F417587

General Info

Members Datasets Scaffolds Average Seq Length
348 239 696 153

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100709460|Ga0307408_1007094602
Length 167
Sequence MYESVPGGIVTVKRMDNVGIVVEDIDAAVAFFSELGLTLEGRMPIEGEWAGRVTGLHGQRVEIAMMCTPDGHSRLELSRFDEPAIVSDHRTAPVNSLGYLRVMFTVDDIDDTLARLTELGATVVDEVVDYEDVYRLCYIRGPEGILIGLAQQLGQQTSRENPIERKR

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
160 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
184 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
187 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
238 2643221695 Lysobacter sp. Root494 Isolate Unclassified
239 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.29
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.29
Rhizoplane 2.87
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100709460 3300031548 Bacteria 905
2 Ga0065704_10172043 3300005289 Bacteria 1286
3 Ga0065707_10008856 3300005295 Bacteria 3805
4 Ga0070658_11443489 3300005327 Bacteria 597
5 Ga0070690_100018721 3300005330 Bacteria 4188
6 Ga0068869_100000209 3300005334 Bacteria 30398
7 Ga0070666_10726288 3300005335 Bacteria 729
8 Ga0070680_100009146 3300005336 Bacteria 7598
9 Ga0070680_100096631 3300005336 Bacteria 2449
10 Ga0070680_100559460 3300005336 Bacteria 980
11 Ga0070680_100873609 3300005336 Bacteria 775
12 Ga0068868_100997576 3300005338 Bacteria 766
13 Ga0068868_101576082 3300005338 Bacteria 616
14 Ga0070660_100865124 3300005339 Bacteria 761
15 Ga0070689_100000715 3300005340 Bacteria 20226
16 Ga0070689_100057082 3300005340 Bacteria 3029
17 Ga0070691_10002903 3300005341 Bacteria 7684
18 Ga0070687_100007507 3300005343 Bacteria 4551
19 Ga0070661_100273046 3300005344 Bacteria 1310
20 Ga0070661_100478153 3300005344 Bacteria 994
21 Ga0070675_100323106 3300005354 Bacteria 1363
22 Ga0070688_100052775 3300005365 Bacteria 2541
23 Ga0070667_100017185 3300005367 Bacteria 5991
24 Ga0070667_100396372 3300005367 Bacteria 1256
25 Ga0070701_10000474 3300005438 Bacteria 13761
26 Ga0070705_100008457 3300005440 Bacteria 5099
27 Ga0070694_100003366 3300005444 Bacteria 9577
28 Ga0070708_100138552 3300005445 Bacteria 2255
29 Ga0070678_100304346 3300005456 Bacteria 1356
30 Ga0070681_10077121 3300005458 Bacteria 3290
31 Ga0070681_10229751 3300005458 Bacteria 1770
32 Ga0070681_10402313 3300005458 Bacteria 1280
33 Ga0070681_10740297 3300005458 Bacteria 899
34 Ga0068867_101164653 3300005459 Bacteria 706
35 Ga0070685_10155531 3300005466 Bacteria 1453
36 Ga0070706_101738815 3300005467 Bacteria 567
37 Ga0070707_100449228 3300005468 Bacteria 1250
38 Ga0070698_100463412 3300005471 Bacteria 1203
39 Ga0070699_100001420 3300005518 Bacteria 22009
40 Ga0070699_100082244 3300005518 Bacteria 2807
41 Ga0070699_100101393 3300005518 Bacteria 2523
42 Ga0070679_100022460 3300005530 Bacteria 6166
43 Ga0070679_100929307 3300005530 Bacteria 813
44 Ga0070684_100071530 3300005535 Bacteria 3052
45 Ga0070684_100181390 3300005535 Bacteria 1914
46 Ga0070697_101539230 3300005536 Bacteria 594
47 Ga0068853_100056601 3300005539 Bacteria 3382
48 Ga0068853_100161822 3300005539 Bacteria 2020
49 Ga0068853_101378707 3300005539 Bacteria 682
50 Ga0070672_100637892 3300005543 Bacteria 930
51 Ga0070686_100000493 3300005544 Bacteria 23885
52 Ga0070686_100538689 3300005544 Bacteria 911
53 Ga0070695_100002310 3300005545 Bacteria 10933
54 Ga0070696_100000170 3300005546 Bacteria 37218
55 Ga0070693_100000171 3300005547 Bacteria 29969
56 Ga0070665_101173992 3300005548 Bacteria 779
57 Ga0070704_100002324 3300005549 Bacteria 10648
58 Ga0068855_100001801 3300005563 Bacteria 26787
59 Ga0070664_101054741 3300005564 Bacteria 765
60 Ga0068854_100000817 3300005578 Bacteria 18611
61 Ga0068856_100154385 3300005614 Bacteria 2305
62 Ga0068856_100895965 3300005614 Bacteria 906
63 Ga0070702_100007600 3300005615 Bacteria 5194
64 Ga0068859_100000935 3300005617 Bacteria 29960
65 Ga0068859_100362916 3300005617 Bacteria 1544
66 Ga0068866_10000239 3300005718 Bacteria 25871
67 Ga0068861_100000070 3300005719 Bacteria 49394
68 Ga0068861_100081606 3300005719 Bacteria 2532
69 Ga0068861_101310083 3300005719 Bacteria 704
70 Ga0068863_100198837 3300005841 Bacteria 1927
71 Ga0068858_100029840 3300005842 Bacteria 5066
72 Ga0068858_100102650 3300005842 Bacteria 2667
73 Ga0068858_100378271 3300005842 Bacteria 1359
74 Ga0068860_100063129 3300005843 Bacteria 3519
75 Ga0068862_100016181 3300005844 Bacteria 6203
76 Ga0068862_100094251 3300005844 Bacteria 2611
77 Ga0070715_10104649 3300006163 Bacteria 1326
78 Ga0097621_100043969 3300006237 Bacteria 3602
79 Ga0097621_100103882 3300006237 Bacteria 2394
80 Ga0068871_100011838 3300006358 Bacteria 6413
81 Ga0075430_100002158 3300006846 Bacteria 16291
82 Ga0075430_100280923 3300006846 Bacteria 1377
83 Ga0075431_100002260 3300006847 Bacteria 18464
84 Ga0075431_100145502 3300006847 Bacteria 2442
85 Ga0075433_10270349 3300006852 Bacteria 1506
86 Ga0075433_10387396 3300006852 Bacteria 1234
87 Ga0075434_100346628 3300006871 Bacteria 1506
88 Ga0075429_100010293 3300006880 Bacteria 8093
89 Ga0075429_100311275 3300006880 Bacteria 1378
90 Ga0068865_100000242 3300006881 Bacteria 30369
91 Ga0097620_100000935 3300006931 Bacteria 29960
92 Ga0097620_100209305 3300006931 Bacteria 2036
93 Ga0097620_100362897 3300006931 Bacteria 1544
94 Ga0075435_100250899 3300007076 Bacteria 1506
95 Ga0111539_10002380 3300009094 Bacteria 24972
96 Ga0111539_10242131 3300009094 Bacteria 2100
97 Ga0111539_11453295 3300009094 Unclassified 795
98 Ga0114129_10006657 3300009147 Bacteria 16407
99 Ga0114129_10543329 3300009147 Bacteria 1512
100 Ga0114129_10945857 3300009147 Bacteria 1089
101 Ga0105243_10001507 3300009148 Bacteria 20391
102 Ga0105241_10010156 3300009174 Bacteria 6914
103 Ga0105242_10000161 3300009176 Bacteria 50082
104 Ga0105237_10043869 3300009545 Bacteria 4503
105 Ga0105237_10147755 3300009545 Bacteria 2346
106 Ga0105249_10001161 3300009553 Bacteria 23275
107 Ga0105249_11073727 3300009553 Bacteria 875
108 Ga0099796_10186055 3300010159 Bacteria 836
109 Ga0099796_10325585 3300010159 Bacteria 657
110 Ga0105239_10035067 3300010375 Bacteria 5510
111 Ga0105239_10061047 3300010375 Bacteria 4137
112 Ga0105239_11350735 3300010375 Bacteria 822
113 Ga0157341_1022883 3300012494 Bacteria 628
114 Ga0157369_11497369 3300013105 Bacteria 686
115 Ga0157378_10015314 3300013297 Bacteria 6716
116 Ga0163162_10046381 3300013306 Bacteria 4355
117 Ga0163162_10621925 3300013306 Bacteria 1205
118 Ga0157375_10948720 3300013308 Bacteria 1002
119 Ga0163163_10497119 3300014325 Bacteria 1281
120 Ga0157380_10029643 3300014326 Bacteria 4184
121 Ga0182008_10116710 3300014497 Bacteria 1325
122 Ga0157379_11359920 3300014968 Bacteria 687
123 Ga0157379_11717787 3300014968 Bacteria 615
124 Ga0157376_12024039 3300014969 Bacteria 614
125 Ga0163161_10000551 3300017792 Bacteria 30373
126 Ga0206353_10980918 3300020082 Bacteria 1772
127 Ga0207656_10058185 3300025321 Bacteria 1688
128 Ga0207682_10132895 3300025893 Bacteria 1112
129 Ga0207692_10184383 3300025898 Bacteria 1218
130 Ga0207642_10000915 3300025899 Bacteria 9230
131 Ga0207642_10176067 3300025899 Bacteria 1161
132 Ga0207688_10098157 3300025901 Bacteria 1688
133 Ga0207688_10414277 3300025901 Bacteria 837
134 Ga0207647_10062020 3300025904 Bacteria 2279
135 Ga0207685_10253228 3300025905 Bacteria 852
136 Ga0207645_10023297 3300025907 Bacteria 4025
137 Ga0207705_10402897 3300025909 Bacteria 1058
138 Ga0207705_11202091 3300025909 Bacteria 581
139 Ga0207684_10036650 3300025910 Bacteria 4162
140 Ga0207654_10065617 3300025911 Bacteria 2138
141 Ga0207654_10152713 3300025911 Bacteria 1484
142 Ga0207707_10026803 3300025912 Bacteria 5037
143 Ga0207707_10030670 3300025912 Bacteria 4703
144 Ga0207707_10316390 3300025912 Bacteria 1348
145 Ga0207671_10008451 3300025914 Bacteria 8727
146 Ga0207660_10198725 3300025917 Bacteria 1565
147 Ga0207660_10905715 3300025917 Bacteria 720
148 Ga0207662_10000479 3300025918 Bacteria 17918
149 Ga0207662_10001816 3300025918 Bacteria 10480
150 Ga0207662_10045021 3300025918 Bacteria 2608
151 Ga0207657_10496775 3300025919 Bacteria 956
152 Ga0207649_10153335 3300025920 Bacteria 1589
153 Ga0207649_10595586 3300025920 Bacteria 850
154 Ga0207652_10033703 3300025921 Bacteria 4313
155 Ga0207652_11267320 3300025921 Bacteria 639
156 Ga0207646_10088713 3300025922 Bacteria 2767
157 Ga0207646_10397811 3300025922 Bacteria 1244
158 Ga0207659_10129952 3300025926 Bacteria 1942
159 Ga0207687_10000267 3300025927 Bacteria 35541
160 Ga0207687_10492791 3300025927 Bacteria 1022
161 Ga0207644_10511585 3300025931 Bacteria 991
162 Ga0207690_10346079 3300025932 Bacteria 1174
163 Ga0207686_10001798 3300025934 Bacteria 11920
164 Ga0207686_10022309 3300025934 Bacteria 3645
165 Ga0207709_10120930 3300025935 Bacteria 1768
166 Ga0207670_10000833 3300025936 Bacteria 16162
167 Ga0207670_10220498 3300025936 Bacteria 1451
168 Ga0207670_10560227 3300025936 Bacteria 935
169 Ga0207669_10045366 3300025937 Bacteria 2589
170 Ga0207704_10000603 3300025938 Bacteria 15864
171 Ga0207704_10025944 3300025938 Bacteria 3207
172 Ga0207665_10280062 3300025939 Bacteria 1241
173 Ga0207691_10001079 3300025940 Bacteria 27155
174 Ga0207711_10026903 3300025941 Bacteria 4828
175 Ga0207711_10145509 3300025941 Bacteria 2135
176 Ga0207689_10000200 3300025942 Bacteria 52703
177 Ga0207679_10103482 3300025945 Bacteria 2231
178 Ga0207679_10610212 3300025945 Bacteria 984
179 Ga0207667_10125325 3300025949 Bacteria 2645
180 Ga0207651_10035582 3300025960 Bacteria 3241
181 Ga0207712_10004385 3300025961 Bacteria 8914
182 Ga0207640_10008663 3300025981 Bacteria 5656
183 Ga0207658_10010508 3300025986 Bacteria 6288
184 Ga0207658_10123941 3300025986 Bacteria 2065
185 Ga0207658_10500767 3300025986 Bacteria 1082
186 Ga0207658_11226301 3300025986 Bacteria 686
187 Ga0207677_10045458 3300026023 Bacteria 2932
188 Ga0207677_10837385 3300026023 Bacteria 826
189 Ga0207677_10886685 3300026023 Bacteria 803
190 Ga0207703_10000937 3300026035 Bacteria 28276
191 Ga0207703_10001427 3300026035 Bacteria 21805
192 Ga0207703_10040147 3300026035 Bacteria 3744
193 Ga0207639_10143991 3300026041 Bacteria 1989
194 Ga0207678_10432116 3300026067 Bacteria 1143
195 Ga0207708_10203496 3300026075 Bacteria 1580
196 Ga0207702_11101345 3300026078 Bacteria 788
197 Ga0207641_10235761 3300026088 Bacteria 1703
198 Ga0207648_10000309 3300026089 Bacteria 53487
199 Ga0207674_11530816 3300026116 Bacteria 636
200 Ga0207675_100000089 3300026118 Bacteria 71258
201 Ga0207675_100093547 3300026118 Bacteria 2828
202 Ga0207683_10687065 3300026121 Bacteria 949
203 Ga0207698_10118592 3300026142 Bacteria 2235
204 Ga0207698_11003637 3300026142 Bacteria 845
205 Ga0209971_1046972 3300027682 Bacteria 1042
206 Ga0209998_10009431 3300027717 Bacteria 2027
207 Ga0209974_10114805 3300027876 Bacteria 950
208 Ga0207428_10028434 3300027907 Bacteria 4645
209 Ga0268266_10881927 3300028379 Bacteria 865
210 Ga0268265_10004854 3300028380 Bacteria 9267
211 Ga0268265_10034919 3300028380 Bacteria 3669
212 Ga0268264_10002468 3300028381 Bacteria 16258
213 Ga0307515_10178576 3300028794 Bacteria 2083
214 Ga0307515_10187388 3300028794 Bacteria 1993
215 Ga0307515_10248504 3300028794 Bacteria 1536
216 Ga0265331_10058702 3300031250 Bacteria 1821
217 Ga0265327_10059727 3300031251 Bacteria 1951
218 Ga0265327_10146820 3300031251 Bacteria 1098
219 Ga0307513_10323619 3300031456 Bacteria 1299
220 Ga0307513_10379778 3300031456 Bacteria 1153
221 Ga0307513_10789119 3300031456 Bacteria 655
222 Ga0307508_10006589 3300031616 Bacteria 10904
223 Ga0307516_10378211 3300031730 Bacteria 1078
224 Ga0307413_10311266 3300031824 Bacteria 1199
225 Ga0307410_10137489 3300031852 Bacteria 1803
226 Ga0307410_10977230 3300031852 Bacteria 729
227 Ga0307406_12015543 3300031901 Bacteria 516
228 Ga0307407_10837358 3300031903 Bacteria 702
229 Ga0307412_10469103 3300031911 Bacteria 1041
230 Ga0307412_10505491 3300031911 Bacteria 1007
231 Ga0307409_100708283 3300031995 Bacteria 1007
232 Ga0307409_100818788 3300031995 Bacteria 940
233 Ga0307416_100091362 3300032002 Bacteria 2615
234 Ga0307416_100557696 3300032002 Bacteria 1220
235 Ga0307416_100630087 3300032002 Bacteria 1155
236 Ga0307411_10082744 3300032005 Bacteria 2215
237 Ga0307411_10088089 3300032005 Bacteria 2158
238 Ga0307411_11392257 3300032005 Bacteria 642
239 Ga0307510_10009383 3300033180 Bacteria 11658
240 Ga0373930_0007414 3300034816 Bacteria 1888
241 Ga0373948_0006004 3300034817 Bacteria 1990
242 Ga0373958_0028376 3300034819 Bacteria 1083
243 Ga0373938_0034356 3300034957 Bacteria 1101
244 Ga0373928_0005706 3300035084 Bacteria 2380
245 Ga0373951_0020634 3300035091 Bacteria 1510
246 Ga0373932_0045276 3300035112 Bacteria 1286
247 Ga0373953_0302864 3300035117 Bacteria 698
248 Ga0373954_0344151 3300035118 Bacteria 736
249 Ga0373957_0095276 3300035120 Bacteria 1187
250 Ga0373955_0092511 3300035172 Bacteria 1725
251 Ga0373942_0140532 3300035207 Bacteria 768
252 Ga0373961_0009898 3300035241 Bacteria 2339
253 Ga0373962_0165536 3300035242 Bacteria 732
254 Ga0373931_0012070 3300035691 Bacteria 4182
255 Ga0373947_1002239 3300035725 Bacteria 570
256 Ga0373937_0507166 3300036401 Bacteria 1146
257 Ga0373925_1396440 3300037068 Bacteria 574
258 Ga0395899_0128530 3300037312 Bacteria 1811
259 Ga0395905_0000903 3300037471 Bacteria 38615
260 Ga0395905_0231226 3300037471 Bacteria 1729
261 Ga0395901_0067793 3300038443 Bacteria 3717
262 Ga0436361_0047415 3300039447 Bacteria 544
263 Ga0436363_0613261 3300039450 Bacteria 671
264 Ga0451798_0867454 3300041458 Bacteria 847
265 Ga0451800_1164648 3300041459 Bacteria 1657
266 Ga0451807_1203434 3300041486 Bacteria 2137
267 Ga0451845_0384025 3300041501 Bacteria 678
268 Ga0439432_157848 3300042006 Bacteria 664
269 Ga0439455_0075845 3300042012 Bacteria 909
270 Ga0450896_066923 3300042133 Bacteria 591
271 Ga0439458_0010319 3300042157 Bacteria 2082
272 Ga0439435_0138519 3300042436 Bacteria 774
273 Ga0439464_0099224 3300042439 Bacteria 883
274 Ga0451577_0800785 3300042876 Bacteria 851
275 Ga0453683_0043160 3300044673 Bacteria 2830
276 Ga0466963_0052684 3300044694 Bacteria 2700
277 Ga0453684_0041603 3300044712 Bacteria 6211
278 Ga0466957_0756418 3300044842 Bacteria 688
279 Ga0466960_0030466 3300044901 Bacteria 2483
280 Ga0466967_0658857 3300045976 Bacteria 1035
281 Ga0495583_0000739 3300046506 Bacteria 41524
282 Ga0495663_0011755 3300046525 Bacteria 2437
283 Ga0495621_0000214 3300046539 Bacteria 13505
284 Ga0495684_1074844 3300047471 Bacteria 506
285 Ga0496100_0041477 3300048903 Bacteria 2934
286 Ga0496102_0108774 3300048905 Bacteria 2582
287 Ga0496114_0000324 3300048917 Bacteria 34974
288 Ga0496114_0058783 3300048917 Bacteria 3211
289 Ga0496114_0673987 3300048917 Bacteria 908
290 Ga0496115_0035313 3300048918 Bacteria 3955
291 Ga0496115_0747354 3300048918 Bacteria 765
292 Ga0496119_0149923 3300048922 Bacteria 1251
293 Ga0496125_0014318 3300048928 Bacteria 7729
294 Ga0501033_0676418 3300049570 Bacteria 704
295 Ga0501040_0949814 3300049576 Bacteria 623
296 Ga0501042_0448836 3300049578 Bacteria 935
297 Ga0501042_1120075 3300049578 Bacteria 574
298 Ga0501043_0148040 3300049579 Bacteria 1838
299 Ga0501046_0753693 3300049580 Bacteria 684
300 Ga0501070_0038360 3300049586 Bacteria 3997
301 Ga0501070_0297203 3300049586 Bacteria 1316
302 Ga0501070_0594853 3300049586 Bacteria 882
303 Ga0501071_0000800 3300049587 Bacteria 16804
304 Ga0501071_0020118 3300049587 Bacteria 4638
305 Ga0501072_0002984 3300049588 Bacteria 12752
306 Ga0501072_0946736 3300049588 Bacteria 672
307 Ga0501073_0326875 3300049589 Bacteria 1059
308 Ga0501075_0024442 3300049591 Bacteria 4431
309 Ga0501075_0801385 3300049591 Bacteria 717
310 Ga0501076_0170645 3300049592 Bacteria 1773
311 Ga0501077_0102782 3300049593 Bacteria 1811
312 Ga0501077_0324386 3300049593 Bacteria 982
313 Ga0501077_0894670 3300049593 Bacteria 571
314 Ga0501249_063428 3300049679 Bacteria 858
315 Ga0501257_013559 3300049686 Bacteria 1870
316 Ga0501079_0112077 3300049741 Bacteria 2120
317 Ga0501080_0028834 3300049742 Bacteria 5167
318 Ga0501080_0350329 3300049742 Bacteria 1333
319 Ga0501080_0670571 3300049742 Bacteria 916
320 Ga0501080_0724340 3300049742 Bacteria 876
321 Ga0501081_0151003 3300049743 Bacteria 1669
322 Ga0501081_0176063 3300049743 Bacteria 1546
323 Ga0501083_0000507 3300049744 Bacteria 24796
324 Ga0501083_0049082 3300049744 Bacteria 2847
325 Ga0501083_0515817 3300049744 Bacteria 778
326 Ga0501044_0002665 3300049823 Bacteria 20304
327 nmdc:mga05p37_1738657_c1 3300050507 Bacteria 606
328 nmdc:mga05p37_43832_c1 3300050507 Bacteria 5505
329 nmdc:mga05p37_4765_c1 3300050507 Bacteria 15845
330 nmdc:mga0qj67_16933_c1 3300050509 Bacteria 5536
331 nmdc:mga0qj67_18224_c1 3300050509 Bacteria 5349
332 nmdc:mga0qj67_194372_c1 3300050509 Bacteria 1649
333 nmdc:mga0qj67_437540_c1 3300050509 Bacteria 1054
334 nmdc:mga06r32_243710_c1 3300050510 Bacteria 1785
335 nmdc:mga06r32_26430_c1 3300050510 Bacteria 5412
336 nmdc:mga08y16_5682_c1 3300050511 Bacteria 13068
337 nmdc:mga0n895_340282_c1 3300050512 Bacteria 1520
338 nmdc:mga0n895_726165_c1 3300050512 Bacteria 988
339 nmdc:mga0rr50_41009_c1 3300050513 Bacteria 3370
340 nmdc:mga08x19_2907_c2 3300050514 Bacteria 9456
341 nmdc:mga0a205_116101_c1 3300050515 Bacteria 2575
342 nmdc:mga0a205_287306_c1 3300050515 Bacteria 1520
343 Ga0495601_0761736 3300053077 Bacteria 616
344 Ga0590077_032510 3300059426 Bacteria 1143
345 Ga0501082_1830982 3300060353 Bacteria 529
346 2512352691 2512047030 Bacteria 9031815
347 2644528112 2643221695 Bacteria 3441323
348 8002870539 8002869464 Bacteria 3588529
349 Ga0307408_100709460
350 Ga0065704_10172043
351 Ga0065707_10008856
352 Ga0070658_11443489
353 Ga0070690_100018721
354 Ga0068869_100000209
355 Ga0070666_10726288
356 Ga0070680_100009146
357 Ga0070680_100096631
358 Ga0070680_100559460
359 Ga0070680_100873609
360 Ga0068868_100997576
361 Ga0068868_101576082
362 Ga0070660_100865124
363 Ga0070689_100000715
364 Ga0070689_100057082
365 Ga0070691_10002903
366 Ga0070687_100007507
367 Ga0070661_100273046
368 Ga0070661_100478153
369 Ga0070675_100323106
370 Ga0070688_100052775
371 Ga0070667_100017185
372 Ga0070667_100396372
373 Ga0070701_10000474
374 Ga0070705_100008457
375 Ga0070694_100003366
376 Ga0070708_100138552
377 Ga0070678_100304346
378 Ga0070681_10077121
379 Ga0070681_10229751
380 Ga0070681_10402313
381 Ga0070681_10740297
382 Ga0068867_101164653
383 Ga0070685_10155531
384 Ga0070706_101738815
385 Ga0070707_100449228
386 Ga0070698_100463412
387 Ga0070699_100001420
388 Ga0070699_100082244
389 Ga0070699_100101393
390 Ga0070679_100022460
391 Ga0070679_100929307
392 Ga0070684_100071530
393 Ga0070684_100181390
394 Ga0070697_101539230
395 Ga0068853_100056601
396 Ga0068853_100161822
397 Ga0068853_101378707
398 Ga0070672_100637892
399 Ga0070686_100000493
400 Ga0070686_100538689
401 Ga0070695_100002310
402 Ga0070696_100000170
403 Ga0070693_100000171
404 Ga0070665_101173992
405 Ga0070704_100002324
406 Ga0068855_100001801
407 Ga0070664_101054741
408 Ga0068854_100000817
409 Ga0068856_100154385
410 Ga0068856_100895965
411 Ga0070702_100007600
412 Ga0068859_100000935
413 Ga0068859_100362916
414 Ga0068866_10000239
415 Ga0068861_100000070
416 Ga0068861_100081606
417 Ga0068861_101310083
418 Ga0068863_100198837
419 Ga0068858_100029840
420 Ga0068858_100102650
421 Ga0068858_100378271
422 Ga0068860_100063129
423 Ga0068862_100016181
424 Ga0068862_100094251
425 Ga0070715_10104649
426 Ga0097621_100043969
427 Ga0097621_100103882
428 Ga0068871_100011838
429 Ga0075430_100002158
430 Ga0075430_100280923
431 Ga0075431_100002260
432 Ga0075431_100145502
433 Ga0075433_10270349
434 Ga0075433_10387396
435 Ga0075434_100346628
436 Ga0075429_100010293
437 Ga0075429_100311275
438 Ga0068865_100000242
439 Ga0097620_100000935
440 Ga0097620_100209305
441 Ga0097620_100362897
442 Ga0075435_100250899
443 Ga0111539_10002380
444 Ga0111539_10242131
445 Ga0111539_11453295
446 Ga0114129_10006657
447 Ga0114129_10543329
448 Ga0114129_10945857
449 Ga0105243_10001507
450 Ga0105241_10010156
451 Ga0105242_10000161
452 Ga0105237_10043869
453 Ga0105237_10147755
454 Ga0105249_10001161
455 Ga0105249_11073727
456 Ga0099796_10186055
457 Ga0099796_10325585
458 Ga0105239_10035067
459 Ga0105239_10061047
460 Ga0105239_11350735
461 Ga0157341_1022883
462 Ga0157369_11497369
463 Ga0157378_10015314
464 Ga0163162_10046381
465 Ga0163162_10621925
466 Ga0157375_10948720
467 Ga0163163_10497119
468 Ga0157380_10029643
469 Ga0182008_10116710
470 Ga0157379_11359920
471 Ga0157379_11717787
472 Ga0157376_12024039
473 Ga0163161_10000551
474 Ga0206353_10980918
475 Ga0207656_10058185
476 Ga0207682_10132895
477 Ga0207692_10184383
478 Ga0207642_10000915
479 Ga0207642_10176067
480 Ga0207688_10098157
481 Ga0207688_10414277
482 Ga0207647_10062020
483 Ga0207685_10253228
484 Ga0207645_10023297
485 Ga0207705_10402897
486 Ga0207705_11202091
487 Ga0207684_10036650
488 Ga0207654_10065617
489 Ga0207654_10152713
490 Ga0207707_10026803
491 Ga0207707_10030670
492 Ga0207707_10316390
493 Ga0207671_10008451
494 Ga0207660_10198725
495 Ga0207660_10905715
496 Ga0207662_10000479
497 Ga0207662_10001816
498 Ga0207662_10045021
499 Ga0207657_10496775
500 Ga0207649_10153335
501 Ga0207649_10595586
502 Ga0207652_10033703
503 Ga0207652_11267320
504 Ga0207646_10088713
505 Ga0207646_10397811
506 Ga0207659_10129952
507 Ga0207687_10000267
508 Ga0207687_10492791
509 Ga0207644_10511585
510 Ga0207690_10346079
511 Ga0207686_10001798
512 Ga0207686_10022309
513 Ga0207709_10120930
514 Ga0207670_10000833
515 Ga0207670_10220498
516 Ga0207670_10560227
517 Ga0207669_10045366
518 Ga0207704_10000603
519 Ga0207704_10025944
520 Ga0207665_10280062
521 Ga0207691_10001079
522 Ga0207711_10026903
523 Ga0207711_10145509
524 Ga0207689_10000200
525 Ga0207679_10103482
526 Ga0207679_10610212
527 Ga0207667_10125325
528 Ga0207651_10035582
529 Ga0207712_10004385
530 Ga0207640_10008663
531 Ga0207658_10010508
532 Ga0207658_10123941
533 Ga0207658_10500767
534 Ga0207658_11226301
535 Ga0207677_10045458
536 Ga0207677_10837385
537 Ga0207677_10886685
538 Ga0207703_10000937
539 Ga0207703_10001427
540 Ga0207703_10040147
541 Ga0207639_10143991
542 Ga0207678_10432116
543 Ga0207708_10203496
544 Ga0207702_11101345
545 Ga0207641_10235761
546 Ga0207648_10000309
547 Ga0207674_11530816
548 Ga0207675_100000089
549 Ga0207675_100093547
550 Ga0207683_10687065
551 Ga0207698_10118592
552 Ga0207698_11003637
553 Ga0209971_1046972
554 Ga0209998_10009431
555 Ga0209974_10114805
556 Ga0207428_10028434
557 Ga0268266_10881927
558 Ga0268265_10004854
559 Ga0268265_10034919
560 Ga0268264_10002468
561 Ga0307515_10178576
562 Ga0307515_10187388
563 Ga0307515_10248504
564 Ga0265331_10058702
565 Ga0265327_10059727
566 Ga0265327_10146820
567 Ga0307513_10323619
568 Ga0307513_10379778
569 Ga0307513_10789119
570 Ga0307508_10006589
571 Ga0307516_10378211
572 Ga0307413_10311266
573 Ga0307410_10137489
574 Ga0307410_10977230
575 Ga0307406_12015543
576 Ga0307407_10837358
577 Ga0307412_10469103
578 Ga0307412_10505491
579 Ga0307409_100708283
580 Ga0307409_100818788
581 Ga0307416_100091362
582 Ga0307416_100557696
583 Ga0307416_100630087
584 Ga0307411_10082744
585 Ga0307411_10088089
586 Ga0307411_11392257
587 Ga0307510_10009383
588 Ga0373930_0007414
589 Ga0373948_0006004
590 Ga0373958_0028376
591 Ga0373938_0034356
592 Ga0373928_0005706
593 Ga0373951_0020634
594 Ga0373932_0045276
595 Ga0373953_0302864
596 Ga0373954_0344151
597 Ga0373957_0095276
598 Ga0373955_0092511
599 Ga0373942_0140532
600 Ga0373961_0009898
601 Ga0373962_0165536
602 Ga0373931_0012070
603 Ga0373947_1002239
604 Ga0373937_0507166
605 Ga0373925_1396440
606 Ga0395899_0128530
607 Ga0395905_0000903
608 Ga0395905_0231226
609 Ga0395901_0067793
610 Ga0436361_0047415
611 Ga0436363_0613261
612 Ga0451798_0867454
613 Ga0451800_1164648
614 Ga0451807_1203434
615 Ga0451845_0384025
616 Ga0439432_157848
617 Ga0439455_0075845
618 Ga0450896_066923
619 Ga0439458_0010319
620 Ga0439435_0138519
621 Ga0439464_0099224
622 Ga0451577_0800785
623 Ga0453683_0043160
624 Ga0466963_0052684
625 Ga0453684_0041603
626 Ga0466957_0756418
627 Ga0466960_0030466
628 Ga0466967_0658857
629 Ga0495583_0000739
630 Ga0495663_0011755
631 Ga0495621_0000214
632 Ga0495684_1074844
633 Ga0496100_0041477
634 Ga0496102_0108774
635 Ga0496114_0000324
636 Ga0496114_0058783
637 Ga0496114_0673987
638 Ga0496115_0035313
639 Ga0496115_0747354
640 Ga0496119_0149923
641 Ga0496125_0014318
642 Ga0501033_0676418
643 Ga0501040_0949814
644 Ga0501042_0448836
645 Ga0501042_1120075
646 Ga0501043_0148040
647 Ga0501046_0753693
648 Ga0501070_0038360
649 Ga0501070_0297203
650 Ga0501070_0594853
651 Ga0501071_0000800
652 Ga0501071_0020118
653 Ga0501072_0002984
654 Ga0501072_0946736
655 Ga0501073_0326875
656 Ga0501075_0024442
657 Ga0501075_0801385
658 Ga0501076_0170645
659 Ga0501077_0102782
660 Ga0501077_0324386
661 Ga0501077_0894670
662 Ga0501249_063428
663 Ga0501257_013559
664 Ga0501079_0112077
665 Ga0501080_0028834
666 Ga0501080_0350329
667 Ga0501080_0670571
668 Ga0501080_0724340
669 Ga0501081_0151003
670 Ga0501081_0176063
671 Ga0501083_0000507
672 Ga0501083_0049082
673 Ga0501083_0515817
674 Ga0501044_0002665
675 nmdc:mga05p37_1738657_c1
676 nmdc:mga05p37_43832_c1
677 nmdc:mga05p37_4765_c1
678 nmdc:mga0qj67_16933_c1
679 nmdc:mga0qj67_18224_c1
680 nmdc:mga0qj67_194372_c1
681 nmdc:mga0qj67_437540_c1
682 nmdc:mga06r32_243710_c1
683 nmdc:mga06r32_26430_c1
684 nmdc:mga08y16_5682_c1
685 nmdc:mga0n895_340282_c1
686 nmdc:mga0n895_726165_c1
687 nmdc:mga0rr50_41009_c1
688 nmdc:mga08x19_2907_c2
689 nmdc:mga0a205_116101_c1
690 nmdc:mga0a205_287306_c1
691 Ga0495601_0761736
692 Ga0590077_032510
693 Ga0501082_1830982
694 2512352691
695 2644528112
696 8002870539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

149

0.84

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

16

138

0.82

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

14

55

0.82

PF18029

Glyoxalase_6

Glyoxalase-like domain

17

149

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9494 5 145
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8944 5 145
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.8294 112 143
4bpc-assembly1.cif.gz_A structure of the catalytic domain of protein tyrosine phosphatase sigma in the sulfenic acid form 0.7839 112 145
1fa5-assembly1.cif.gz_B crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli 0.7743 5 143
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9325 6 145 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.901 6 145 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8669 9 143 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8524 9 143 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.851 90 144 3.30.720.110
ID Description Score Start End GO Terms
AF-B5I170-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9591 90 145 GO:0051213
AF-A0A529P2B6-F1-model_v4 VOC family protein 0.9551 88 144
AF-A0A0S2FWJ6-F1-model_v4 deleted 0.9544 57 145
AF-A0A346XUA4-F1-model_v4 Glyoxalase family protein 0.9542 6 145 GO:0004493
GO:0046491
AF-A0A858RR96-F1-model_v4 VOC family protein 0.9536 6 145

Map