F417600

General Info

Members Datasets Scaffolds Average Seq Length
348 226 696 152

Family's Representative Sequence

Representative Sequence 3300032168|Ga0316593_10352136|Ga0316593_103521361
Length 173
Sequence MRFVRTLFSHIAHLEDMSMTAIDFTPLFRSAIGFDRLASALETAYRSDAGGYPPYNIEVTGTDKYRISMAVAGFAEKDLDVQVKESILTVSGSHKDDMAKEKEQRFLYRGIATRNFERQFQLADYVKVVDARIEDGLLHIDLVREIPEAMKPRKIEIRTEGGSLLEGTAEKAA

Samples

Sample ID Description Type Environment
1 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
56 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
103 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
109 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
167 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
172 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
173 2506520008 Serratia plymuthica AS12 Isolate Unclassified
174 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
175 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
176 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
177 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
178 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
179 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
180 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
181 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
182 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
183 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
184 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
185 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
186 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
187 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
188 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
189 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
190 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
191 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
192 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
193 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
194 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
195 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
196 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
197 2932406140 Serratia sp. 2723 Isolate Rhizosphere
198 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
199 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
200 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
201 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
202 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
203 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
204 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
205 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
206 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
207 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
208 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
209 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
210 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
211 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
212 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
213 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
214 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
215 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
216 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
217 2939577877 Serratia sp. 509 Isolate Rhizosphere
218 640753048 Serratia proteamaculans 568 Isolate Endosphere
219 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
220 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
221 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
222 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
223 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
224 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
225 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
226 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 56.9
Metatranscriptomes 27.3
Isolates 15.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 11.78
Rhizoplane 4.89
Rhizosphere 78.74
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316593_10352136 3300032168 Bacteria 564
2 Ga0007429J51699_1018786 3300003579 Bacteria 572
3 Ga0007429J51699_1067155 3300003579 Bacteria 541
4 Ga0065703_1018787 3300005272 Bacteria 8104
5 Ga0070690_100146414 3300005330 Bacteria 1608
6 Ga0070670_100881728 3300005331 Bacteria 810
7 Ga0070680_100002263 3300005336 Bacteria 14227
8 Ga0070680_100006196 3300005336 Bacteria 9074
9 Ga0070689_100503433 3300005340 Bacteria 1038
10 Ga0070691_10008826 3300005341 Bacteria 4615
11 Ga0070687_100149410 3300005343 Bacteria 1370
12 Ga0070668_100228043 3300005347 Bacteria 1539
13 Ga0070659_100149040 3300005366 Bacteria 1908
14 Ga0070703_10004916 3300005406 Bacteria 3732
15 Ga0070705_100000168 3300005440 Bacteria 38074
16 Ga0070700_100000622 3300005441 Bacteria 17601
17 Ga0070694_100002378 3300005444 Bacteria 11122
18 Ga0070708_100275519 3300005445 Bacteria 1583
19 Ga0070663_100002036 3300005455 Bacteria 11297
20 Ga0070662_100054886 3300005457 Bacteria 2888
21 Ga0070662_100717363 3300005457 Bacteria 847
22 Ga0070681_10001440 3300005458 Bacteria 20950
23 Ga0070681_10072262 3300005458 Bacteria 3413
24 Ga0070698_100086738 3300005471 Bacteria 3116
25 Ga0070698_100213528 3300005471 Bacteria 1864
26 Ga0070699_100000299 3300005518 Bacteria 47843
27 Ga0070679_100010942 3300005530 Bacteria 8621
28 Ga0070684_101351316 3300005535 Bacteria 671
29 Ga0070697_100010682 3300005536 Bacteria 7166
30 Ga0068853_100535677 3300005539 Bacteria 1108
31 Ga0070695_100001801 3300005545 Bacteria 12085
32 Ga0070696_100000036 3300005546 Bacteria 62324
33 Ga0070693_100707314 3300005547 Bacteria 738
34 Ga0070704_100001096 3300005549 Bacteria 14044
35 Ga0068855_100396041 3300005563 Bacteria 1514
36 Ga0070664_100101132 3300005564 Bacteria 2507
37 Ga0070664_100518303 3300005564 Bacteria 1100
38 Ga0068857_100004383 3300005577 Bacteria 11931
39 Ga0068854_100308105 3300005578 Bacteria 1283
40 Ga0068854_100950285 3300005578 Bacteria 758
41 Ga0068859_100003711 3300005617 Bacteria 15562
42 Ga0068864_100002987 3300005618 Bacteria 13984
43 Ga0068861_101332433 3300005719 Bacteria 699
44 Ga0068870_10068174 3300005840 Bacteria 1932
45 Ga0068860_100010953 3300005843 Bacteria 8938
46 Ga0068862_100001757 3300005844 Bacteria 19597
47 Ga0081539_10126050 3300005985 Bacteria 1265
48 Ga0075363_100107128 3300006048 Bacteria 1551
49 Ga0097620_100003711 3300006931 Bacteria 15562
50 Ga0079104_1002630 3300006946 Bacteria 9381
51 Ga0105247_10001859 3300009101 Bacteria 14775
52 Ga0105243_10160232 3300009148 Bacteria 1939
53 Ga0105243_10925387 3300009148 Bacteria 869
54 Ga0105237_10807940 3300009545 Bacteria 945
55 Ga0105238_11364908 3300009551 Bacteria 735
56 Ga0105249_10001285 3300009553 Bacteria 22007
57 Ga0105246_10065945 3300011119 Bacteria 2533
58 Ga0163163_11005367 3300014325 Bacteria 897
59 Ga0157379_10453468 3300014968 Bacteria 1184
60 Ga0163161_10000006 3300017792 Bacteria 302708
61 Ga0197907_11081214 3300020069 Bacteria 613
62 Ga0197907_11388647 3300020069 Bacteria 636
63 Ga0206349_1152902 3300020075 Bacteria 672
64 Ga0206355_1183166 3300020076 Bacteria 564
65 Ga0206351_10218240 3300020077 Bacteria 580
66 Ga0206351_10387930 3300020077 Bacteria 558
67 Ga0206351_10926438 3300020077 Bacteria 577
68 Ga0206350_10935296 3300020080 Bacteria 526
69 Ga0206350_11033741 3300020080 Bacteria 505
70 Ga0206350_11636023 3300020080 Bacteria 719
71 Ga0206354_11207549 3300020081 Bacteria 580
72 Ga0206353_10060399 3300020082 Bacteria 576
73 Ga0154015_1027122 3300020610 Bacteria 535
74 Ga0224712_10202095 3300022467 Bacteria 904
75 Ga0224712_10432979 3300022467 Bacteria 630
76 Ga0224712_10510722 3300022467 Bacteria 581
77 Ga0207696_1000046 3300025711 Bacteria 291327
78 Ga0207713_1000418 3300025735 Bacteria 45176
79 Ga0207653_10003556 3300025885 Bacteria 4904
80 Ga0207710_10000024 3300025900 Bacteria 319633
81 Ga0207643_10075325 3300025908 Bacteria 1947
82 Ga0207705_10281814 3300025909 Bacteria 1272
83 Ga0207684_10549988 3300025910 Bacteria 988
84 Ga0207707_10001919 3300025912 Bacteria 18897
85 Ga0207707_10012019 3300025912 Bacteria 7525
86 Ga0207695_10085380 3300025913 Bacteria 3185
87 Ga0207660_10009610 3300025917 Bacteria 6261
88 Ga0207660_10079294 3300025917 Bacteria 2408
89 Ga0207662_10177623 3300025918 Bacteria 1369
90 Ga0207657_10029326 3300025919 Bacteria 5010
91 Ga0207649_10080276 3300025920 Bacteria 2109
92 Ga0207652_10002048 3300025921 Bacteria 17344
93 Ga0207644_11160743 3300025931 Bacteria 649
94 Ga0207706_10033954 3300025933 Bacteria 4541
95 Ga0207706_10134176 3300025933 Bacteria 2177
96 Ga0207706_10294839 3300025933 Bacteria 1414
97 Ga0207670_10727631 3300025936 Bacteria 823
98 Ga0207669_10026026 3300025937 Bacteria 3174
99 Ga0207691_10312278 3300025940 Bacteria 1349
100 Ga0207689_10229903 3300025942 Bacteria 1533
101 Ga0207679_10061814 3300025945 Bacteria 2789
102 Ga0207712_10001558 3300025961 Bacteria 15449
103 Ga0207668_10117469 3300025972 Bacteria 2008
104 Ga0207668_11316153 3300025972 Bacteria 651
105 Ga0207640_10427545 3300025981 Bacteria 1085
106 Ga0207640_11105183 3300025981 Bacteria 701
107 Ga0207678_10022224 3300026067 Bacteria 5557
108 Ga0207678_10141376 3300026067 Bacteria 2054
109 Ga0207702_10878273 3300026078 Bacteria 888
110 Ga0207676_10016665 3300026095 Bacteria 5322
111 Ga0207674_10002654 3300026116 Bacteria 22335
112 Ga0207675_100247112 3300026118 Bacteria 1726
113 Ga0207698_10169677 3300026142 Bacteria 1919
114 Ga0207698_11194934 3300026142 Bacteria 774
115 Ga0209281_1003310 3300027111 Bacteria 5428
116 Ga0268265_10013054 3300028380 Bacteria 5640
117 Ga0268264_10009035 3300028381 Bacteria 8268
118 Ga0310981_1057955 3300029285 Bacteria 573
119 Ga0316579_10238613 3300031691 Bacteria 879
120 Ga0316576_10078527 3300031727 Bacteria 2446
121 Ga0316578_10007591 3300031728 Bacteria 5451
122 Ga0316578_10175293 3300031728 Bacteria 1292
123 Ga0316578_10384073 3300031728 Bacteria 833
124 Ga0307405_10470945 3300031731 Bacteria 1001
125 Ga0307410_10377496 3300031852 Bacteria 1140
126 Ga0307406_10557117 3300031901 Bacteria 939
127 Ga0316580_10028874 3300032139 Bacteria 1715
128 Ga0316593_10004863 3300032168 Bacteria 3494
129 Ga0316593_10006506 3300032168 Bacteria 3156
130 Ga0316593_10055624 3300032168 Unclassified 1345
131 Ga0316593_10068115 3300032168 Unclassified 1227
132 Ga0316593_10087875 3300032168 Bacteria 1092
133 Ga0316593_10101890 3300032168 Bacteria 1019
134 Ga0316593_10112323 3300032168 Bacteria 974
135 Ga0316593_10121737 3300032168 Bacteria 937
136 Ga0316593_10153302 3300032168 Bacteria 839
137 Ga0316593_10166149 3300032168 Bacteria 807
138 Ga0316593_10308802 3300032168 Bacteria 600
139 Ga0316593_10317146 3300032168 Bacteria 592
140 Ga0316593_10326082 3300032168 Bacteria 584
141 Ga0316593_10335614 3300032168 Bacteria 577
142 Ga0316593_10418767 3300032168 Bacteria 519
143 Ga0316592_1031630 3300033524 Bacteria 1153
144 Ga0316592_1044955 3300033524 Bacteria 982
145 Ga0316592_1054023 3300033524 Bacteria 898
146 Ga0316592_1110528 3300033524 Bacteria 635
147 Ga0316592_1110811 3300033524 Bacteria 634
148 Ga0316592_1115617 3300033524 Bacteria 621
149 Ga0316592_1117730 3300033524 Bacteria 616
150 Ga0316592_1119514 3300033524 Bacteria 612
151 Ga0316592_1123398 3300033524 Bacteria 602
152 Ga0316592_1133811 3300033524 Bacteria 579
153 Ga0316592_1136157 3300033524 Unclassified 575
154 Ga0316592_1145575 3300033524 Bacteria 557
155 Ga0316592_1150835 3300033524 Bacteria 548
156 Ga0316592_1180928 3300033524 Bacteria 504
157 Ga0316586_1019024 3300033527 Bacteria 1119
158 Ga0316586_1038902 3300033527 Bacteria 832
159 Ga0316586_1047667 3300033527 Unclassified 763
160 Ga0316586_1050702 3300033527 Bacteria 743
161 Ga0316586_1059288 3300033527 Bacteria 694
162 Ga0316586_1079580 3300033527 Bacteria 611
163 Ga0316586_1082257 3300033527 Bacteria 602
164 Ga0316586_1082569 3300033527 Bacteria 601
165 Ga0316586_1082585 3300033527 Bacteria 601
166 Ga0316586_1083378 3300033527 Bacteria 599
167 Ga0316586_1085830 3300033527 Bacteria 591
168 Ga0316586_1093966 3300033527 Bacteria 568
169 Ga0316586_1094216 3300033527 Bacteria 568
170 Ga0316586_1099434 3300033527 Bacteria 555
171 Ga0316586_1099647 3300033527 Bacteria 555
172 Ga0316588_1063274 3300033528 Bacteria 904
173 Ga0316588_1065271 3300033528 Bacteria 890
174 Ga0316588_1100750 3300033528 Bacteria 723
175 Ga0316588_1122372 3300033528 Bacteria 659
176 Ga0316588_1145059 3300033528 Bacteria 608
177 Ga0316588_1148710 3300033528 Bacteria 601
178 Ga0316588_1173243 3300033528 Bacteria 558
179 Ga0316588_1176645 3300033528 Bacteria 553
180 Ga0316588_1188729 3300033528 Bacteria 537
181 Ga0316587_1045772 3300033529 Bacteria 795
182 Ga0316587_1055005 3300033529 Unclassified 733
183 Ga0316587_1084014 3300033529 Bacteria 604
184 Ga0316587_1089965 3300033529 Bacteria 585
185 Ga0316587_1097912 3300033529 Bacteria 563
186 Ga0316587_1100621 3300033529 Bacteria 556
187 Ga0316587_1102435 3300033529 Bacteria 552
188 Ga0316587_1102628 3300033529 Bacteria 551
189 Ga0316587_1103854 3300033529 Bacteria 548
190 Ga0316587_1105543 3300033529 Bacteria 544
191 Ga0316596_1041651 3300033541 Bacteria 1207
192 Ga0316596_1072918 3300033541 Bacteria 920
193 Ga0316596_1097008 3300033541 Bacteria 796
194 Ga0316596_1130389 3300033541 Bacteria 686
195 Ga0316596_1133247 3300033541 Bacteria 679
196 Ga0316596_1196052 3300033541 Bacteria 561
197 Ga0316596_1196986 3300033541 Bacteria 560
198 Ga0316596_1199504 3300033541 Bacteria 556
199 Ga0316596_1201624 3300033541 Bacteria 554
200 Ga0316596_1209472 3300033541 Unclassified 544
201 Ga0373958_0014900 3300034819 Bacteria 1365
202 Ga0373938_0123588 3300034957 Bacteria 669
203 Ga0316582_0055882 3300036647 Bacteria 2517
204 Ga0316584_0028339 3300036712 Bacteria 4129
205 Ga0316584_0586897 3300036712 Bacteria 774
206 Ga0436360_0448941 3300039438 Bacteria 1091
207 Ga0439432_153672 3300042006 Bacteria 675
208 Ga0439449_0014538 3300042007 Bacteria 2959
209 Ga0495627_000151 3300046453 Bacteria 81610
210 Ga0495664_0503910 3300046477 Bacteria 723
211 Ga0495606_0247963 3300046507 Bacteria 989
212 Ga0495654_0002491 3300046530 Bacteria 11827
213 Ga0495654_0033994 3300046530 Bacteria 2576
214 Ga0495645_0203849 3300046543 Bacteria 1340
215 Ga0495589_0000076 3300046794 Bacteria 91288
216 Ga0495674_0812888 3300047319 Bacteria 726
217 Ga0495684_0713986 3300047471 Bacteria 663
218 Ga0496100_0314211 3300048903 Bacteria 1175
219 Ga0496101_0122120 3300048904 Bacteria 1970
220 Ga0496102_0005114 3300048905 Bacteria 11115
221 Ga0496103_0026739 3300048906 Bacteria 3492
222 Ga0496104_0010725 3300048907 Bacteria 8194
223 Ga0496104_1871131 3300048907 Bacteria 502
224 Ga0496105_0005879 3300048908 Bacteria 9354
225 Ga0496106_0001219 3300048909 Bacteria 19244
226 Ga0496107_0090573 3300048910 Bacteria 2234
227 Ga0496108_0071928 3300048911 Bacteria 2919
228 Ga0496109_1791488 3300048912 Bacteria 547
229 Ga0496110_1729767 3300048913 Bacteria 535
230 Ga0496112_1092672 3300048915 Bacteria 716
231 Ga0496114_0677773 3300048917 Bacteria 905
232 Ga0496115_0138832 3300048918 Bacteria 2004
233 Ga0496115_0211142 3300048918 Bacteria 1603
234 Ga0496116_0000058 3300048919 Bacteria 279767
235 Ga0496117_0012799 3300048920 Bacteria 7358
236 Ga0496118_0004225 3300048921 Bacteria 17234
237 Ga0496120_0081921 3300048923 Bacteria 1745
238 Ga0496121_0504529 3300048924 Bacteria 767
239 Ga0496123_0102138 3300048926 Bacteria 1665
240 Ga0496125_0533804 3300048928 Bacteria 653
241 Ga0501032_0074513 3300049569 Bacteria 2261
242 Ga0501033_0678596 3300049570 Bacteria 702
243 Ga0501034_1011684 3300049571 Bacteria 715
244 Ga0501036_0217731 3300049572 Bacteria 1603
245 Ga0501037_0869043 3300049573 Bacteria 592
246 Ga0501040_0117060 3300049576 Bacteria 1867
247 Ga0501040_1024031 3300049576 Bacteria 599
248 Ga0501041_0116620 3300049577 Bacteria 1658
249 Ga0501041_0140333 3300049577 Bacteria 1507
250 Ga0501046_0080779 3300049580 Bacteria 2512
251 Ga0501048_0040952 3300049582 Bacteria 3319
252 Ga0501048_0095613 3300049582 Bacteria 2095
253 Ga0501048_0748517 3300049582 Bacteria 702
254 Ga0501072_0047135 3300049588 Bacteria 3394
255 Ga0501072_0438041 3300049588 Bacteria 1035
256 Ga0501073_0726973 3300049589 Bacteria 685
257 Ga0501074_0630491 3300049590 Bacteria 758
258 Ga0501075_0125140 3300049591 Bacteria 1957
259 Ga0501075_0238274 3300049591 Bacteria 1387
260 Ga0501075_0760530 3300049591 Bacteria 737
261 Ga0501076_0075060 3300049592 Bacteria 2710
262 Ga0501076_0530368 3300049592 Bacteria 971
263 Ga0501076_0866626 3300049592 Bacteria 745
264 Ga0501077_0009466 3300049593 Bacteria 6056
265 Ga0501077_0079206 3300049593 Bacteria 2082
266 Ga0501079_0158001 3300049741 Bacteria 1767
267 Ga0501079_0868343 3300049741 Bacteria 710
268 Ga0501081_0068879 3300049743 Bacteria 2464
269 Ga0501081_0099014 3300049743 Bacteria 2059
270 Ga0501081_0897403 3300049743 Bacteria 668
271 Ga0501083_0157395 3300049744 Bacteria 1487
272 Ga0501083_0618679 3300049744 Bacteria 704
273 Ga0501035_0737606 3300049822 Bacteria 791
274 Ga0501045_0034916 3300049824 Bacteria 3651
275 Ga0501045_0117192 3300049824 Bacteria 1977
276 Ga0501045_0895378 3300049824 Bacteria 652
277 nmdc:mga06r32_462275_c1 3300050510 Bacteria 1248
278 Ga0495601_0227363 3300053077 Bacteria 1219
279 Ga0500555_084874 3300053103 Bacteria 820
280 Ga0500620_243799 3300053155 Bacteria 600
281 Ga0501084_1229592 3300054114 Bacteria 628
282 Ga0501084_1282284 3300054114 Bacteria 614
283 Ga0501084_1535105 3300054114 Bacteria 557
284 Ga0587069_117734 3300059642 Bacteria 560
285 Ga0587069_132994 3300059642 Bacteria 538
286 Ga0501082_0000040 3300060353 Bacteria 91596
287 Ga0501082_0271626 3300060353 Bacteria 1476
288 Ga0501082_0460418 3300060353 Bacteria 1111
289 Ga0501082_0899622 3300060353 Bacteria 774
290 Ga0530510_0026532 3300061734 Bacteria 4147
291 Ga0530510_0320883 3300061734 Bacteria 1161
292 Ga0530510_0451012 3300061734 Bacteria 972
293 Ga0530510_1083761 3300061734 Bacteria 614
294 2506576016 2506520007 Bacteria 5442880
295 2506581154 2506520008 Bacteria 5443009
296 2507504330 2507262055 Bacteria 8048963
297 2508545764 2508501009 Bacteria 7784016
298 2508694589 2508501042 Bacteria 8719808
299 2508849966 2508501071 Bacteria 5454741
300 2513624498 2513237092 Bacteria 8341956
301 2515624482 2515154112 Bacteria 8294334
302 2603860614 2602042107 Bacteria 6226103
303 2656277092 2654587920 Bacteria 5475511
304 2689442446 2687453601 Bacteria 5546041
305 2807178626 2806310673 Bacteria 4801221
306 2852106645 2852103415 Bacteria 5193810
307 2857525572 2857524615 Bacteria 6615449
308 2869551843 2869551831 Bacteria 5474685
309 2874595713 2874590934 Bacteria 8299676
310 2874651655 2874645413 Bacteria 8214782
311 2876775908 2876771140 Bacteria 8287509
312 2876821550 2876818435 Bacteria 8274608
313 2879079999 2879074833 Bacteria 8279565
314 2879134082 2879127579 Bacteria 8294491
315 2879148567 2879142872 Bacteria 8267021
316 2906633078 2906626472 Bacteria 8826946
317 2919074620 2919073203 Bacteria 6531949
318 2924198889 2924193448 Bacteria 6955718
319 2932409902 2932406140 Bacteria 5134491
320 2935613255 2935608549 Bacteria 8203142
321 2935656631 2935648319 Bacteria 8801166
322 2935665445 2935656913 Bacteria 8965014
323 2935824891 2935819856 Bacteria 8261050
324 2935852111 2935847175 Bacteria 8228321
325 2935911458 2935908558 Bacteria 8568796
326 2935920993 2935916978 Bacteria 9113783
327 2935928487 2935926038 Bacteria 8601059
328 2935938132 2935934488 Bacteria 8602579
329 2935945414 2935942939 Bacteria 8599779
330 2935954080 2935951376 Bacteria 8602333
331 2935971652 2935967501 Bacteria 8603075
332 2935980056 2935975950 Bacteria 8347125
333 2935989484 2935984226 Bacteria 8302647
334 2936019494 2936011229 Bacteria 8801034
335 2936028096 2936019824 Bacteria 8804134
336 2936036930 2936028420 Bacteria 8965941
337 2936054953 2936046547 Bacteria 8903709
338 2936060740 2936055302 Bacteria 8785755
339 2939580961 2939577877 Bacteria 5132791
340 640935534 640753048 Bacteria 5495657
341 8016587701 8016583857 Bacteria 10421953
342 8016636934 8016630954 Bacteria 9217207
343 8019623894 8019619141 Bacteria 9218857
344 8019638147 8019629233 Bacteria 8687553
345 8019666062 8019659431 Bacteria 8577854
346 8019675579 8019668869 Bacteria 8791617
347 8019680520 8019678201 Bacteria 8863603
348 8055693956 8055693939 Bacteria 4772047
349 Ga0316593_10352136
350 Ga0007429J51699_1018786
351 Ga0007429J51699_1067155
352 Ga0065703_1018787
353 Ga0070690_100146414
354 Ga0070670_100881728
355 Ga0070680_100002263
356 Ga0070680_100006196
357 Ga0070689_100503433
358 Ga0070691_10008826
359 Ga0070687_100149410
360 Ga0070668_100228043
361 Ga0070659_100149040
362 Ga0070703_10004916
363 Ga0070705_100000168
364 Ga0070700_100000622
365 Ga0070694_100002378
366 Ga0070708_100275519
367 Ga0070663_100002036
368 Ga0070662_100054886
369 Ga0070662_100717363
370 Ga0070681_10001440
371 Ga0070681_10072262
372 Ga0070698_100086738
373 Ga0070698_100213528
374 Ga0070699_100000299
375 Ga0070679_100010942
376 Ga0070684_101351316
377 Ga0070697_100010682
378 Ga0068853_100535677
379 Ga0070695_100001801
380 Ga0070696_100000036
381 Ga0070693_100707314
382 Ga0070704_100001096
383 Ga0068855_100396041
384 Ga0070664_100101132
385 Ga0070664_100518303
386 Ga0068857_100004383
387 Ga0068854_100308105
388 Ga0068854_100950285
389 Ga0068859_100003711
390 Ga0068864_100002987
391 Ga0068861_101332433
392 Ga0068870_10068174
393 Ga0068860_100010953
394 Ga0068862_100001757
395 Ga0081539_10126050
396 Ga0075363_100107128
397 Ga0097620_100003711
398 Ga0079104_1002630
399 Ga0105247_10001859
400 Ga0105243_10160232
401 Ga0105243_10925387
402 Ga0105237_10807940
403 Ga0105238_11364908
404 Ga0105249_10001285
405 Ga0105246_10065945
406 Ga0163163_11005367
407 Ga0157379_10453468
408 Ga0163161_10000006
409 Ga0197907_11081214
410 Ga0197907_11388647
411 Ga0206349_1152902
412 Ga0206355_1183166
413 Ga0206351_10218240
414 Ga0206351_10387930
415 Ga0206351_10926438
416 Ga0206350_10935296
417 Ga0206350_11033741
418 Ga0206350_11636023
419 Ga0206354_11207549
420 Ga0206353_10060399
421 Ga0154015_1027122
422 Ga0224712_10202095
423 Ga0224712_10432979
424 Ga0224712_10510722
425 Ga0207696_1000046
426 Ga0207713_1000418
427 Ga0207653_10003556
428 Ga0207710_10000024
429 Ga0207643_10075325
430 Ga0207705_10281814
431 Ga0207684_10549988
432 Ga0207707_10001919
433 Ga0207707_10012019
434 Ga0207695_10085380
435 Ga0207660_10009610
436 Ga0207660_10079294
437 Ga0207662_10177623
438 Ga0207657_10029326
439 Ga0207649_10080276
440 Ga0207652_10002048
441 Ga0207644_11160743
442 Ga0207706_10033954
443 Ga0207706_10134176
444 Ga0207706_10294839
445 Ga0207670_10727631
446 Ga0207669_10026026
447 Ga0207691_10312278
448 Ga0207689_10229903
449 Ga0207679_10061814
450 Ga0207712_10001558
451 Ga0207668_10117469
452 Ga0207668_11316153
453 Ga0207640_10427545
454 Ga0207640_11105183
455 Ga0207678_10022224
456 Ga0207678_10141376
457 Ga0207702_10878273
458 Ga0207676_10016665
459 Ga0207674_10002654
460 Ga0207675_100247112
461 Ga0207698_10169677
462 Ga0207698_11194934
463 Ga0209281_1003310
464 Ga0268265_10013054
465 Ga0268264_10009035
466 Ga0310981_1057955
467 Ga0316579_10238613
468 Ga0316576_10078527
469 Ga0316578_10007591
470 Ga0316578_10175293
471 Ga0316578_10384073
472 Ga0307405_10470945
473 Ga0307410_10377496
474 Ga0307406_10557117
475 Ga0316580_10028874
476 Ga0316593_10004863
477 Ga0316593_10006506
478 Ga0316593_10055624
479 Ga0316593_10068115
480 Ga0316593_10087875
481 Ga0316593_10101890
482 Ga0316593_10112323
483 Ga0316593_10121737
484 Ga0316593_10153302
485 Ga0316593_10166149
486 Ga0316593_10308802
487 Ga0316593_10317146
488 Ga0316593_10326082
489 Ga0316593_10335614
490 Ga0316593_10418767
491 Ga0316592_1031630
492 Ga0316592_1044955
493 Ga0316592_1054023
494 Ga0316592_1110528
495 Ga0316592_1110811
496 Ga0316592_1115617
497 Ga0316592_1117730
498 Ga0316592_1119514
499 Ga0316592_1123398
500 Ga0316592_1133811
501 Ga0316592_1136157
502 Ga0316592_1145575
503 Ga0316592_1150835
504 Ga0316592_1180928
505 Ga0316586_1019024
506 Ga0316586_1038902
507 Ga0316586_1047667
508 Ga0316586_1050702
509 Ga0316586_1059288
510 Ga0316586_1079580
511 Ga0316586_1082257
512 Ga0316586_1082569
513 Ga0316586_1082585
514 Ga0316586_1083378
515 Ga0316586_1085830
516 Ga0316586_1093966
517 Ga0316586_1094216
518 Ga0316586_1099434
519 Ga0316586_1099647
520 Ga0316588_1063274
521 Ga0316588_1065271
522 Ga0316588_1100750
523 Ga0316588_1122372
524 Ga0316588_1145059
525 Ga0316588_1148710
526 Ga0316588_1173243
527 Ga0316588_1176645
528 Ga0316588_1188729
529 Ga0316587_1045772
530 Ga0316587_1055005
531 Ga0316587_1084014
532 Ga0316587_1089965
533 Ga0316587_1097912
534 Ga0316587_1100621
535 Ga0316587_1102435
536 Ga0316587_1102628
537 Ga0316587_1103854
538 Ga0316587_1105543
539 Ga0316596_1041651
540 Ga0316596_1072918
541 Ga0316596_1097008
542 Ga0316596_1130389
543 Ga0316596_1133247
544 Ga0316596_1196052
545 Ga0316596_1196986
546 Ga0316596_1199504
547 Ga0316596_1201624
548 Ga0316596_1209472
549 Ga0373958_0014900
550 Ga0373938_0123588
551 Ga0316582_0055882
552 Ga0316584_0028339
553 Ga0316584_0586897
554 Ga0436360_0448941
555 Ga0439432_153672
556 Ga0439449_0014538
557 Ga0495627_000151
558 Ga0495664_0503910
559 Ga0495606_0247963
560 Ga0495654_0002491
561 Ga0495654_0033994
562 Ga0495645_0203849
563 Ga0495589_0000076
564 Ga0495674_0812888
565 Ga0495684_0713986
566 Ga0496100_0314211
567 Ga0496101_0122120
568 Ga0496102_0005114
569 Ga0496103_0026739
570 Ga0496104_0010725
571 Ga0496104_1871131
572 Ga0496105_0005879
573 Ga0496106_0001219
574 Ga0496107_0090573
575 Ga0496108_0071928
576 Ga0496109_1791488
577 Ga0496110_1729767
578 Ga0496112_1092672
579 Ga0496114_0677773
580 Ga0496115_0138832
581 Ga0496115_0211142
582 Ga0496116_0000058
583 Ga0496117_0012799
584 Ga0496118_0004225
585 Ga0496120_0081921
586 Ga0496121_0504529
587 Ga0496123_0102138
588 Ga0496125_0533804
589 Ga0501032_0074513
590 Ga0501033_0678596
591 Ga0501034_1011684
592 Ga0501036_0217731
593 Ga0501037_0869043
594 Ga0501040_0117060
595 Ga0501040_1024031
596 Ga0501041_0116620
597 Ga0501041_0140333
598 Ga0501046_0080779
599 Ga0501048_0040952
600 Ga0501048_0095613
601 Ga0501048_0748517
602 Ga0501072_0047135
603 Ga0501072_0438041
604 Ga0501073_0726973
605 Ga0501074_0630491
606 Ga0501075_0125140
607 Ga0501075_0238274
608 Ga0501075_0760530
609 Ga0501076_0075060
610 Ga0501076_0530368
611 Ga0501076_0866626
612 Ga0501077_0009466
613 Ga0501077_0079206
614 Ga0501079_0158001
615 Ga0501079_0868343
616 Ga0501081_0068879
617 Ga0501081_0099014
618 Ga0501081_0897403
619 Ga0501083_0157395
620 Ga0501083_0618679
621 Ga0501035_0737606
622 Ga0501045_0034916
623 Ga0501045_0117192
624 Ga0501045_0895378
625 nmdc:mga06r32_462275_c1
626 Ga0495601_0227363
627 Ga0500555_084874
628 Ga0500620_243799
629 Ga0501084_1229592
630 Ga0501084_1282284
631 Ga0501084_1535105
632 Ga0587069_117734
633 Ga0587069_132994
634 Ga0501082_0000040
635 Ga0501082_0271626
636 Ga0501082_0460418
637 Ga0501082_0899622
638 Ga0530510_0026532
639 Ga0530510_0320883
640 Ga0530510_0451012
641 Ga0530510_1083761
642 2506576016
643 2506581154
644 2507504330
645 2508545764
646 2508694589
647 2508849966
648 2513624498
649 2515624482
650 2603860614
651 2656277092
652 2689442446
653 2807178626
654 2852106645
655 2857525572
656 2869551843
657 2874595713
658 2874651655
659 2876775908
660 2876821550
661 2879079999
662 2879134082
663 2879148567
664 2906633078
665 2919074620
666 2924198889
667 2932409902
668 2935613255
669 2935656631
670 2935665445
671 2935824891
672 2935852111
673 2935911458
674 2935920993
675 2935928487
676 2935938132
677 2935945414
678 2935954080
679 2935971652
680 2935980056
681 2935989484
682 2936019494
683 2936028096
684 2936036930
685 2936054953
686 2936060740
687 2939580961
688 640935534
689 8016587701
690 8016636934
691 8019623894
692 8019638147
693 8019666062
694 8019675579
695 8019680520
696 8055693956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

57

158

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zjd-assembly1.cif.gz_A small heat shock protein agsa from salmonella typhimurium: truncations at n- and c- termini 0.8089 35 126
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.7876 35 125
4zjd-assembly1.cif.gz_A small heat shock protein agsa from salmonella typhimurium: truncations at n- and c- termini 0.7866 35 126
5zul-assembly1.cif.gz_C-2 small heat shock protein from mycobacterium marinum m : form-3 0.7854 35 127
7ck4-assembly1.cif.gz_F structural and functional analysis of small heat shock protein from synechococcus phage s-shm2 0.7848 35 129
ID Description Score Start End Superfamily
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8921 33 140 2.60.40.790
af_P0C054_33_137_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8841 33 140 2.60.40.790
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8681 35 126 2.60.40.790
4zj9A00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8453 35 126 2.60.40.790
af_C0PJF1_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8343 35 129 2.60.40.790
ID Description Score Start End GO Terms
AF-F3KHI5-F1-model_v4 16 kDa heat shock protein A 0.8259 43 144
AF-A0A836NRI7-F1-model_v4 deleted 0.8232 26 148
AF-A0A7W4VLU8-F1-model_v4 Molecular chaperone IbpA 0.8081 31 148
AF-A0A7W4G6I5-F1-model_v4 deleted 0.8012 10 141
AF-E3DKN1-F1-model_v4 deleted 0.7907 1 141

Map