F417565

General Info

Members Datasets Scaffolds Average Seq Length
348 158 696 142

Family's Representative Sequence

Representative Sequence 3300025945|Ga0207679_11707418|Ga0207679_117074181
Length 167
Sequence MAGDPTGPGEAGSGQEPVEGLPPGAKNHGSTSTDAAPAPVGAYPHARRVGDLLFLSGIGPRTSGSNTIPGNVLDAGGTLIGHDIAAQTRQVFANVRAVLDASGARWEDLVDVTVFLTDMAGDFKAYNAVWAEYFPDPAAAPCRTTLGITALPTPIAIELKCVARVDR

Samples

Sample ID Description Type Environment
1 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
41 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
42 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
43 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
96 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
99 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
105 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
123 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
146 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
147 2643221559 Lysobacter sp. Root559 Isolate Unclassified
148 2643221573 Lysobacter sp. Root604 Isolate Unclassified
149 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
150 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
151 2643221586 Lysobacter sp. Root667 Isolate Unclassified
152 2643221593 Lysobacter sp. Root690 Isolate Unclassified
153 2643221612 Lysobacter sp. Root76 Isolate Unclassified
154 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
155 2643221720 Lysobacter sp. Root916 Isolate Unclassified
156 2643221727 Lysobacter sp. Root96 Isolate Unclassified
157 2643221728 Lysobacter sp. Root983 Isolate Unclassified
158 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 4.6
Isolates 4.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 1.44
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207679_11707418 3300025945 Bacteria 576
2 SwRhRL2b_contig_891988 2162886007 Bacteria 3796
3 JGI24736J21556_1001015 3300001904 Bacteria 5132
4 JGI24741J21665_1000570 3300001915 Bacteria 11239
5 JGI24741J21665_1003164 3300001915 Bacteria 4025
6 JGI24741J21665_1003530 3300001915 Bacteria 3704
7 JGI24741J21665_1004713 3300001915 Bacteria 2967
8 JGI24740J21852_10000938 3300001979 Bacteria 12972
9 JGI24740J21852_10004086 3300001979 Bacteria 6316
10 JGI24740J21852_10148532 3300001979 Bacteria 582
11 Ga0065704_10071057 3300005289 Bacteria 13463
12 Ga0070658_10041762 3300005327 Bacteria 3700
13 Ga0070658_10090414 3300005327 Bacteria 2522
14 Ga0070683_100009011 3300005329 Bacteria 8512
15 Ga0070683_100586451 3300005329 Bacteria 1066
16 Ga0070683_100838591 3300005329 Bacteria 881
17 Ga0068869_100467276 3300005334 Bacteria 1048
18 Ga0070680_100003066 3300005336 Bacteria 12394
19 Ga0070680_100011426 3300005336 Bacteria 6869
20 Ga0070680_100017417 3300005336 Bacteria 5666
21 Ga0070680_100031568 3300005336 Bacteria 4260
22 Ga0070680_100092238 3300005336 Bacteria 2508
23 Ga0070680_100367758 3300005336 Bacteria 1223
24 Ga0070682_100010027 3300005337 Bacteria 5367
25 Ga0070682_100138157 3300005337 Bacteria 1658
26 Ga0070682_100159947 3300005337 Bacteria 1554
27 Ga0070660_100011695 3300005339 Bacteria 6249
28 Ga0070660_100104012 3300005339 Bacteria 2252
29 Ga0070660_101202775 3300005339 Bacteria 642
30 Ga0070691_10004881 3300005341 Bacteria 6104
31 Ga0070691_10006277 3300005341 Bacteria 5431
32 Ga0070691_10007239 3300005341 Bacteria 5078
33 Ga0070691_10296766 3300005341 Bacteria 881
34 Ga0070661_100003463 3300005344 Bacteria 10887
35 Ga0070661_100011761 3300005344 Bacteria 6107
36 Ga0070661_100045593 3300005344 Bacteria 3205
37 Ga0070692_10001144 3300005345 Bacteria 9317
38 Ga0070692_10018678 3300005345 Bacteria 3337
39 Ga0070692_10020734 3300005345 Bacteria 3189
40 Ga0070692_10039297 3300005345 Bacteria 2415
41 Ga0070692_10496779 3300005345 Bacteria 790
42 Ga0070659_100049906 3300005366 Bacteria 3291
43 Ga0070659_100222743 3300005366 Bacteria 1557
44 Ga0070663_100042385 3300005455 Bacteria 3198
45 Ga0070663_100204893 3300005455 Bacteria 1541
46 Ga0070663_101073510 3300005455 Bacteria 703
47 Ga0070662_100039975 3300005457 Bacteria 3338
48 Ga0070681_10000012 3300005458 Bacteria 137191
49 Ga0070681_10005350 3300005458 Bacteria 12394
50 Ga0070681_10037113 3300005458 Bacteria 4891
51 Ga0070681_10111732 3300005458 Bacteria 2671
52 Ga0070681_10115633 3300005458 Bacteria 2620
53 Ga0070679_100004875 3300005530 Bacteria 12384
54 Ga0070679_100034277 3300005530 Bacteria 5031
55 Ga0070679_100061260 3300005530 Bacteria 3750
56 Ga0070679_100126011 3300005530 Bacteria 2543
57 Ga0070679_100563192 3300005530 Bacteria 1083
58 Ga0070679_100717191 3300005530 Bacteria 943
59 Ga0070679_101058834 3300005530 Bacteria 755
60 Ga0070684_100005534 3300005535 Bacteria 9692
61 Ga0070684_100008874 3300005535 Bacteria 7885
62 Ga0070684_100106483 3300005535 Bacteria 2510
63 Ga0068853_100008143 3300005539 Bacteria 8414
64 Ga0068853_100028520 3300005539 Bacteria 4696
65 Ga0070672_100064295 3300005543 Bacteria 2899
66 Ga0070696_100024100 3300005546 Bacteria 4136
67 Ga0070696_100028412 3300005546 Bacteria 3817
68 Ga0070696_100046354 3300005546 Bacteria 3014
69 Ga0070696_100138701 3300005546 Bacteria 1775
70 Ga0070696_101356228 3300005546 Bacteria 605
71 Ga0070693_100021154 3300005547 Bacteria 3444
72 Ga0070693_100135441 3300005547 Bacteria 1545
73 Ga0070665_100274683 3300005548 Bacteria 1687
74 Ga0068855_100054336 3300005563 Bacteria 4707
75 Ga0068855_100621871 3300005563 Bacteria 1163
76 Ga0070664_100016982 3300005564 Bacteria 5973
77 Ga0070664_100067424 3300005564 Bacteria 3058
78 Ga0068857_100014316 3300005577 Bacteria 6913
79 Ga0068857_100030408 3300005577 Bacteria 4768
80 Ga0068857_100627831 3300005577 Bacteria 1017
81 Ga0068857_101016135 3300005577 Bacteria 798
82 Ga0068854_100000979 3300005578 Bacteria 17194
83 Ga0068854_100004698 3300005578 Bacteria 8608
84 Ga0068854_100016718 3300005578 Bacteria 4895
85 Ga0068854_100203565 3300005578 Bacteria 1557
86 Ga0068856_100054921 3300005614 Bacteria 3930
87 Ga0068856_100080511 3300005614 Bacteria 3230
88 Ga0068856_100080670 3300005614 Bacteria 3227
89 Ga0068852_100002405 3300005616 Bacteria 12900
90 Ga0068852_100003594 3300005616 Bacteria 10853
91 Ga0068852_100003816 3300005616 Bacteria 10580
92 Ga0068852_100009112 3300005616 Bacteria 7348
93 Ga0068851_10002836 3300005834 Bacteria 7645
94 Ga0068851_10111928 3300005834 Bacteria 1458
95 Ga0097621_100053409 3300006237 Bacteria 3294
96 Ga0105240_10042869 3300009093 Bacteria 5764
97 Ga0105240_10097889 3300009093 Bacteria 3574
98 Ga0105240_10105131 3300009093 Bacteria 3427
99 Ga0105240_10152190 3300009093 Bacteria 2754
100 Ga0105240_10586538 3300009093 Bacteria 1229
101 Ga0105240_10698729 3300009093 Bacteria 1107
102 Ga0105241_10120254 3300009174 Bacteria 2114
103 Ga0105241_10303398 3300009174 Bacteria 1371
104 Ga0105237_10311236 3300009545 Bacteria 1578
105 Ga0105237_10458985 3300009545 Bacteria 1280
106 Ga0105237_10527949 3300009545 Bacteria 1187
107 Ga0105238_10000936 3300009551 Bacteria 29916
108 Ga0105249_10002363 3300009553 Bacteria 16380
109 Ga0105028_101289 3300009993 Bacteria 2640
110 Ga0157317_1022331 3300012475 Bacteria 571
111 Ga0157328_1028252 3300012478 Bacteria 516
112 Ga0157318_1007264 3300012482 Bacteria 751
113 Ga0157373_10008843 3300013100 Bacteria 7456
114 Ga0157373_10100378 3300013100 Bacteria 2037
115 Ga0157373_10129282 3300013100 Bacteria 1776
116 Ga0157373_11080458 3300013100 Bacteria 601
117 Ga0157371_10008388 3300013102 Bacteria 8238
118 Ga0157371_10031057 3300013102 Bacteria 3849
119 Ga0157371_10559129 3300013102 Bacteria 848
120 Ga0157370_10001384 3300013104 Bacteria 30011
121 Ga0157370_10173423 3300013104 Bacteria 2004
122 Ga0157370_10243244 3300013104 Bacteria 1665
123 Ga0157370_10261742 3300013104 Bacteria 1598
124 Ga0157370_11597311 3300013104 Bacteria 586
125 Ga0157369_10009147 3300013105 Bacteria 11334
126 Ga0157369_10039850 3300013105 Bacteria 5133
127 Ga0157369_10060849 3300013105 Bacteria 4072
128 Ga0157369_10124825 3300013105 Bacteria 2730
129 Ga0157372_10006725 3300013307 Bacteria 12226
130 Ga0157372_10011234 3300013307 Bacteria 9525
131 Ga0157372_10165957 3300013307 Bacteria 2553
132 Ga0182008_10011603 3300014497 Bacteria 4679
133 Ga0197907_10679015 3300020069 Bacteria 4935
134 Ga0197907_11315571 3300020069 Bacteria 691
135 Ga0206356_10366407 3300020070 Bacteria 2082
136 Ga0206356_11185377 3300020070 Bacteria 6401
137 Ga0206351_10842093 3300020077 Bacteria 1708
138 Ga0206352_11045181 3300020078 Bacteria 2572
139 Ga0206350_10433200 3300020080 Bacteria 4873
140 Ga0206354_10075386 3300020081 Bacteria 746
141 Ga0206354_10554201 3300020081 Bacteria 2120
142 Ga0206354_10665683 3300020081 Bacteria 614
143 Ga0206354_11370099 3300020081 Bacteria 660
144 Ga0206353_10069988 3300020082 Bacteria 1350
145 Ga0206353_10673398 3300020082 Bacteria 2119
146 Ga0206353_11539502 3300020082 Bacteria 5306
147 Ga0206353_11804626 3300020082 Bacteria 1704
148 Ga0154015_1130737 3300020610 Bacteria 11491
149 Ga0209676_1005140 3300025292 Bacteria 6962
150 Ga0209256_1001644 3300025299 Bacteria 21742
151 Ga0209257_1006360 3300025304 Bacteria 7662
152 Ga0207656_10044132 3300025321 Bacteria 1903
153 Ga0207656_10100984 3300025321 Bacteria 1323
154 Ga0207647_10000357 3300025904 Bacteria 37133
155 Ga0207647_10001972 3300025904 Bacteria 15672
156 Ga0207705_10000083 3300025909 Bacteria 117366
157 Ga0207705_10001988 3300025909 Bacteria 15889
158 Ga0207705_10003268 3300025909 Bacteria 12338
159 Ga0207705_10005839 3300025909 Bacteria 9166
160 Ga0207705_10006273 3300025909 Bacteria 8832
161 Ga0207705_10066012 3300025909 Bacteria 2617
162 Ga0207654_10120601 3300025911 Bacteria 1646
163 Ga0207654_10247990 3300025911 Bacteria 1192
164 Ga0207707_10000182 3300025912 Bacteria 65800
165 Ga0207707_10000867 3300025912 Bacteria 29561
166 Ga0207707_10000948 3300025912 Bacteria 27952
167 Ga0207707_10013348 3300025912 Bacteria 7159
168 Ga0207707_10026157 3300025912 Bacteria 5102
169 Ga0207707_10046624 3300025912 Bacteria 3775
170 Ga0207707_10507394 3300025912 Bacteria 1028
171 Ga0207695_10001956 3300025913 Bacteria 31955
172 Ga0207695_10006170 3300025913 Bacteria 15629
173 Ga0207695_10006275 3300025913 Bacteria 15476
174 Ga0207695_10023159 3300025913 Bacteria 7027
175 Ga0207695_10028014 3300025913 Bacteria 6259
176 Ga0207695_10269759 3300025913 Bacteria 1597
177 Ga0207695_10319808 3300025913 Bacteria 1441
178 Ga0207660_10000061 3300025917 Bacteria 56597
179 Ga0207660_10001165 3300025917 Bacteria 17576
180 Ga0207660_10001379 3300025917 Bacteria 16293
181 Ga0207660_10001949 3300025917 Bacteria 13777
182 Ga0207660_10008099 3300025917 Bacteria 6799
183 Ga0207657_10001948 3300025919 Bacteria 22285
184 Ga0207657_10008687 3300025919 Bacteria 10283
185 Ga0207657_10017090 3300025919 Bacteria 6975
186 Ga0207657_10019560 3300025919 Bacteria 6425
187 Ga0207649_10000615 3300025920 Bacteria 24085
188 Ga0207649_10001854 3300025920 Bacteria 12080
189 Ga0207649_10019184 3300025920 Bacteria 3905
190 Ga0207649_10298559 3300025920 Bacteria 1177
191 Ga0207652_10000161 3300025921 Bacteria 72715
192 Ga0207652_10001174 3300025921 Bacteria 23555
193 Ga0207652_10001507 3300025921 Bacteria 20552
194 Ga0207652_10001756 3300025921 Bacteria 18928
195 Ga0207652_10002315 3300025921 Bacteria 16140
196 Ga0207652_10007038 3300025921 Bacteria 9065
197 Ga0207652_10169590 3300025921 Bacteria 1958
198 Ga0207652_10536641 3300025921 Bacteria 1052
199 Ga0207694_10004429 3300025924 Bacteria 10979
200 Ga0207690_10000418 3300025932 Bacteria 27675
201 Ga0207690_10009803 3300025932 Bacteria 5691
202 Ga0207690_10033938 3300025932 Bacteria 3284
203 Ga0207690_10503114 3300025932 Bacteria 980
204 Ga0207706_10038278 3300025933 Bacteria 4255
205 Ga0207691_10016364 3300025940 Bacteria 7040
206 Ga0207689_10536959 3300025942 Bacteria 982
207 Ga0207661_10005029 3300025944 Bacteria 9271
208 Ga0207661_10005287 3300025944 Bacteria 9086
209 Ga0207679_10028057 3300025945 Bacteria 3901
210 Ga0207679_11096196 3300025945 Bacteria 730
211 Ga0207667_10000186 3300025949 Bacteria 90817
212 Ga0207667_10000316 3300025949 Bacteria 67194
213 Ga0207667_10001225 3300025949 Bacteria 32182
214 Ga0207667_10006428 3300025949 Bacteria 14236
215 Ga0207667_10008974 3300025949 Bacteria 11828
216 Ga0207667_10100894 3300025949 Bacteria 2977
217 Ga0207712_10000677 3300025961 Bacteria 26367
218 Ga0207640_10000378 3300025981 Bacteria 28715
219 Ga0207640_10000881 3300025981 Bacteria 17009
220 Ga0207640_10029839 3300025981 Bacteria 3352
221 Ga0207640_10088007 3300025981 Bacteria 2143
222 Ga0207639_10001028 3300026041 Bacteria 18964
223 Ga0207639_10003551 3300026041 Bacteria 10477
224 Ga0207639_10013891 3300026041 Bacteria 5648
225 Ga0207678_10002209 3300026067 Bacteria 17581
226 Ga0207678_10008911 3300026067 Bacteria 8832
227 Ga0207678_10008941 3300026067 Bacteria 8819
228 Ga0207702_10002852 3300026078 Bacteria 16166
229 Ga0207702_10076930 3300026078 Bacteria 2885
230 Ga0207702_10783353 3300026078 Bacteria 942
231 Ga0207674_10002462 3300026116 Bacteria 23372
232 Ga0207674_10005859 3300026116 Bacteria 14565
233 Ga0207674_10026434 3300026116 Bacteria 6163
234 Ga0207674_12293232 3300026116 Bacteria 502
235 Ga0207698_10001280 3300026142 Bacteria 14672
236 Ga0207698_10002790 3300026142 Bacteria 10427
237 Ga0207698_10005302 3300026142 Bacteria 7942
238 Ga0207698_10008893 3300026142 Bacteria 6367
239 Ga0307408_101667790 3300031548 Bacteria 607
240 Ga0307516_10592963 3300031730 Bacteria 762
241 Ga0307416_102713175 3300032002 Bacteria 592
242 Ga0307414_10880169 3300032004 Bacteria 820
243 Ga0395899_0007474 3300037312 Bacteria 8439
244 Ga0395899_0155484 3300037312 Bacteria 1618
245 Ga0395900_0000059 3300037418 Bacteria 205996
246 Ga0395900_0001328 3300037418 Bacteria 29941
247 Ga0395900_0410525 3300037418 Bacteria 1316
248 Ga0395898_0011286 3300037466 Bacteria 9292
249 Ga0395898_0127361 3300037466 Bacteria 2439
250 Ga0395901_0087599 3300038443 Bacteria 3255
251 Ga0395901_0924734 3300038443 Bacteria 852
252 Ga0237816_00667 3300039145 Bacteria 2892
253 Ga0436365_1313714 3300039437 Bacteria 585
254 Ga0439465_0011686 3300041413 Bacteria 2754
255 Ga0451787_104110 3300041441 Bacteria 1040
256 Ga0451791_1300966 3300041451 Bacteria 776
257 Ga0451797_0729763 3300041453 Bacteria 835
258 Ga0451798_0830356 3300041458 Bacteria 653
259 Ga0451807_2471531 3300041486 Bacteria 620
260 Ga0451837_1006580 3300041494 Bacteria 3664
261 Ga0451837_1800117 3300041494 Bacteria 1235
262 Ga0451843_0934667 3300041509 Bacteria 1079
263 Ga0451843_1634350 3300041509 Bacteria 3214
264 Ga0439449_0004776 3300042007 Bacteria 5230
265 Ga0439449_0318628 3300042007 Bacteria 587
266 Ga0439462_0084529 3300042015 Bacteria 868
267 Ga0450909_024017 3300042185 Bacteria 915
268 Ga0451577_0109085 3300042876 Bacteria 2475
269 Ga0466969_0034627 3300044656 Bacteria 2558
270 Ga0466982_0000003 3300044672 Bacteria 417243
271 Ga0453683_0109241 3300044673 Bacteria 1739
272 Ga0466965_0109044 3300044683 Bacteria 1421
273 Ga0466966_0024968 3300044684 Bacteria 3907
274 Ga0466963_0376092 3300044694 Bacteria 1001
275 Ga0466963_0496451 3300044694 Bacteria 862
276 Ga0466971_0004246 3300044719 Bacteria 6177
277 Ga0466971_0006337 3300044719 Bacteria 5136
278 Ga0466971_0085738 3300044719 Bacteria 1439
279 Ga0466968_0002993 3300044735 Bacteria 6242
280 Ga0466970_0004595 3300044765 Bacteria 6810
281 Ga0466957_0067011 3300044842 Bacteria 2214
282 Ga0466960_0001653 3300044901 Bacteria 8164
283 Ga0466958_0056859 3300045836 Bacteria 2377
284 Ga0466958_0133177 3300045836 Bacteria 1562
285 Ga0466958_0182376 3300045836 Bacteria 1332
286 Ga0495638_0104326 3300046460 Bacteria 1691
287 Ga0495654_0098591 3300046530 Bacteria 1348
288 Ga0496117_0024279 3300048920 Bacteria 4800
289 Ga0496117_0073090 3300048920 Bacteria 2289
290 Ga0496118_0001608 3300048921 Bacteria 33395
291 Ga0496118_0004394 3300048921 Bacteria 16754
292 Ga0501290_001995 3300049513 Bacteria 2684
293 Ga0501033_0128932 3300049570 Bacteria 1833
294 Ga0501034_0970696 3300049571 Bacteria 735
295 Ga0501037_0442911 3300049573 Bacteria 887
296 Ga0501038_0044113 3300049574 Bacteria 3876
297 Ga0501043_0292409 3300049579 Bacteria 1247
298 Ga0501047_0014623 3300049581 Bacteria 7468
299 Ga0501047_0133155 3300049581 Bacteria 2366
300 Ga0501067_0583384 3300049583 Bacteria 627
301 Ga0501069_0001393 3300049585 Bacteria 11866
302 Ga0501069_0011229 3300049585 Bacteria 4751
303 Ga0501069_0068484 3300049585 Bacteria 1986
304 Ga0501069_0086080 3300049585 Bacteria 1774
305 Ga0501070_0000126 3300049586 Bacteria 68255
306 Ga0501070_0005889 3300049586 Bacteria 10456
307 Ga0501070_0015496 3300049586 Bacteria 6412
308 Ga0501070_0029148 3300049586 Bacteria 4629
309 Ga0501070_0071981 3300049586 Bacteria 2862
310 Ga0501070_0504737 3300049586 Bacteria 971
311 Ga0501073_0021448 3300049589 Bacteria 4658
312 Ga0501073_0092384 3300049589 Bacteria 2103
313 Ga0501074_0001263 3300049590 Bacteria 16709
314 Ga0501074_0005263 3300049590 Bacteria 9310
315 Ga0501079_0073027 3300049741 Bacteria 2652
316 Ga0501079_0900105 3300049741 Bacteria 697
317 Ga0501080_0002772 3300049742 Bacteria 15398
318 Ga0501080_0106647 3300049742 Bacteria 2596
319 Ga0501080_0482420 3300049742 Bacteria 1109
320 Ga0501080_0947702 3300049742 Bacteria 748
321 Ga0501083_1109405 3300049744 Bacteria 515
322 Ga0501275_000128 3300049772 Bacteria 8356
323 Ga0501035_0002607 3300049822 Bacteria 17610
324 Ga0501035_0017465 3300049822 Bacteria 6618
325 Ga0501035_0021761 3300049822 Bacteria 5894
326 Ga0501044_0032068 3300049823 Bacteria 5524
327 Ga0501044_0067048 3300049823 Bacteria 3657
328 Ga0501044_0288884 3300049823 Bacteria 1572
329 Ga0501044_0945645 3300049823 Bacteria 735
330 Ga0501045_0806488 3300049824 Bacteria 691
331 Ga0500651_0000413 3300053093 Bacteria 23063
332 Ga0501084_0417018 3300054114 Bacteria 1135
333 Ga0466962_0001855 3300061719 Bacteria 9935
334 Ga0466962_0010490 3300061719 Bacteria 4455
335 2525556786 2524614729 Bacteria 3091755
336 2630648382 2627854209 Bacteria 3093011
337 2643817689 2643221559 Bacteria 4424915
338 2643878913 2643221573 Bacteria 4784121
339 2643896803 2643221577 Bacteria 3710843
340 2643915968 2643221581 Bacteria 3893603
341 2643940400 2643221586 Bacteria 4446529
342 2643976709 2643221593 Bacteria 6296053
343 2644079474 2643221612 Bacteria 4361984
344 2644479008 2643221685 Bacteria 3673288
345 2644660229 2643221720 Bacteria 4694283
346 2644694916 2643221727 Bacteria 4415595
347 2644697531 2643221728 Bacteria 4797149
348 8003016093 8003014200 Bacteria 4059994
349 Ga0207679_11707418
350 SwRhRL2b_contig_891988
351 JGI24736J21556_1001015
352 JGI24741J21665_1000570
353 JGI24741J21665_1003164
354 JGI24741J21665_1003530
355 JGI24741J21665_1004713
356 JGI24740J21852_10000938
357 JGI24740J21852_10004086
358 JGI24740J21852_10148532
359 Ga0065704_10071057
360 Ga0070658_10041762
361 Ga0070658_10090414
362 Ga0070683_100009011
363 Ga0070683_100586451
364 Ga0070683_100838591
365 Ga0068869_100467276
366 Ga0070680_100003066
367 Ga0070680_100011426
368 Ga0070680_100017417
369 Ga0070680_100031568
370 Ga0070680_100092238
371 Ga0070680_100367758
372 Ga0070682_100010027
373 Ga0070682_100138157
374 Ga0070682_100159947
375 Ga0070660_100011695
376 Ga0070660_100104012
377 Ga0070660_101202775
378 Ga0070691_10004881
379 Ga0070691_10006277
380 Ga0070691_10007239
381 Ga0070691_10296766
382 Ga0070661_100003463
383 Ga0070661_100011761
384 Ga0070661_100045593
385 Ga0070692_10001144
386 Ga0070692_10018678
387 Ga0070692_10020734
388 Ga0070692_10039297
389 Ga0070692_10496779
390 Ga0070659_100049906
391 Ga0070659_100222743
392 Ga0070663_100042385
393 Ga0070663_100204893
394 Ga0070663_101073510
395 Ga0070662_100039975
396 Ga0070681_10000012
397 Ga0070681_10005350
398 Ga0070681_10037113
399 Ga0070681_10111732
400 Ga0070681_10115633
401 Ga0070679_100004875
402 Ga0070679_100034277
403 Ga0070679_100061260
404 Ga0070679_100126011
405 Ga0070679_100563192
406 Ga0070679_100717191
407 Ga0070679_101058834
408 Ga0070684_100005534
409 Ga0070684_100008874
410 Ga0070684_100106483
411 Ga0068853_100008143
412 Ga0068853_100028520
413 Ga0070672_100064295
414 Ga0070696_100024100
415 Ga0070696_100028412
416 Ga0070696_100046354
417 Ga0070696_100138701
418 Ga0070696_101356228
419 Ga0070693_100021154
420 Ga0070693_100135441
421 Ga0070665_100274683
422 Ga0068855_100054336
423 Ga0068855_100621871
424 Ga0070664_100016982
425 Ga0070664_100067424
426 Ga0068857_100014316
427 Ga0068857_100030408
428 Ga0068857_100627831
429 Ga0068857_101016135
430 Ga0068854_100000979
431 Ga0068854_100004698
432 Ga0068854_100016718
433 Ga0068854_100203565
434 Ga0068856_100054921
435 Ga0068856_100080511
436 Ga0068856_100080670
437 Ga0068852_100002405
438 Ga0068852_100003594
439 Ga0068852_100003816
440 Ga0068852_100009112
441 Ga0068851_10002836
442 Ga0068851_10111928
443 Ga0097621_100053409
444 Ga0105240_10042869
445 Ga0105240_10097889
446 Ga0105240_10105131
447 Ga0105240_10152190
448 Ga0105240_10586538
449 Ga0105240_10698729
450 Ga0105241_10120254
451 Ga0105241_10303398
452 Ga0105237_10311236
453 Ga0105237_10458985
454 Ga0105237_10527949
455 Ga0105238_10000936
456 Ga0105249_10002363
457 Ga0105028_101289
458 Ga0157317_1022331
459 Ga0157328_1028252
460 Ga0157318_1007264
461 Ga0157373_10008843
462 Ga0157373_10100378
463 Ga0157373_10129282
464 Ga0157373_11080458
465 Ga0157371_10008388
466 Ga0157371_10031057
467 Ga0157371_10559129
468 Ga0157370_10001384
469 Ga0157370_10173423
470 Ga0157370_10243244
471 Ga0157370_10261742
472 Ga0157370_11597311
473 Ga0157369_10009147
474 Ga0157369_10039850
475 Ga0157369_10060849
476 Ga0157369_10124825
477 Ga0157372_10006725
478 Ga0157372_10011234
479 Ga0157372_10165957
480 Ga0182008_10011603
481 Ga0197907_10679015
482 Ga0197907_11315571
483 Ga0206356_10366407
484 Ga0206356_11185377
485 Ga0206351_10842093
486 Ga0206352_11045181
487 Ga0206350_10433200
488 Ga0206354_10075386
489 Ga0206354_10554201
490 Ga0206354_10665683
491 Ga0206354_11370099
492 Ga0206353_10069988
493 Ga0206353_10673398
494 Ga0206353_11539502
495 Ga0206353_11804626
496 Ga0154015_1130737
497 Ga0209676_1005140
498 Ga0209256_1001644
499 Ga0209257_1006360
500 Ga0207656_10044132
501 Ga0207656_10100984
502 Ga0207647_10000357
503 Ga0207647_10001972
504 Ga0207705_10000083
505 Ga0207705_10001988
506 Ga0207705_10003268
507 Ga0207705_10005839
508 Ga0207705_10006273
509 Ga0207705_10066012
510 Ga0207654_10120601
511 Ga0207654_10247990
512 Ga0207707_10000182
513 Ga0207707_10000867
514 Ga0207707_10000948
515 Ga0207707_10013348
516 Ga0207707_10026157
517 Ga0207707_10046624
518 Ga0207707_10507394
519 Ga0207695_10001956
520 Ga0207695_10006170
521 Ga0207695_10006275
522 Ga0207695_10023159
523 Ga0207695_10028014
524 Ga0207695_10269759
525 Ga0207695_10319808
526 Ga0207660_10000061
527 Ga0207660_10001165
528 Ga0207660_10001379
529 Ga0207660_10001949
530 Ga0207660_10008099
531 Ga0207657_10001948
532 Ga0207657_10008687
533 Ga0207657_10017090
534 Ga0207657_10019560
535 Ga0207649_10000615
536 Ga0207649_10001854
537 Ga0207649_10019184
538 Ga0207649_10298559
539 Ga0207652_10000161
540 Ga0207652_10001174
541 Ga0207652_10001507
542 Ga0207652_10001756
543 Ga0207652_10002315
544 Ga0207652_10007038
545 Ga0207652_10169590
546 Ga0207652_10536641
547 Ga0207694_10004429
548 Ga0207690_10000418
549 Ga0207690_10009803
550 Ga0207690_10033938
551 Ga0207690_10503114
552 Ga0207706_10038278
553 Ga0207691_10016364
554 Ga0207689_10536959
555 Ga0207661_10005029
556 Ga0207661_10005287
557 Ga0207679_10028057
558 Ga0207679_11096196
559 Ga0207667_10000186
560 Ga0207667_10000316
561 Ga0207667_10001225
562 Ga0207667_10006428
563 Ga0207667_10008974
564 Ga0207667_10100894
565 Ga0207712_10000677
566 Ga0207640_10000378
567 Ga0207640_10000881
568 Ga0207640_10029839
569 Ga0207640_10088007
570 Ga0207639_10001028
571 Ga0207639_10003551
572 Ga0207639_10013891
573 Ga0207678_10002209
574 Ga0207678_10008911
575 Ga0207678_10008941
576 Ga0207702_10002852
577 Ga0207702_10076930
578 Ga0207702_10783353
579 Ga0207674_10002462
580 Ga0207674_10005859
581 Ga0207674_10026434
582 Ga0207674_12293232
583 Ga0207698_10001280
584 Ga0207698_10002790
585 Ga0207698_10005302
586 Ga0207698_10008893
587 Ga0307408_101667790
588 Ga0307516_10592963
589 Ga0307416_102713175
590 Ga0307414_10880169
591 Ga0395899_0007474
592 Ga0395899_0155484
593 Ga0395900_0000059
594 Ga0395900_0001328
595 Ga0395900_0410525
596 Ga0395898_0011286
597 Ga0395898_0127361
598 Ga0395901_0087599
599 Ga0395901_0924734
600 Ga0237816_00667
601 Ga0436365_1313714
602 Ga0439465_0011686
603 Ga0451787_104110
604 Ga0451791_1300966
605 Ga0451797_0729763
606 Ga0451798_0830356
607 Ga0451807_2471531
608 Ga0451837_1006580
609 Ga0451837_1800117
610 Ga0451843_0934667
611 Ga0451843_1634350
612 Ga0439449_0004776
613 Ga0439449_0318628
614 Ga0439462_0084529
615 Ga0450909_024017
616 Ga0451577_0109085
617 Ga0466969_0034627
618 Ga0466982_0000003
619 Ga0453683_0109241
620 Ga0466965_0109044
621 Ga0466966_0024968
622 Ga0466963_0376092
623 Ga0466963_0496451
624 Ga0466971_0004246
625 Ga0466971_0006337
626 Ga0466971_0085738
627 Ga0466968_0002993
628 Ga0466970_0004595
629 Ga0466957_0067011
630 Ga0466960_0001653
631 Ga0466958_0056859
632 Ga0466958_0133177
633 Ga0466958_0182376
634 Ga0495638_0104326
635 Ga0495654_0098591
636 Ga0496117_0024279
637 Ga0496117_0073090
638 Ga0496118_0001608
639 Ga0496118_0004394
640 Ga0501290_001995
641 Ga0501033_0128932
642 Ga0501034_0970696
643 Ga0501037_0442911
644 Ga0501038_0044113
645 Ga0501043_0292409
646 Ga0501047_0014623
647 Ga0501047_0133155
648 Ga0501067_0583384
649 Ga0501069_0001393
650 Ga0501069_0011229
651 Ga0501069_0068484
652 Ga0501069_0086080
653 Ga0501070_0000126
654 Ga0501070_0005889
655 Ga0501070_0015496
656 Ga0501070_0029148
657 Ga0501070_0071981
658 Ga0501070_0504737
659 Ga0501073_0021448
660 Ga0501073_0092384
661 Ga0501074_0001263
662 Ga0501074_0005263
663 Ga0501079_0073027
664 Ga0501079_0900105
665 Ga0501080_0002772
666 Ga0501080_0106647
667 Ga0501080_0482420
668 Ga0501080_0947702
669 Ga0501083_1109405
670 Ga0501275_000128
671 Ga0501035_0002607
672 Ga0501035_0017465
673 Ga0501035_0021761
674 Ga0501044_0032068
675 Ga0501044_0067048
676 Ga0501044_0288884
677 Ga0501044_0945645
678 Ga0501045_0806488
679 Ga0500651_0000413
680 Ga0501084_0417018
681 Ga0466962_0001855
682 Ga0466962_0010490
683 2525556786
684 2630648382
685 2643817689
686 2643878913
687 2643896803
688 2643915968
689 2643940400
690 2643976709
691 2644079474
692 2644479008
693 2644660229
694 2644694916
695 2644697531
696 8003016093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

33

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9254 19 139
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9024 19 139
3k12-assembly1.cif.gz_C crystal structure of an uncharacterized protein a6v7t0 from pseudomonas aeruginosa 0.8941 19 140
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.8911 17 139
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.8892 19 139
ID Description Score Start End Superfamily
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.922 17 138 3.30.1330.40
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9111 20 138 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9074 17 138 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9028 19 139 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8911 17 139 3.30.1330.40
ID Description Score Start End GO Terms
AF-M2Z0B7-F1-model_v4 Uncharacterized protein 0.9539 61 135 GO:0005739
GO:0005829
GO:0019239
AF-G5S0U0-F1-model_v4 Endoribonuclease L-PSP 0.9358 22 140 GO:0005829
GO:0019239
AF-A0A1H8XLX3-F1-model_v4 Endoribonuclease L-PSP 0.9345 18 142 GO:0005829
GO:0019239
AF-A0A3M1CC56-F1-model_v4 RidA family protein 0.9339 17 143 GO:0005829
GO:0019239
AF-A0A819LMK5-F1-model_v4 Uncharacterized protein 0.9312 28 141 GO:0005829
GO:0019239

Map