614 Bacteria 2316
45 Ga0068852_100030159 3300005616 Bacteria 4461
46 Ga0068862_100024817 3300005844 Bacteria 5030
47 Ga0081538_10008504 3300005981 Bacteria 8697
48 Ga0081540_1004828 3300005983 Bacteria 10156
49 Ga0075365_10002483 3300006038 Bacteria 9065
50 Ga0075368_10032606 3300006042 Bacteria 2024
51 Ga0075363_100010017 3300006048 Bacteria 4479
52 Ga0075363_100084100 3300006048 Bacteria 1744
53 Ga0075363_100155731 3300006048 Bacteria 1292
54 Ga0075364_10016046 3300006051 Bacteria 4654
55 Ga0070712_100168147 3300006175 Bacteria 1699
56 Ga0075367_10012833 3300006178 Bacteria 4486
57 Ga0075429_100439520 3300006880 Bacteria 1143
58 Ga0099794_10029464 3300007265 Bacteria 2558
59 Ga0105240_10006964 3300009093 Bacteria 16514
60 Ga0105240_10011910 3300009093 Bacteria 12062
61 Ga0105240_10055924 3300009093 Bacteria 4939
62 Ga0111539_10041364 3300009094 Bacteria 5541
63 Ga0105241_10005667 3300009174 Bacteria 9214
64 Ga0105248_10251083 3300009177 Bacteria 1991
65 Ga0105237_10007023 3300009545 Bacteria 12400
66 Ga0105238_10036027 3300009551 Bacteria 5029
67 Ga0105238_10104833 3300009551 Bacteria 2809
68 Ga0105239_10030920 3300010375 Bacteria 5890
69 Ga0157373_10009307 3300013100 Bacteria 7263
70 Ga0157371_10052607 3300013102 Bacteria 2892
71 Ga0157370_10018194 3300013104 Bacteria 7072
72 Ga0157370_10024107 3300013104 Bacteria 6031
73 Ga0157378_10081569 3300013297 Bacteria 2923
74 Ga0157372_10029953 3300013307 Bacteria 5948
75 Ga0206353_10197760 3300020082 Bacteria 3626
76 Ga0213876_10009783 3300021384 Bacteria 5160
77 Ga0209233_1006798 3300025261 Bacteria 3660
78 Ga0207656_10005116 3300025321 Bacteria 4612
79 Ga0207705_10009596 3300025909 Bacteria 7039
80 Ga0207705_10019884 3300025909 Bacteria 4803
81 Ga0207705_10159452 3300025909 Bacteria 1694
82 Ga0207654_10170687 3300025911 Bacteria 1412
83 Ga0207707_10007720 3300025912 Bacteria 9366
84 Ga0207707_10014256 3300025912 Bacteria 6925
85 Ga0207707_10020876 3300025912 Bacteria 5720
86 Ga0207707_10021242 3300025912 Bacteria 5674
87 Ga0207695_10017211 3300025913 Bacteria 8421
88 Ga0207695_10036471 3300025913 Bacteria 5315
89 Ga0207671_10009486 3300025914 Bacteria 8129
90 Ga0207693_10228140 3300025915 Bacteria 1462
91 Ga0207660_10008544 3300025917 Bacteria 6626
92 Ga0207660_10014572 3300025917 Bacteria 5173
93 Ga0207662_10136652 3300025918 Bacteria 1550
94 Ga0207657_10004221 3300025919 Bacteria 15223
95 Ga0207657_10048498 3300025919 Bacteria 3708
96 Ga0207657_10073689 3300025919 Bacteria 2884
97 Ga0207649_10047380 3300025920 Bacteria 2645
98 Ga0207652_10012192 3300025921 Bacteria 6946
99 Ga0207652_10050909 3300025921 Bacteria 3549
100 Ga0207652_10078341 3300025921 Bacteria 2885
101 Ga0207652_10263026 3300025921 Bacteria 1556
102 Ga0207681_10066960 3300025923 Bacteria 2488
103 Ga0207650_10169706 3300025925 Bacteria 1733
104 Ga0207690_10043068 3300025932 Bacteria 2969
105 Ga0207706_10004852 3300025933 Bacteria 12593
106 Ga0207670_10336819 3300025936 Bacteria 1191
107 Ga0207661_10046153 3300025944 Bacteria 3454
108 Ga0207667_10012359 3300025949 Bacteria 9845
109 Ga0207667_10027075 3300025949 Bacteria 6251
110 Ga0207667_10075289 3300025949 Bacteria 3505
111 Ga0207667_10080429 3300025949 Bacteria 3376
112 Ga0207640_10019304 3300025981 Bacteria 4025
113 Ga0207640_10025784 3300025981 Bacteria 3563
114 Ga0207640_10092314 3300025981 Bacteria 2100
115 Ga0207639_10016950 3300026041 Bacteria 5162
116 Ga0207639_10038051 3300026041 Bacteria 3576
117 Ga0207639_10177175 3300026041 Bacteria 1811
118 Ga0207678_10135901 3300026067 Bacteria 2098
119 Ga0207702_10000805 3300026078 Bacteria 33235
120 Ga0207702_10319148 3300026078 Bacteria 1479
121 Ga0207674_10012738 3300026116 Bacteria 9394
122 Ga0207674_10155708 3300026116 Bacteria 2240
123 Ga0207698_10034006 3300026142 Bacteria 3711
124 Ga0207698_10592257 3300026142 Bacteria 1092
125 Ga0209970_1003456 3300027614 Bacteria 2655
126 Ga0207428_10142246 3300027907 Bacteria 1830
127 Ga0268265_10013916 3300028380 Bacteria 5477
128 Ga0268265_10314179 3300028380 Bacteria 1416
129 Ga0307513_10000012 3300031456 Bacteria 328865
130 Ga0307408_100058669 3300031548 Bacteria 2799
131 Ga0265313_10000087 3300031595 Bacteria 91132
132 Ga0265313_10013513 3300031595 Bacteria 4895
133 Ga0265342_10000131 3300031712 Bacteria 82968
134 Ga0316576_10001596 3300031727 Bacteria 12358
135 Ga0307405_10002425 3300031731 Bacteria 8213
136 Ga0307410_10006859 3300031852 Bacteria 6185
137 Ga0307406_10005349 3300031901 Bacteria 7026
138 Ga0307407_10004490 3300031903 Bacteria 5936
139 Ga0307409_100002503 3300031995 Bacteria 9626
140 Ga0307416_100009639 3300032002 Bacteria 6334
141 Ga0307411_10084155 3300032005 Bacteria 2199
142 Ga0307411_10272350 3300032005 Bacteria 1343
143 Ga0307415_100003499 3300032126 Bacteria 8004
144 Ga0316593_10032136 3300032168 Bacteria 1713
145 Ga0373926_0006331 3300035083 Bacteria 3930
146 Ga0373934_0001465 3300035086 Bacteria 8638
147 Ga0373936_0045393 3300035113 Bacteria 1770
148 Ga0373941_0001564 3300035115 Bacteria 4858
149 Ga0373945_0011709 3300035116 Bacteria 2904
150 Ga0373953_0003693 3300035117 Bacteria 4805
151 Ga0373954_0000827 3300035118 Bacteria 11995
152 Ga0373954_0123131 3300035118 Bacteria 1260
153 Ga0373957_0010743 3300035120 Bacteria 3035
154 Ga0373943_0000498 3300035170 Bacteria 16777
155 Ga0373955_0002043 3300035172 Bacteria 8678
156 Ga0373955_0020483 3300035172 Bacteria 3326
157 Ga0373924_0002332 3300035410 Bacteria 6372
158 Ga0373935_0010062 3300035692 Bacteria 5666
159 Ga0373927_0002012 3300035695 Bacteria 14988
160 Ga0373933_0008625 3300035724 Bacteria 5559
161 Ga0373947_0002414 3300035725 Bacteria 11276
162 Ga0373937_0014183 3300036401 Bacteria 7030
163 Ga0316582_0137353 3300036647 Unclassified 1646
164 Ga0373925_0028167 3300037068 Bacteria 4116
165 Ga0395899_0098695 3300037312 Bacteria 2110
166 Ga0395899_0220105 3300037312 Bacteria 1315
167 Ga0395900_0031735 3300037418 Bacteria 5430
168 Ga0395900_0089134 3300037418 Bacteria 3171
169 Ga0395900_0245254 3300037418 Bacteria 1795
170 Ga0395898_0178666 3300037466 Bacteria 2028
171 Ga0316581_0069833 3300037588 Unclassified 1079
172 Ga0395901_0100712 3300038443 Bacteria 3031
173 Ga0395901_0496844 3300038443 Bacteria 1242
174 Ga0400487_58139 3300039110 Bacteria 4932
175 Ga0436365_1849927 3300039437 Bacteria 23122
176 Ga0439448_0023556 3300042005 Bacteria 1922
177 Ga0451577_0141711 3300042876 Bacteria 2160
178 Ga0453684_0024323 3300044712 Bacteria 8859
179 Ga0495629_0000804 3300046459 Bacteria 25437
180 Ga0495629_0076097 3300046459 Bacteria 2344
181 Ga0495651_0120569 3300046462 Bacteria 1927
182 Ga0495653_0005997 3300046463 Bacteria 9949
183 Ga0495662_0015620 3300046476 Bacteria 3684
184 Ga0495608_0006206 3300046511 Bacteria 8483
185 Ga0495628_0026632 3300046516 Bacteria 4710
186 Ga0495630_0047031 3300046517 Bacteria 3226
187 Ga0495665_0034600 3300046531 Bacteria 2701
188 Ga0495640_0002381 3300046533 Bacteria 15097
189 Ga0495645_0008789 3300046543 Bacteria 7054
190 Ga0495634_0005998 3300046642 Bacteria 9277
191 Ga0495634_0110442 3300046642 Bacteria 1768
192 Ga0495635_0006293 3300046663 Bacteria 8269
193 Ga0495657_0033361 3300046675 Bacteria 3584
194 Ga0495599_0005174 3300046678 Bacteria 7777
195 Ga0495623_0143097 3300046679 Bacteria 1420
196 Ga0495646_0019943 3300046680 Bacteria 4239
197 Ga0495658_0162174 3300046683 Bacteria 1379
198 Ga0495600_0015912 3300046809 Bacteria 4765
199 Ga0495600_0177706 3300046809 Bacteria 1372
200 Ga0495581_0005378 3300047315 Bacteria 7410
201 Ga0495604_0191553 3300047317 Bacteria 1424
202 Ga0495674_0012736 3300047319 Bacteria 7923
203 Ga0495674_0035147 3300047319 Bacteria 4524
204 Ga0495676_0071239 3300047321 Bacteria 2673
205 Ga0495675_0012432 3300047444 Bacteria 5358
206 Ga0495684_0001622 3300047471 Bacteria 18046
207 Ga0495684_0003719 3300047471 Bacteria 11894
208 Ga0495593_0003006 3300047673 Bacteria 10163
209 Ga0495593_0036345 3300047673 Bacteria 2671
210 Ga0495602_0040840 3300048088 Bacteria 4245
211 Ga0496114_0072544 3300048917 Bacteria 2896
212 Ga0501031_0103129 3300049568 Bacteria 1861
213 Ga0501031_0119679 3300049568 Bacteria 1720
214 Ga0501031_0226938 3300049568 Bacteria 1216
215 Ga0501032_0016333 3300049569 Bacteria 5223
216 Ga0501032_0017695 3300049569 Bacteria 5002
217 Ga0501032_0067917 3300049569 Bacteria 2380
218 Ga0501033_0001736 3300049570 Bacteria 19056
219 Ga0501033_0114275 3300049570 Bacteria 1962
220 Ga0501034_0000179 3300049571 Bacteria 118832
221 Ga0501034_0009186 3300049571 Bacteria 10371
222 Ga0501034_0009628 3300049571 Bacteria 10107
223 Ga0501034_0015149 3300049571 Bacteria 7924
224 Ga0501034_0088129 3300049571 Bacteria 3102
225 Ga0501034_0210054 3300049571 Bacteria 1902
226 Ga0501034_0356450 3300049571 Bacteria 1390
227 Ga0501036_0001210 3300049572 Bacteria 19714
228 Ga0501036_0002364 3300049572 Bacteria 14751
229 Ga0501036_0004131 3300049572 Bacteria 11683
230 Ga0501036_0012136 3300049572 Bacteria 7139
231 Ga0501036_0012446 3300049572 Bacteria 7050
232 Ga0501037_0003424 3300049573 Bacteria 11527
233 Ga0501037_0007192 3300049573 Bacteria 8132
234 Ga0501037_0022670 3300049573 Bacteria 4642
235 Ga0501038_0001455 3300049574 Bacteria 21766
236 Ga0501038_0004755 3300049574 Bacteria 12624
237 Ga0501038_0009593 3300049574 Bacteria 8880
238 Ga0501039_0005161 3300049575 Bacteria 9897
239 Ga0501039_0008624 3300049575 Bacteria 7770
240 Ga0501039_0030048 3300049575 Bacteria 4187
241 Ga0501039_0184700 3300049575 Bacteria 1639
242 Ga0501042_0031595 3300049578 Bacteria 3746
243 Ga0501043_0001468 3300049579 Bacteria 20618
244 Ga0501043_0004234 3300049579 Bacteria 11697
245 Ga0501043_0034549 3300049579 Bacteria 3976
246 Ga0501046_0010801 3300049580 Bacteria 7827
247 Ga0501046_0013077 3300049580 Bacteria 7045
248 Ga0501046_0048993 3300049580 Bacteria 3344
249 Ga0501047_0000179 3300049581 Bacteria 77520
250 Ga0501047_0004650 3300049581 Bacteria 12913
251 Ga0501047_0085972 3300049581 Bacteria 3021
252 Ga0501047_0255541 3300049581 Bacteria 1600
253 Ga0501048_0000818 3300049582 Bacteria 22920
254 Ga0501048_0005785 3300049582 Bacteria 9399
255 Ga0501048_0025403 3300049582 Bacteria 4317
256 Ga0501048_0072238 3300049582 Bacteria 2436
257 Ga0501067_0008054 3300049583 Bacteria 5856
258 Ga0501067_0043173 3300049583 Bacteria 2504
259 Ga0501067_0175645 3300049583 Bacteria 1193
260 Ga0501068_0010845 3300049584 Bacteria 5128
261 Ga0501069_0000783 3300049585 Bacteria 14926
262 Ga0501069_0050031 3300049585 Bacteria 2323
263 Ga0501069_0099815 3300049585 Bacteria 1647
264 Ga0501069_0100894 3300049585 Bacteria 1638
265 Ga0501069_0265632 3300049585 Bacteria 1002
266 Ga0501070_0003205 3300049586 Bacteria 14226
267 Ga0501070_0003263 3300049586 Bacteria 14075
268 Ga0501070_0007403 3300049586 Bacteria 9323
269 Ga0501070_0061598 3300049586 Bacteria 3108
270 Ga0501070_0061927 3300049586 Bacteria 3099
271 Ga0501070_0088206 3300049586 Bacteria 2568
272 Ga0501071_0009950 3300049587 Bacteria 6354
273 Ga0501071_0017895 3300049587 Bacteria 4899
274 Ga0501071_0116511 3300049587 Bacteria 1978
275 Ga0501072_0001804 3300049588 Bacteria 15946
276 Ga0501072_0039652 3300049588 Bacteria 3697
277 Ga0501073_0011864 3300049589 Bacteria 6360
278 Ga0501073_0012683 3300049589 Bacteria 6147
279 Ga0501073_0018071 3300049589 Bacteria 5099
280 Ga0501073_0050271 3300049589 Bacteria 2922
281 Ga0501073_0062557 3300049589 Bacteria 2596
282 Ga0501074_0009832 3300049590 Bacteria 6947
283 Ga0501074_0011223 3300049590 Bacteria 6510
284 Ga0501074_0033159 3300049590 Bacteria 3742
285 Ga0501075_0005615 3300049591 Bacteria 8582
286 Ga0501075_0022341 3300049591 Bacteria 4620
287 Ga0501076_0000232 3300049592 Bacteria 33942
288 Ga0501076_0005960 3300049592 Bacteria 8800
289 Ga0501077_0040602 3300049593 Bacteria 2964
290 Ga0501077_0049256 3300049593 Bacteria 2678
291 Ga0501077_0051257 3300049593 Bacteria 2623
292 Ga0501079_0017940 3300049741 Bacteria 5404
293 Ga0501079_0136530 3300049741 Bacteria 1910
294 Ga0501080_0001165 3300049742 Bacteria 21739
295 Ga0501080_0003959 3300049742 Bacteria 13113
296 Ga0501080_0012111 3300049742 Bacteria 7902
297 Ga0501080_0018937 3300049742 Bacteria 6376
298 Ga0501080_0040611 3300049742 Bacteria 4339
299 Ga0501080_0158096 3300049742 Bacteria 2093
300 Ga0501080_0351121 3300049742 Bacteria 1332
301 Ga0501083_0003061 3300049744 Bacteria 11626
302 Ga0501083_0006494 3300049744 Bacteria 8292
303 Ga0501083_0036174 3300049744 Bacteria 3368
304 Ga0501083_0037504 3300049744 Bacteria 3301
305 Ga0501083_0233272 3300049744 Bacteria 1198
306 Ga0501035_0001465 3300049822 Bacteria 24189
307 Ga0501035_0008439 3300049822 Bacteria 9593
308 Ga0501035_0046251 3300049822 Bacteria 3914
309 Ga0501035_0272149 3300049822 Bacteria 1433
310 Ga0501044_0003639 3300049823 Bacteria 17347
311 Ga0501044_0005248 3300049823 Bacteria 14411
312 Ga0501044_0046723 3300049823 Bacteria 4481
313 Ga0501044_0057454 3300049823 Bacteria 3992
314 Ga0501044_0167466 3300049823 Bacteria 2171
315 Ga0501044_0278613 3300049823 Bacteria 1606
316 Ga0501045_0022855 3300049824 Bacteria 4479
317 nmdc:mga03n38_31255_c1 3300050490 Bacteria 2245
318 nmdc:mga03n38_33977_c1 3300050490 Bacteria 2174
319 nmdc:mga00v17_17763_c1 3300050491 Bacteria 4033
320 Ga0495595_0005672 3300053084 Bacteria 5052
321 Ga0495619_0002256 3300053085 Bacteria 12741
322 Ga0495619_0190431 3300053085 Bacteria 1420
323 Ga0500651_0001692 3300053093 Bacteria 11268
324 Ga0500616_0013767 3300053153 Bacteria 4678
325 Ga0501084_0002949 3300054114 Bacteria 13780
326 Ga0501084_0005398 3300054114 Bacteria 10478
327 Ga0501084_0017256 3300054114 Bacteria 5997
328 Ga0501084_0078980 3300054114 Bacteria 2758
329 Ga0501082_0002533 3300060353 Bacteria 16001
330 Ga0501082_0003464 3300060353 Bacteria 13763
331 Ga0501082_0040028 3300060353 Bacteria 4043
332 Ga0501082_0095901 3300060353 Bacteria 2564
333 Ga0530510_0000487 3300061734 Bacteria 25408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0255541 Ga0501047_0255541_769_1584 258
2 3300028380 Ga0268265_10314179 Ga0268265_103141791 287
3 3300047673 Ga0495593_0036345 Ga0495593_0036345_276_1187 290
4 3300053085 Ga0495619_0190431 Ga0495619_0190431_481_1392 290
5 3300009174 Ga0105241_10005667 Ga0105241_100056675 294
6 3300013100 Ga0157373_10009307 Ga0157373_100093075 294
7 3300013104 Ga0157370_10024107 Ga0157370_100241077 294
8 3300013307 Ga0157372_10029953 Ga0157372_100299534 294
9 3300042005 Ga0439448_0023556 Ga0439448_0023556_217_1191 295
10 3300049586 Ga0501070_0088206 Ga0501070_0088206_937_1887 295
11 3300049744 Ga0501083_0037504 Ga0501083_0037504_932_1882 295
12 3300005539 Ga0068853_100002117 Ga0068853_1000021175 296
13 3300035083 Ga0373926_0006331 Ga0373926_0006331_2116_3045 296
14 3300035116 Ga0373945_0011709 Ga0373945_0011709_1905_2834 296
15 3300035170 Ga0373943_0000498 Ga0373943_0000498_12910_13839 296
16 3300035692 Ga0373935_0010062 Ga0373935_0010062_3312_4241 296
17 3300035695 Ga0373927_0002012 Ga0373927_0002012_1136_2065 296
18 3300035725 Ga0373947_0002414 Ga0373947_0002414_6653_7582 296
19 3300037068 Ga0373925_0028167 Ga0373925_0028167_2084_3013 296
20 3300046459 Ga0495629_0076097 Ga0495629_0076097_257_1186 296
21 3300046476 Ga0495662_0015620 Ga0495662_0015620_2576_3505 296
22 3300046517 Ga0495630_0047031 Ga0495630_0047031_1937_2866 296
23 3300046531 Ga0495665_0034600 Ga0495665_0034600_1736_2665 296
24 3300046642 Ga0495634_0110442 Ga0495634_0110442_205_1134 296
25 3300046683 Ga0495658_0162174 Ga0495658_0162174_254_1183 296
26 3300047315 Ga0495581_0005378 Ga0495581_0005378_1133_2062 296
27 3300047319 Ga0495674_0035147 Ga0495674_0035147_2426_3355 296
28 3300047321 Ga0495676_0071239 Ga0495676_0071239_1371_2300 296
29 3300047471 Ga0495684_0001622 Ga0495684_0001622_3276_4205 296
30 3300005341 Ga0070691_10117164 Ga0070691_101171642 297
31 3300005458 Ga0070681_10003118 Ga0070681_100031183 297
32 3300005530 Ga0070679_100002575 Ga0070679_1000025755 297
33 3300005547 Ga0070693_100008954 Ga0070693_1000089545 297
34 3300005563 Ga0068855_100014231 Ga0068855_1000142316 297
35 3300025911 Ga0207654_10170687 Ga0207654_101706872 297
36 3300025912 Ga0207707_10021242 Ga0207707_100212422 297
37 3300025921 Ga0207652_10078341 Ga0207652_100783412 297
38 3300026041 Ga0207639_10016950 Ga0207639_100169502 297
39 3300049586 Ga0501070_0061927 Ga0501070_0061927_19_951 297
40 3300026116 Ga0207674_10155708 Ga0207674_101557082 298
41 3300049583 Ga0501067_0043173 Ga0501067_0043173_1223_2167 299
42 3300049585 Ga0501069_0265632 Ga0501069_0265632_44_988 301
43 3300009093 Ga0105240_10055924 Ga0105240_100559242 302
44 3300042876 Ga0451577_0141711 Ga0451577_0141711_570_1559 302
45 3300044712 Ga0453684_0024323 Ga0453684_0024323_4520_5509 302
46 iso_pu_bacteria 2919704043 2919704771 302
47 3300035086 Ga0373934_0001465 Ga0373934_0001465_3208_4161 303
48 3300035113 Ga0373936_0045393 Ga0373936_0045393_131_1084 303
49 3300035117 Ga0373953_0003693 Ga0373953_0003693_3085_4038 303
50 3300035118 Ga0373954_0000827 Ga0373954_0000827_7237_8190 303
51 3300035120 Ga0373957_0010743 Ga0373957_0010743_180_1133 303
52 3300035172 Ga0373955_0002043 Ga0373955_0002043_7677_8630 303
53 3300035410 Ga0373924_0002332 Ga0373924_0002332_2016_2969 303
54 3300035724 Ga0373933_0008625 Ga0373933_0008625_1484_2437 303
55 3300046459 Ga0495629_0000804 Ga0495629_0000804_18767_19720 303
56 3300046462 Ga0495651_0120569 Ga0495651_0120569_856_1809 303
57 3300046463 Ga0495653_0005997 Ga0495653_0005997_192_1145 303
58 3300046511 Ga0495608_0006206 Ga0495608_0006206_911_1864 303
59 3300046533 Ga0495640_0002381 Ga0495640_0002381_6335_7288 303
60 3300046543 Ga0495645_0008789 Ga0495645_0008789_1827_2780 303
61 3300046642 Ga0495634_0005998 Ga0495634_0005998_3543_4496 303
62 3300046663 Ga0495635_0006293 Ga0495635_0006293_5153_6106 303
63 3300046675 Ga0495657_0033361 Ga0495657_0033361_1721_2674 303
64 3300046678 Ga0495599_0005174 Ga0495599_0005174_6505_7458 303
65 3300046679 Ga0495623_0143097 Ga0495623_0143097_159_1112 303
66 3300046680 Ga0495646_0019943 Ga0495646_0019943_3128_4081 303
67 3300046809 Ga0495600_0015912 Ga0495600_0015912_3709_4662 303
68 3300047317 Ga0495604_0191553 Ga0495604_0191553_35_988 303
69 3300047319 Ga0495674_0012736 Ga0495674_0012736_3373_4326 303
70 3300047444 Ga0495675_0012432 Ga0495675_0012432_4119_5072 303
71 3300047471 Ga0495684_0003719 Ga0495684_0003719_9637_10590 303
72 3300047673 Ga0495593_0003006 Ga0495593_0003006_1615_2568 303
73 3300048088 Ga0495602_0040840 Ga0495602_0040840_1490_2443 303
74 3300053084 Ga0495595_0005672 Ga0495595_0005672_2380_3333 303
75 3300053085 Ga0495619_0002256 Ga0495619_0002256_6620_7573 303
76 iso_pu_bacteria 2503198000 2503200797 303
77 iso_pu_bacteria 2513237090 2513611541 303
78 iso_pu_bacteria 2874123672 2874124431 303
79 3300048917 Ga0496114_0072544 Ga0496114_0072544_367_1344 304
80 3300005344 Ga0070661_100064974 Ga0070661_1000649742 305
81 3300005366 Ga0070659_100387109 Ga0070659_1003871091 305
82 3300005535 Ga0070684_100285110 Ga0070684_1002851101 305
83 3300025919 Ga0207657_10073689 Ga0207657_100736892 305
84 3300025920 Ga0207649_10047380 Ga0207649_100473802 305
85 3300025921 Ga0207652_10263026 Ga0207652_102630262 305
86 3300049593 Ga0501077_0051257 Ga0501077_0051257_1391_2362 305
87 iso_pu_bacteria 2693429783 2694629669 305
88 iso_pu_bacteria 2693429784 2694638123 305
89 3300005354 Ga0070675_100155745 Ga0070675_1001557452 306
90 3300005366 Ga0070659_100206012 Ga0070659_1002060122 306
91 3300005457 Ga0070662_100053447 Ga0070662_1000534472 306
92 3300005547 Ga0070693_100006849 Ga0070693_1000068494 306
93 3300005564 Ga0070664_100105162 Ga0070664_1001051622 306
94 3300009094 Ga0111539_10041364 Ga0111539_100413642 306
95 3300025918 Ga0207662_10136652 Ga0207662_101366521 306
96 3300025923 Ga0207681_10066960 Ga0207681_100669602 306
97 3300025925 Ga0207650_10169706 Ga0207650_101697062 306
98 3300025933 Ga0207706_10004852 Ga0207706_100048522 306
99 3300026142 Ga0207698_10034006 Ga0207698_100340062 306
100 3300027907 Ga0207428_10142246 Ga0207428_101422462 306
101 3300046516 Ga0495628_0026632 Ga0495628_0026632_3716_4684 306
102 3300049823 Ga0501044_0167466 Ga0501044_0167466_303_1268 306
103 3300005327 Ga0070658_10021237 Ga0070658_100212372 307
104 3300005336 Ga0070680_100022626 Ga0070680_1000226263 307
105 3300005365 Ga0070688_100212628 Ga0070688_1002126282 307
106 3300005435 Ga0070714_100083261 Ga0070714_1000832612 307
107 3300005458 Ga0070681_10210676 Ga0070681_102106762 307
108 3300005530 Ga0070679_100044649 Ga0070679_1000446493 307
109 3300005563 Ga0068855_100011862 Ga0068855_1000118628 307
110 3300005563 Ga0068855_100435572 Ga0068855_1004355721 307
111 3300005578 Ga0068854_100021820 Ga0068854_1000218202 307
112 3300005614 Ga0068856_100152949 Ga0068856_1001529492 307
113 3300006042 Ga0075368_10032606 Ga0075368_100326062 307
114 3300006048 Ga0075363_100084100 Ga0075363_1000841001 307
115 3300006175 Ga0070712_100168147 Ga0070712_1001681472 307
116 3300006880 Ga0075429_100439520 Ga0075429_1004395201 307
117 3300009093 Ga0105240_10006964 Ga0105240_100069646 307
118 3300009177 Ga0105248_10251083 Ga0105248_102510832 307
119 3300009551 Ga0105238_10104833 Ga0105238_101048331 307
120 3300013102 Ga0157371_10052607 Ga0157371_100526072 307
121 3300013297 Ga0157378_10081569 Ga0157378_100815692 307
122 3300020082 Ga0206353_10197760 Ga0206353_101977603 307
123 3300025909 Ga0207705_10019884 Ga0207705_100198842 307
124 3300025909 Ga0207705_10159452 Ga0207705_101594522 307
125 3300025912 Ga0207707_10020876 Ga0207707_100208762 307
126 3300025913 Ga0207695_10017211 Ga0207695_100172115 307
127 3300025919 Ga0207657_10048498 Ga0207657_100484982 307
128 3300025921 Ga0207652_10050909 Ga0207652_100509091 307
129 3300025936 Ga0207670_10336819 Ga0207670_103368191 307
130 3300025949 Ga0207667_10075289 Ga0207667_100752892 307
131 3300025949 Ga0207667_10080429 Ga0207667_100804291 307
132 3300025981 Ga0207640_10019304 Ga0207640_100193041 307
133 3300026041 Ga0207639_10177175 Ga0207639_101771752 307
134 3300026067 Ga0207678_10135901 Ga0207678_101359012 307
135 3300026142 Ga0207698_10592257 Ga0207698_105922571 307
136 3300031595 Ga0265313_10013513 Ga0265313_100135132 307
137 3300031712 Ga0265342_10000131 Ga0265342_1000013153 307
138 3300049742 Ga0501080_0351121 Ga0501080_0351121_177_1142 307
139 iso_pu_bacteria 2513237351 2514585977 307
140 iso_pu_bacteria 2643221547 2643758360 307
141 iso_pu_bacteria 2871474448 2871479033 307
142 iso_pu_bacteria 2885312484 2885317240 307
143 iso_pu_bacteria 2958071322 2958077662 307
144 iso_pu_bacteria 8004633249 8004635393 307
145 3300005983 Ga0081540_1004828 Ga0081540_10048282 308
146 3300031727 Ga0316576_10001596 Ga0316576_100015969 308
147 3300032168 Ga0316593_10032136 Ga0316593_100321362 308
148 3300036647 Ga0316582_0137353 Ga0316582_0137353_505_1497 308
149 3300037312 Ga0395899_0098695 Ga0395899_0098695_1080_2048 308
150 3300037418 Ga0395900_0089134 Ga0395900_0089134_532_1500 308
151 3300037418 Ga0395900_0245254 Ga0395900_0245254_293_1261 308
152 3300037466 Ga0395898_0178666 Ga0395898_0178666_866_1834 308
153 3300037588 Ga0316581_0069833 Ga0316581_0069833_61_1053 308
154 3300038443 Ga0395901_0100712 Ga0395901_0100712_1561_2529 308
155 3300049568 Ga0501031_0103129 Ga0501031_0103129_148_1122 308
156 3300049568 Ga0501031_0119679 Ga0501031_0119679_595_1572 308
157 3300049569 Ga0501032_0016333 Ga0501032_0016333_1205_2182 308
158 3300049569 Ga0501032_0067917 Ga0501032_0067917_1077_2051 308
159 3300049570 Ga0501033_0001736 Ga0501033_0001736_4480_5457 308
160 3300049570 Ga0501033_0114275 Ga0501033_0114275_370_1344 308
161 3300049571 Ga0501034_0009628 Ga0501034_0009628_6447_7424 308
162 3300049572 Ga0501036_0001210 Ga0501036_0001210_2766_3740 308
163 3300049572 Ga0501036_0004131 Ga0501036_0004131_4463_5440 308
164 3300049573 Ga0501037_0007192 Ga0501037_0007192_2504_3481 308
165 3300049574 Ga0501038_0001455 Ga0501038_0001455_2682_3656 308
166 3300049574 Ga0501038_0009593 Ga0501038_0009593_6661_7638 308
167 3300049575 Ga0501039_0008624 Ga0501039_0008624_5002_5979 308
168 3300049575 Ga0501039_0030048 Ga0501039_0030048_3064_4038 308
169 3300049575 Ga0501039_0184700 Ga0501039_0184700_133_1107 308
170 3300049578 Ga0501042_0031595 Ga0501042_0031595_812_1786 308
171 3300049579 Ga0501043_0004234 Ga0501043_0004234_7872_8849 308
172 3300049580 Ga0501046_0010801 Ga0501046_0010801_2529_3506 308
173 3300049581 Ga0501047_0004650 Ga0501047_0004650_9687_10664 308
174 3300049582 Ga0501048_0005785 Ga0501048_0005785_938_1912 308
175 3300049582 Ga0501048_0025403 Ga0501048_0025403_2631_3608 308
176 3300049583 Ga0501067_0008054 Ga0501067_0008054_1395_2369 308
177 3300049585 Ga0501069_0000783 Ga0501069_0000783_10237_11214 308
178 3300049585 Ga0501069_0050031 Ga0501069_0050031_1077_2051 308
179 3300049586 Ga0501070_0003205 Ga0501070_0003205_2945_3922 308
180 3300049587 Ga0501071_0009950 Ga0501071_0009950_1179_2153 308
181 3300049587 Ga0501071_0017895 Ga0501071_0017895_1835_2809 308
182 3300049588 Ga0501072_0001804 Ga0501072_0001804_2724_3698 308
183 3300049589 Ga0501073_0012683 Ga0501073_0012683_2716_3693 308
184 3300049590 Ga0501074_0009832 Ga0501074_0009832_2581_3558 308
185 3300049591 Ga0501075_0022341 Ga0501075_0022341_1898_2872 308
186 3300049592 Ga0501076_0000232 Ga0501076_0000232_14331_15305 308
187 3300049593 Ga0501077_0049256 Ga0501077_0049256_223_1197 308
188 3300049741 Ga0501079_0136530 Ga0501079_0136530_804_1778 308
189 3300049742 Ga0501080_0012111 Ga0501080_0012111_2836_3810 308
190 3300049742 Ga0501080_0018937 Ga0501080_0018937_1249_2226 308
191 3300049744 Ga0501083_0006494 Ga0501083_0006494_1077_2054 308
192 3300049822 Ga0501035_0008439 Ga0501035_0008439_2739_3716 308
193 3300049822 Ga0501035_0272149 Ga0501035_0272149_34_1008 308
194 3300049823 Ga0501044_0003639 Ga0501044_0003639_3063_4040 308
195 3300049823 Ga0501044_0057454 Ga0501044_0057454_794_1768 308
196 3300049824 Ga0501045_0022855 Ga0501045_0022855_1684_2658 308
197 3300053153 Ga0500616_0013767 Ga0500616_0013767_3087_4055 308
198 3300054114 Ga0501084_0002949 Ga0501084_0002949_10079_11053 308
199 3300054114 Ga0501084_0017256 Ga0501084_0017256_1036_2013 308
200 3300060353 Ga0501082_0002533 Ga0501082_0002533_9235_10212 308
201 3300060353 Ga0501082_0040028 Ga0501082_0040028_2863_3837 308
202 3300061734 Ga0530510_0000487 Ga0530510_0000487_17259_18233 308
203 3300005578 Ga0068854_100001452 Ga0068854_10000145211 309
204 3300005614 Ga0068856_100000024 Ga0068856_1000000243 309
205 3300006048 Ga0075363_100155731 Ga0075363_1001557312 309
206 3300025981 Ga0207640_10025784 Ga0207640_100257842 309
207 3300026078 Ga0207702_10000805 Ga0207702_1000080523 309
208 3300027614 Ga0209970_1003456 Ga0209970_10034562 309
209 3300031456 Ga0307513_10000012 Ga0307513_1000001224 309
210 3300031595 Ga0265313_10000087 Ga0265313_1000008733 309
211 3300032005 Ga0307411_10272350 Ga0307411_102723501 309
212 3300035115 Ga0373941_0001564 Ga0373941_0001564_1406_2380 309
213 3300049568 Ga0501031_0226938 Ga0501031_0226938_159_1136 309
214 3300049569 Ga0501032_0017695 Ga0501032_0017695_2062_3036 309
215 3300049571 Ga0501034_0000179 Ga0501034_0000179_50482_51456 309
216 3300049571 Ga0501034_0009186 Ga0501034_0009186_3239_4213 309
217 3300049571 Ga0501034_0015149 Ga0501034_0015149_2768_3742 309
218 3300049571 Ga0501034_0088129 Ga0501034_0088129_725_1699 309
219 3300049571 Ga0501034_0356450 Ga0501034_0356450_224_1198 309
220 3300049572 Ga0501036_0002364 Ga0501036_0002364_4097_5071 309
221 3300049572 Ga0501036_0012136 Ga0501036_0012136_743_1717 309
222 3300049572 Ga0501036_0012446 Ga0501036_0012446_963_1937 309
223 3300049573 Ga0501037_0003424 Ga0501037_0003424_5239_6213 309
224 3300049573 Ga0501037_0022670 Ga0501037_0022670_884_1858 309
225 3300049574 Ga0501038_0004755 Ga0501038_0004755_5947_6921 309
226 3300049575 Ga0501039_0005161 Ga0501039_0005161_4904_5878 309
227 3300049579 Ga0501043_0001468 Ga0501043_0001468_17674_18648 309
228 3300049579 Ga0501043_0034549 Ga0501043_0034549_2026_3000 309
229 3300049580 Ga0501046_0013077 Ga0501046_0013077_5914_6888 309
230 3300049580 Ga0501046_0048993 Ga0501046_0048993_1192_2166 309
231 3300049581 Ga0501047_0000179 Ga0501047_0000179_66607_67581 309
232 3300049581 Ga0501047_0085972 Ga0501047_0085972_781_1755 309
233 3300049582 Ga0501048_0000818 Ga0501048_0000818_15918_16892 309
234 3300049582 Ga0501048_0072238 Ga0501048_0072238_446_1420 309
235 3300049584 Ga0501068_0010845 Ga0501068_0010845_3513_4487 309
236 3300049586 Ga0501070_0003263 Ga0501070_0003263_2933_3907 309
237 3300049586 Ga0501070_0007403 Ga0501070_0007403_4290_5264 309
238 3300049588 Ga0501072_0039652 Ga0501072_0039652_881_1855 309
239 3300049589 Ga0501073_0011864 Ga0501073_0011864_642_1616 309
240 3300049589 Ga0501073_0050271 Ga0501073_0050271_988_1962 309
241 3300049590 Ga0501074_0011223 Ga0501074_0011223_2950_3924 309
242 3300049590 Ga0501074_0033159 Ga0501074_0033159_770_1744 309
243 3300049591 Ga0501075_0005615 Ga0501075_0005615_1948_2928 309
244 3300049592 Ga0501076_0005960 Ga0501076_0005960_3919_4899 309
245 3300049593 Ga0501077_0040602 Ga0501077_0040602_385_1365 309
246 3300049741 Ga0501079_0017940 Ga0501079_0017940_2101_3081 309
247 3300049742 Ga0501080_0001165 Ga0501080_0001165_2960_3934 309
248 3300049742 Ga0501080_0003959 Ga0501080_0003959_6223_7197 309
249 3300049742 Ga0501080_0040611 Ga0501080_0040611_1464_2444 309
250 3300049742 Ga0501080_0158096 Ga0501080_0158096_650_1624 309
251 3300049744 Ga0501083_0003061 Ga0501083_0003061_9556_10530 309
252 3300049744 Ga0501083_0233272 Ga0501083_0233272_17_991 309
253 3300049822 Ga0501035_0046251 Ga0501035_0046251_2398_3372 309
254 3300049823 Ga0501044_0005248 Ga0501044_0005248_2958_3932 309
255 3300049823 Ga0501044_0046723 Ga0501044_0046723_642_1616 309
256 3300049823 Ga0501044_0278613 Ga0501044_0278613_262_1236 309
257 3300054114 Ga0501084_0005398 Ga0501084_0005398_9357_10337 309
258 3300060353 Ga0501082_0003464 Ga0501082_0003464_8221_9201 309
259 3300060353 Ga0501082_0095901 Ga0501082_0095901_879_1853 309
260 3300000549 LJQas_1002447 LJQas_10024472 310
261 3300005327 Ga0070658_10028900 Ga0070658_100289002 310
262 3300005329 Ga0070683_100018847 Ga0070683_1000188473 310
263 3300005336 Ga0070680_100028568 Ga0070680_1000285683 310
264 3300005336 Ga0070680_100029149 Ga0070680_1000291492 310
265 3300005336 Ga0070680_100120490 Ga0070680_1001204902 310
266 3300005339 Ga0070660_100014784 Ga0070660_1000147842 310
267 3300005366 Ga0070659_100118746 Ga0070659_1001187462 310
268 3300005458 Ga0070681_10084259 Ga0070681_100842592 310
269 3300005518 Ga0070699_100156603 Ga0070699_1001566032 310
270 3300005530 Ga0070679_100056561 Ga0070679_1000565614 310
271 3300005530 Ga0070679_100107224 Ga0070679_1001072242 310
272 3300005535 Ga0070684_100060818 Ga0070684_1000608182 310
273 3300005539 Ga0068853_100008111 Ga0068853_1000081114 310
274 3300005563 Ga0068855_100025923 Ga0068855_1000259234 310
275 3300005563 Ga0068855_100054267 Ga0068855_1000542673 310
276 3300005577 Ga0068857_100035960 Ga0068857_1000359602 310
277 3300005614 Ga0068856_100065386 Ga0068856_1000653862 310
278 3300005616 Ga0068852_100030159 Ga0068852_1000301592 310
279 3300005844 Ga0068862_100024817 Ga0068862_1000248173 310
280 3300005981 Ga0081538_10008504 Ga0081538_100085042 310
281 3300006038 Ga0075365_10002483 Ga0075365_100024832 310
282 3300006048 Ga0075363_100010017 Ga0075363_1000100172 310
283 3300006051 Ga0075364_10016046 Ga0075364_100160462 310
284 3300006178 Ga0075367_10012833 Ga0075367_100128331 310
285 3300007265 Ga0099794_10029464 Ga0099794_100294642 310
286 3300009093 Ga0105240_10011910 Ga0105240_100119102 310
287 3300009545 Ga0105237_10007023 Ga0105237_100070234 310
288 3300009551 Ga0105238_10036027 Ga0105238_100360272 310
289 3300010375 Ga0105239_10030920 Ga0105239_100309205 310
290 3300013104 Ga0157370_10018194 Ga0157370_100181943 310
291 3300021384 Ga0213876_10009783 Ga0213876_100097833 310
292 3300025261 Ga0209233_1006798 Ga0209233_10067982 310
293 3300025321 Ga0207656_10005116 Ga0207656_100051163 310
294 3300025909 Ga0207705_10009596 Ga0207705_100095963 310
295 3300025912 Ga0207707_10007720 Ga0207707_100077206 310
296 3300025912 Ga0207707_10014256 Ga0207707_100142562 310
297 3300025913 Ga0207695_10036471 Ga0207695_100364714 310
298 3300025914 Ga0207671_10009486 Ga0207671_100094867 310
299 3300025915 Ga0207693_10228140 Ga0207693_102281401 310
300 3300025917 Ga0207660_10008544 Ga0207660_100085445 310
301 3300025917 Ga0207660_10014572 Ga0207660_100145722 310
302 3300025919 Ga0207657_10004221 Ga0207657_100042212 310
303 3300025921 Ga0207652_10012192 Ga0207652_100121923 310
304 3300025932 Ga0207690_10043068 Ga0207690_100430682 310
305 3300025944 Ga0207661_10046153 Ga0207661_100461532 310
306 3300025949 Ga0207667_10012359 Ga0207667_100123596 310
307 3300025949 Ga0207667_10027075 Ga0207667_100270754 310
308 3300025981 Ga0207640_10092314 Ga0207640_100923142 310
309 3300026041 Ga0207639_10038051 Ga0207639_100380513 310
310 3300026078 Ga0207702_10319148 Ga0207702_103191482 310
311 3300026116 Ga0207674_10012738 Ga0207674_100127382 310
312 3300028380 Ga0268265_10013916 Ga0268265_100139165 310
313 3300031548 Ga0307408_100058669 Ga0307408_1000586692 310
314 3300031731 Ga0307405_10002425 Ga0307405_100024254 310
315 3300031852 Ga0307410_10006859 Ga0307410_100068592 310
316 3300031901 Ga0307406_10005349 Ga0307406_100053494 310
317 3300031903 Ga0307407_10004490 Ga0307407_100044903 310
318 3300031995 Ga0307409_100002503 Ga0307409_1000025033 310
319 3300032002 Ga0307416_100009639 Ga0307416_1000096392 310
320 3300032005 Ga0307411_10084155 Ga0307411_100841552 310
321 3300032126 Ga0307415_100003499 Ga0307415_1000034993 310
322 3300035118 Ga0373954_0123131 Ga0373954_0123131_82_1056 310
323 3300035172 Ga0373955_0020483 Ga0373955_0020483_803_1777 310
324 3300036401 Ga0373937_0014183 Ga0373937_0014183_3438_4412 310
325 3300037312 Ga0395899_0220105 Ga0395899_0220105_322_1302 310
326 3300037418 Ga0395900_0031735 Ga0395900_0031735_1317_2315 310
327 3300038443 Ga0395901_0496844 Ga0395901_0496844_156_1136 310
328 3300039110 Ga0400487_58139 Ga0400487_58139_1166_2278 310
329 3300039437 Ga0436365_1849927 Ga0436365_1849927_17839_18816 310
330 3300046809 Ga0495600_0177706 Ga0495600_0177706_53_1033 310
331 3300049571 Ga0501034_0210054 Ga0501034_0210054_141_1115 310
332 3300049583 Ga0501067_0175645 Ga0501067_0175645_28_1005 310
333 3300049585 Ga0501069_0099815 Ga0501069_0099815_527_1504 310
334 3300049585 Ga0501069_0100894 Ga0501069_0100894_274_1251 310
335 3300049586 Ga0501070_0061598 Ga0501070_0061598_1604_2581 310
336 3300049587 Ga0501071_0116511 Ga0501071_0116511_267_1244 310
337 3300049589 Ga0501073_0018071 Ga0501073_0018071_1434_2411 310
338 3300049589 Ga0501073_0062557 Ga0501073_0062557_1409_2386 310
339 3300049744 Ga0501083_0036174 Ga0501083_0036174_2324_3301 310
340 3300049822 Ga0501035_0001465 Ga0501035_0001465_4804_5781 310
341 3300050490 nmdc:mga03n38_31255_c1 nmdc:mga03n38_31255_c1_633_1616 310
342 3300050490 nmdc:mga03n38_33977_c1 nmdc:mga03n38_33977_c1_722_1705 310
343 3300050491 nmdc:mga00v17_17763_c1 nmdc:mga00v17_17763_c1_50_1036 310
344 3300053093 Ga0500651_0001692 Ga0500651_0001692_2447_3436 310
345 3300054114 Ga0501084_0078980 Ga0501084_0078980_1590_2567 310
346 iso_pu_bacteria 2643221621 2644121060 310
347 iso_pu_bacteria 2857537821 2857539638 310
348 iso_pu_bacteria 8002392321 8002392535 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16868

NMT1_3

NMT1-like family

54

342

0.98

PF09084

NMT1

NMT1/THI5 like

79

233

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.7867 28 310
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.7741 28 310
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.7458 28 310
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.7406 28 310
7d3b-assembly1.cif.gz_A flavone reductase 0.7154 29 68
ID Description Score Start End Superfamily
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9332 106 243 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9242 106 243 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9205 106 243 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9117 106 243 3.40.190.10
af_Q54B10_47_225_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8544 29 69 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A528CWL3-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9381 100 184
AF-X1W1P1-F1-model_v4 Uncharacterized protein 0.925 104 244
AF-A0A0M9E212-F1-model_v4 TRAP transporter solute receptor, TAXI family 0.9063 26 310
AF-A0A840WRM5-F1-model_v4 Uncharacterized protein 0.9008 16 307
AF-A0A1V0PSZ8-F1-model_v4 TRAP transporter solute receptor, TAXI family 0.8886 28 308

Feature Viewer

pLDDT pTM Quality
86.5 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map