F417674

General Info

Members Datasets Scaffolds Average Seq Length
348 205 696 425

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0000470|Ga0495597_0000470_20698_22182
Length 494
Sequence LSSCCLGPSLLCSVFARLTPGLFFARSIVGAAPHLLRFAQQVRLWLRLLQMPTTLNFQSHAIANNNRNIPVSNLIDVVNLDASPADLVQPDRVHTSLYTDPKLFDAELEKIFYSTWVWVAHASEIPEAGSYKSTFIGKQPVIVARDRKKQVHVLLNRCRHRGATVCEHKKGKTNSFVCPYHGWSYALDGSLRGVPHPESYGDCLDKSELPLVSLRVEEYAGMLFATFKDDIEPLTDFLGPAKKWIDLFMKQGAGYPIKVPGEHRFRFPGNWKIQLENTTDAYHFPLVHKSFLSSVDEETLKLFDFVEGPGYVEDLGNGHSVMVMIPDLVDLEADLDRPVPERFEGLAAELRDEGIDEQQVRRIVRAVGGSGFNLNLFPNVACSMAFFRVLQPISVTETEIHHSVITMDGGPATANRYRLRLHEHFQGPMGFGTPDDSEAWERVQKGATAGEDLWIMLNRGLPGEKPSEDGLVSDVSAETGMRAAYQQWKKMMSA

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
14 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
15 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
27 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
47 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
54 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
55 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
56 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
59 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
60 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
61 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
62 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
63 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
64 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
65 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
66 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
69 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
70 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
71 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
133 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
139 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
140 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
143 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
146 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
147 2511231006 Pseudomonas sp. GM17 Isolate Nodule
148 2511231024 Pseudomonas sp. GM84 Isolate Nodule
149 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
150 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
151 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
152 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
153 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
154 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
155 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
156 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
157 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
158 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
159 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
160 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
161 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
162 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
163 2643221698 Ensifer sp. Root142 Isolate Unclassified
164 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
165 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
166 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
167 2765235841 Pseudomonas putida AA7 Isolate Unclassified
168 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
169 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
170 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
171 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
172 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
173 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
174 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
175 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
176 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
177 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
178 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
179 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
180 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
181 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
182 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
183 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
184 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
185 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
186 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
187 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
188 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
189 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
190 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
191 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
192 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
193 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
194 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
195 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
196 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
197 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
198 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
199 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
200 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
201 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
202 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
203 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
204 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
205 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.18
Metatranscriptomes 0
Isolates 17.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.31
Nodule 1.44
Rhizoplane 5.17
Rhizosphere 74.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0000470 3300046542 Bacteria 34242
2 SwRhRL2b_contig_1088933 2162886007 Bacteria 16763
3 SwRhRL2b_contig_1307124 2162886007 Bacteria 6199
4 SwRhRL2b_contig_1984320 2162886007 Bacteria 5379
5 SwRhRL2b_contig_590714 2162886007 Bacteria 8484
6 Ga0055529_1000045 3300003763 Bacteria 209617
7 Ga0058692_1000159 3300003856 Bacteria 42231
8 Ga0058692_1016783 3300003856 Bacteria 1618
9 Ga0065704_10000407 3300005289 Bacteria 28477
10 Ga0065704_10000897 3300005289 Bacteria 24622
11 Ga0065704_10072276 3300005289 Bacteria 8812
12 Ga0070670_100000034 3300005331 Bacteria 158067
13 Ga0070669_100001319 3300005353 Bacteria 17892
14 Ga0070667_100000117 3300005367 Bacteria 100684
15 Ga0070663_100248065 3300005455 Bacteria 1408
16 Ga0068863_100000055 3300005841 Bacteria 124300
17 Ga0068860_100003129 3300005843 Bacteria 17098
18 Ga0068860_100227776 3300005843 Bacteria 1811
19 Ga0075364_10000702 3300006051 Bacteria 17520
20 Ga0075364_10085112 3300006051 Bacteria 2094
21 Ga0079104_1000538 3300006946 Bacteria 39908
22 Ga0079104_1007126 3300006946 Bacteria 4111
23 Ga0105251_10000182 3300009011 Bacteria 63096
24 Ga0105251_10000200 3300009011 Bacteria 60751
25 Ga0105251_10000445 3300009011 Bacteria 39997
26 Ga0105251_10000679 3300009011 Bacteria 31356
27 Ga0105251_10006948 3300009011 Bacteria 7089
28 Ga0105251_10032973 3300009011 Bacteria 2576
29 Ga0105251_10066516 3300009011 Bacteria 1685
30 Ga0105244_10000055 3300009036 Bacteria 130164
31 Ga0105244_10000359 3300009036 Bacteria 42409
32 Ga0105244_10000396 3300009036 Bacteria 40375
33 Ga0105244_10000529 3300009036 Bacteria 34041
34 Ga0105244_10006999 3300009036 Bacteria 7217
35 Ga0105244_10010474 3300009036 Bacteria 5622
36 Ga0105244_10010758 3300009036 Bacteria 5527
37 Ga0105244_10011837 3300009036 Bacteria 5199
38 Ga0105250_10000027 3300009092 Bacteria 212624
39 Ga0105250_10000047 3300009092 Bacteria 124276
40 Ga0105250_10000352 3300009092 Bacteria 35185
41 Ga0105247_10000484 3300009101 Bacteria 33206
42 Ga0105243_10001286 3300009148 Bacteria 22512
43 Ga0105241_10040557 3300009174 Bacteria 3515
44 Ga0105238_10001202 3300009551 Bacteria 26102
45 Ga0105239_10011703 3300010375 Bacteria 9791
46 Ga0157373_10000346 3300013100 Bacteria 37499
47 Ga0157371_10000591 3300013102 Bacteria 43094
48 Ga0157371_10003837 3300013102 Bacteria 13414
49 Ga0157369_10001348 3300013105 Bacteria 30330
50 Ga0163162_10000741 3300013306 Bacteria 30330
51 Ga0163162_10000867 3300013306 Bacteria 28167
52 Ga0182008_10001651 3300014497 Bacteria 14743
53 Ga0182006_1026295 3300015261 Bacteria 2383
54 Ga0182007_10000469 3300015262 Bacteria 24401
55 Ga0182007_10000520 3300015262 Bacteria 22665
56 Ga0163161_10000665 3300017792 Bacteria 27470
57 Ga0163161_10007077 3300017792 Bacteria 7760
58 Ga0163161_10008322 3300017792 Bacteria 7183
59 Ga0209148_1000011 3300025254 Bacteria 1196503
60 Ga0209455_1000006 3300025272 Bacteria 1196503
61 Ga0207696_1000008 3300025711 Bacteria 568181
62 Ga0207696_1000012 3300025711 Bacteria 527363
63 Ga0207696_1000017 3300025711 Bacteria 491130
64 Ga0207696_1000305 3300025711 Bacteria 56307
65 Ga0207696_1000855 3300025711 Bacteria 19090
66 Ga0207696_1001068 3300025711 Bacteria 16170
67 Ga0207696_1001140 3300025711 Bacteria 15319
68 Ga0207655_1000001 3300025728 Bacteria 1866413
69 Ga0207655_1000004 3300025728 Bacteria 1021221
70 Ga0207655_1000006 3300025728 Bacteria 861092
71 Ga0207655_1000497 3300025728 Bacteria 50628
72 Ga0207655_1000555 3300025728 Bacteria 46637
73 Ga0207655_1000626 3300025728 Bacteria 42454
74 Ga0207655_1000627 3300025728 Bacteria 42405
75 Ga0207655_1009558 3300025728 Bacteria 6007
76 Ga0207655_1028141 3300025728 Bacteria 2658
77 Ga0207713_1000004 3300025735 Bacteria 702781
78 Ga0207713_1000025 3300025735 Bacteria 322749
79 Ga0207713_1000168 3300025735 Bacteria 95191
80 Ga0207713_1000611 3300025735 Bacteria 35138
81 Ga0207713_1002338 3300025735 Bacteria 13924
82 Ga0207713_1011730 3300025735 Bacteria 4736
83 Ga0207713_1026983 3300025735 Bacteria 2617
84 Ga0207710_10000257 3300025900 Bacteria 43901
85 Ga0207654_10084956 3300025911 Bacteria 1914
86 Ga0207671_10062535 3300025914 Bacteria 2764
87 Ga0207681_10052306 3300025923 Bacteria 2769
88 Ga0207694_10018925 3300025924 Bacteria 5205
89 Ga0207650_10000066 3300025925 Bacteria 140329
90 Ga0207709_10000001 3300025935 Bacteria 2228154
91 Ga0207709_10001093 3300025935 Bacteria 19872
92 Ga0207668_10000092 3300025972 Bacteria 66323
93 Ga0207658_10000087 3300025986 Bacteria 100698
94 Ga0207702_10258789 3300026078 Bacteria 1638
95 Ga0207641_10000307 3300026088 Bacteria 61051
96 Ga0209281_1000004 3300027111 Bacteria 1253949
97 Ga0209371_1000008 3300027312 Bacteria 1024606
98 Ga0209371_1000073 3300027312 Bacteria 199474
99 Ga0268264_10009689 3300028381 Bacteria 7979
100 Ga0268264_10247708 3300028381 Bacteria 1654
101 Ga0307515_10007320 3300028794 Bacteria 21845
102 Ga0268256_1000009 3300030500 Bacteria 1022625
103 Ga0268256_1000125 3300030500 Bacteria 110255
104 Ga0307412_10006495 3300031911 Bacteria 6614
105 Ga0395905_0002579 3300037471 Bacteria 19952
106 Ga0395905_0014352 3300037471 Bacteria 7570
107 Ga0439436_0011235 3300041404 Bacteria 2720
108 Ga0439438_000424 3300041405 Bacteria 19105
109 Ga0439438_000654 3300041405 Bacteria 15596
110 Ga0439438_016046 3300041405 Bacteria 2186
111 Ga0439447_000716 3300041407 Bacteria 12283
112 Ga0439447_002411 3300041407 Bacteria 6829
113 Ga0439447_002952 3300041407 Bacteria 6094
114 Ga0439466_0000122 3300041411 Bacteria 30512
115 Ga0439466_0000241 3300041411 Bacteria 21431
116 Ga0439466_0000249 3300041411 Bacteria 21305
117 Ga0439466_0030387 3300041411 Bacteria 1853
118 Ga0439432_000169 3300042006 Bacteria 22777
119 Ga0439432_002387 3300042006 Bacteria 7088
120 Ga0439451_000005 3300042009 Bacteria 95541
121 Ga0439451_000028 3300042009 Bacteria 31600
122 Ga0439452_000616 3300042010 Bacteria 17978
123 Ga0439452_000819 3300042010 Bacteria 14476
124 Ga0439456_000185 3300042013 Bacteria 18162
125 Ga0439456_000235 3300042013 Bacteria 14847
126 Ga0439456_001187 3300042013 Bacteria 5173
127 Ga0439463_000253 3300042016 Bacteria 14846
128 Ga0450902_002775 3300042137 Bacteria 2503
129 Ga0439446_0010985 3300042156 Bacteria 2449
130 Ga0439434_0000003 3300042435 Bacteria 66445
131 Ga0439460_0001801 3300042461 Bacteria 5101
132 Ga0450893_0010343 3300042532 Bacteria 1532
133 Ga0466968_0005440 3300044735 Bacteria 4765
134 Ga0495627_000010 3300046453 Bacteria 381168
135 Ga0495627_002095 3300046453 Bacteria 10130
136 Ga0495603_0015512 3300046455 Bacteria 4612
137 Ga0495590_0001561 3300046457 Bacteria 9820
138 Ga0495591_000002 3300046458 Bacteria 455013
139 Ga0495591_000053 3300046458 Bacteria 135500
140 Ga0495591_000077 3300046458 Bacteria 109433
141 Ga0495591_000098 3300046458 Bacteria 99757
142 Ga0495591_000776 3300046458 Bacteria 22981
143 Ga0495638_0000959 3300046460 Bacteria 29262
144 Ga0495653_0000284 3300046463 Bacteria 41113
145 Ga0495650_0002177 3300046471 Bacteria 16573
146 Ga0495650_0002736 3300046471 Bacteria 13635
147 Ga0495650_0012424 3300046471 Bacteria 4583
148 Ga0495605_0000324 3300046474 Bacteria 49042
149 Ga0495605_0000781 3300046474 Bacteria 22856
150 Ga0495605_0003008 3300046474 Bacteria 10181
151 Ga0495664_0003662 3300046477 Bacteria 8374
152 Ga0495584_0000066 3300046491 Bacteria 75173
153 Ga0495585_0002114 3300046492 Bacteria 14514
154 Ga0495596_0030792 3300046500 Bacteria 2146
155 Ga0495607_0000047 3300046501 Bacteria 121696
156 Ga0495607_0000136 3300046501 Bacteria 77992
157 Ga0495607_0000199 3300046501 Bacteria 63824
158 Ga0495607_0005437 3300046501 Bacteria 9123
159 Ga0495607_0010421 3300046501 Bacteria 6250
160 Ga0495607_0030205 3300046501 Bacteria 3329
161 Ga0495607_0037249 3300046501 Bacteria 2923
162 Ga0495583_0000110 3300046506 Bacteria 138380
163 Ga0495583_0000978 3300046506 Bacteria 32813
164 Ga0495583_0001442 3300046506 Bacteria 24147
165 Ga0495583_0019637 3300046506 Bacteria 3522
166 Ga0495606_0002468 3300046507 Bacteria 21427
167 Ga0495606_0034838 3300046507 Bacteria 3450
168 Ga0495610_0030390 3300046512 Bacteria 2832
169 Ga0495616_0045772 3300046513 Bacteria 2213
170 Ga0495620_0000930 3300046515 Bacteria 17985
171 Ga0495631_0000222 3300046518 Bacteria 39049
172 Ga0495632_0000111 3300046519 Bacteria 83663
173 Ga0495632_0005200 3300046519 Bacteria 8679
174 Ga0495632_0013458 3300046519 Bacteria 4669
175 Ga0495637_0001782 3300046520 Bacteria 12317
176 Ga0495637_0003901 3300046520 Bacteria 7824
177 Ga0495637_0014352 3300046520 Bacteria 3737
178 Ga0495643_0000021 3300046522 Bacteria 293465
179 Ga0495643_0001059 3300046522 Bacteria 27569
180 Ga0495643_0001208 3300046522 Bacteria 25052
181 Ga0495648_0000015 3300046524 Bacteria 285838
182 Ga0495648_0000582 3300046524 Bacteria 39114
183 Ga0495654_0018736 3300046530 Bacteria 3624
184 Ga0495609_0000014 3300046538 Bacteria 326023
185 Ga0495597_0000011 3300046542 Bacteria 221377
186 Ga0495597_0001260 3300046542 Bacteria 18706
187 Ga0495633_0005152 3300046558 Bacteria 8097
188 Ga0495633_0012172 3300046558 Bacteria 4590
189 Ga0495668_0006173 3300046616 Bacteria 7929
190 Ga0495661_0000048 3300046665 Bacteria 144678
191 Ga0495588_0075183 3300046674 Bacteria 1759
192 Ga0495671_0000004 3300046692 Bacteria 545630
193 Ga0495671_0000017 3300046692 Bacteria 293465
194 Ga0495671_0000073 3300046692 Bacteria 97167
195 Ga0495671_0001603 3300046692 Bacteria 14934
196 Ga0495671_0003483 3300046692 Bacteria 9654
197 Ga0495649_0000633 3300046694 Bacteria 28694
198 Ga0495649_0001553 3300046694 Bacteria 17226
199 Ga0495649_0002267 3300046694 Bacteria 13672
200 Ga0495660_0000142 3300046810 Bacteria 77290
201 Ga0495660_0000296 3300046810 Bacteria 45599
202 Ga0495660_0000359 3300046810 Bacteria 40179
203 Ga0495660_0000371 3300046810 Bacteria 39393
204 Ga0495674_0031057 3300047319 Bacteria 4855
205 Ga0495672_0024941 3300047320 Bacteria 3840
206 Ga0495676_0027251 3300047321 Bacteria 4902
207 Ga0495679_000662 3300047446 Bacteria 22840
208 Ga0495679_002661 3300047446 Bacteria 8945
209 Ga0495673_0000007 3300047469 Bacteria 796722
210 Ga0495673_0000021 3300047469 Bacteria 545523
211 Ga0495673_0000106 3300047469 Bacteria 170429
212 Ga0495673_0000383 3300047469 Bacteria 52691
213 Ga0495673_0001035 3300047469 Bacteria 24507
214 Ga0495681_0000562 3300047470 Bacteria 28361
215 Ga0495681_0001648 3300047470 Bacteria 16572
216 Ga0495681_0006734 3300047470 Bacteria 7494
217 Ga0495681_0007342 3300047470 Bacteria 7057
218 Ga0495681_0042298 3300047470 Bacteria 2206
219 Ga0495686_0000057 3300047472 Bacteria 250088
220 Ga0495615_0000007 3300048090 Bacteria 90892
221 Ga0496100_0006609 3300048903 Bacteria 6336
222 Ga0496102_0011594 3300048905 Bacteria 7606
223 Ga0496104_0000359 3300048907 Bacteria 40640
224 Ga0496104_0001087 3300048907 Bacteria 23229
225 Ga0496105_0007449 3300048908 Bacteria 8473
226 Ga0496105_0009047 3300048908 Bacteria 7772
227 Ga0496105_0159939 3300048908 Bacteria 1849
228 Ga0496110_0010413 3300048913 Bacteria 7560
229 Ga0496114_0002057 3300048917 Bacteria 15311
230 Ga0496116_0006932 3300048919 Bacteria 10161
231 Ga0496117_0001913 3300048920 Bacteria 27918
232 Ga0496117_0003714 3300048920 Bacteria 17528
233 Ga0496117_0021833 3300048920 Bacteria 5160
234 Ga0496118_0002100 3300048921 Bacteria 27975
235 Ga0496118_0003670 3300048921 Bacteria 19046
236 Ga0496118_0028613 3300048921 Bacteria 4689
237 Ga0496118_0124902 3300048921 Bacteria 1668
238 Ga0496119_0001724 3300048922 Bacteria 25500
239 Ga0496119_0034310 3300048922 Bacteria 3345
240 Ga0496120_0000755 3300048923 Bacteria 46782
241 Ga0496120_0007871 3300048923 Bacteria 7852
242 Ga0496121_0001323 3300048924 Bacteria 42412
243 Ga0496121_0008087 3300048924 Bacteria 12517
244 Ga0496121_0008186 3300048924 Bacteria 12412
245 Ga0496122_0001631 3300048925 Bacteria 35009
246 Ga0496122_0021825 3300048925 Bacteria 5714
247 Ga0496122_0030517 3300048925 Bacteria 4514
248 Ga0496122_0088385 3300048925 Bacteria 2124
249 Ga0496123_0007394 3300048926 Bacteria 10372
250 Ga0496123_0015173 3300048926 Bacteria 6337
251 Ga0496124_0005385 3300048927 Bacteria 14446
252 Ga0496124_0016523 3300048927 Bacteria 7009
253 Ga0496125_0001961 3300048928 Bacteria 28021
254 Ga0496125_0003424 3300048928 Bacteria 19241
255 Ga0496126_0001776 3300048929 Bacteria 31898
256 Ga0496126_0014637 3300048929 Bacteria 7918
257 Ga0496126_0025551 3300048929 Bacteria 5679
258 Ga0496126_0055333 3300048929 Bacteria 3590
259 Ga0495678_001320 3300049459 Bacteria 19879
260 Ga0501032_0016465 3300049569 Bacteria 5200
261 Ga0501034_0008457 3300049571 Bacteria 10870
262 Ga0501034_0100983 3300049571 Bacteria 2879
263 Ga0501034_0151584 3300049571 Bacteria 2294
264 Ga0501038_0076262 3300049574 Bacteria 2832
265 Ga0501039_0098680 3300049575 Bacteria 2279
266 Ga0501046_0155301 3300049580 Bacteria 1724
267 Ga0501047_0000070 3300049581 Bacteria 127146
268 Ga0501223_000049 3300049663 Bacteria 40988
269 Ga0501224_000007 3300049664 Bacteria 127654
270 Ga0501249_000109 3300049679 Bacteria 25443
271 Ga0501249_008680 3300049679 Bacteria 2109
272 Ga0501225_0000055 3300049705 Bacteria 38821
273 Ga0501269_000505 3300049766 Bacteria 7959
274 Ga0501035_0084029 3300049822 Bacteria 2808
275 Ga0501204_001792 3300049850 Bacteria 2148
276 Ga0501226_000025 3300049853 Bacteria 91197
277 nmdc:mga00v17_1434_c1 3300050491 Bacteria 12495
278 Ga0500643_000162 3300053087 Bacteria 66736
279 Ga0500594_0007325 3300053118 Bacteria 2496
280 Ga0500594_0013446 3300053118 Bacteria 1945
281 Ga0500618_000579 3300053125 Bacteria 22615
282 Ga0500618_000948 3300053125 Bacteria 14852
283 Ga0500618_019976 3300053125 Bacteria 1644
284 Ga0500559_0005097 3300053136 Bacteria 6080
285 Ga0500573_0002848 3300053140 Bacteria 8783
286 Ga0500661_001103 3300055283 Bacteria 5068
287 2511268680 2511231006 Bacteria 6794709
288 2511372951 2511231024 Bacteria 5835885
289 2552748920 2551306352 Bacteria 3873115
290 2597869254 2597489889 Bacteria 6297495
291 2599516448 2599185190 Bacteria 6285678
292 2599895825 2599185290 Bacteria 6289611
293 2599931369 2599185300 Bacteria 6062622
294 2599972057 2599185307 Bacteria 6194719
295 2599972064 2599185307 Bacteria 6194719
296 2600040832 2599185319 Bacteria 6637840
297 2600065824 2599185323 Bacteria 6688755
298 2603865321 2602042109 Bacteria 5152801
299 2640734489 2639762793 Bacteria 3943681
300 2643844876 2643221565 Bacteria 6216018
301 2644041556 2643221606 Bacteria 5588032
302 2644363694 2643221665 Bacteria 4699229
303 2644395096 2643221671 Bacteria 5496681
304 2644542273 2643221698 Bacteria 7756764
305 2678231401 2675903507 Bacteria 3737791
306 2739650114 2739367664 Bacteria 4114334
307 2740028587 2739367865 Bacteria 4114482
308 2765583405 2765235841 Bacteria 6137024
309 2765583409 2765235841 Bacteria 6137024
310 2774391573 2773857761 Bacteria 3837365
311 2776915764 2775507049 Bacteria 6284736
312 2808961035 2808606382 Bacteria 6841132
313 2808979786 2808606385 Bacteria 6711065
314 2808995506 2808606388 Bacteria 6706662
315 2817489967 2816332298 Bacteria 6852809
316 2823422066 2823421272 Bacteria 5372474
317 2842782389 2842780639 Bacteria 4337790
318 2852614562 2852612431 Bacteria 6885235
319 2852667700 2852667396 Bacteria 6885555
320 2884088433 2884086401 Bacteria 5005459
321 2884964031 2884960567 Bacteria 5437054
322 2891674460 2891670763 Bacteria 4967099
323 2896256306 2896253425 Bacteria 3418029
324 2909400096 2909399089 Bacteria 3922598
325 2909400167 2909399089 Bacteria 3922598
326 2917835829 2917832318 Bacteria 5346010
327 2919182625 2919182534 Bacteria 3907101
328 2919483373 2919481497 Bacteria 6907839
329 2928516059 2928515477 Bacteria 4448421
330 2939569516 2939568625 Bacteria 4542555
331 2939609127 2939607340 Bacteria 4719256
332 2939639410 2939636861 Bacteria 6297853
333 2939643465 2939642701 Bacteria 4475280
334 2978971040 2978969890 Bacteria 5400756
335 3000380247 3000376612 Bacteria 4705565
336 3005711491 3005710791 Bacteria 7622528
337 8002747296 8002745576 Bacteria 4840272
338 8015690929 8015687852 Bacteria 6613826
339 8019771325 8019769354 Bacteria 6924660
340 8033233129 8033232454 Bacteria 3202805
341 8054008717 8054002106 Bacteria 7987183
342 8054303241 8054302542 Bacteria 5698134
343 8055090515 8055087960 Bacteria 4784273
344 8055096819 8055092621 Bacteria 4873875
345 8055098672 8055097453 Bacteria 4865496
346 8056134109 8056131705 Bacteria 6107031
347 8057163688 8057160832 Bacteria 3268302
348 8057309209 8057304971 Bacteria 4649742
349 Ga0495597_0000470
350 SwRhRL2b_contig_1088933
351 SwRhRL2b_contig_1307124
352 SwRhRL2b_contig_1984320
353 SwRhRL2b_contig_590714
354 Ga0055529_1000045
355 Ga0058692_1000159
356 Ga0058692_1016783
357 Ga0065704_10000407
358 Ga0065704_10000897
359 Ga0065704_10072276
360 Ga0070670_100000034
361 Ga0070669_100001319
362 Ga0070667_100000117
363 Ga0070663_100248065
364 Ga0068863_100000055
365 Ga0068860_100003129
366 Ga0068860_100227776
367 Ga0075364_10000702
368 Ga0075364_10085112
369 Ga0079104_1000538
370 Ga0079104_1007126
371 Ga0105251_10000182
372 Ga0105251_10000200
373 Ga0105251_10000445
374 Ga0105251_10000679
375 Ga0105251_10006948
376 Ga0105251_10032973
377 Ga0105251_10066516
378 Ga0105244_10000055
379 Ga0105244_10000359
380 Ga0105244_10000396
381 Ga0105244_10000529
382 Ga0105244_10006999
383 Ga0105244_10010474
384 Ga0105244_10010758
385 Ga0105244_10011837
386 Ga0105250_10000027
387 Ga0105250_10000047
388 Ga0105250_10000352
389 Ga0105247_10000484
390 Ga0105243_10001286
391 Ga0105241_10040557
392 Ga0105238_10001202
393 Ga0105239_10011703
394 Ga0157373_10000346
395 Ga0157371_10000591
396 Ga0157371_10003837
397 Ga0157369_10001348
398 Ga0163162_10000741
399 Ga0163162_10000867
400 Ga0182008_10001651
401 Ga0182006_1026295
402 Ga0182007_10000469
403 Ga0182007_10000520
404 Ga0163161_10000665
405 Ga0163161_10007077
406 Ga0163161_10008322
407 Ga0209148_1000011
408 Ga0209455_1000006
409 Ga0207696_1000008
410 Ga0207696_1000012
411 Ga0207696_1000017
412 Ga0207696_1000305
413 Ga0207696_1000855
414 Ga0207696_1001068
415 Ga0207696_1001140
416 Ga0207655_1000001
417 Ga0207655_1000004
418 Ga0207655_1000006
419 Ga0207655_1000497
420 Ga0207655_1000555
421 Ga0207655_1000626
422 Ga0207655_1000627
423 Ga0207655_1009558
424 Ga0207655_1028141
425 Ga0207713_1000004
426 Ga0207713_1000025
427 Ga0207713_1000168
428 Ga0207713_1000611
429 Ga0207713_1002338
430 Ga0207713_1011730
431 Ga0207713_1026983
432 Ga0207710_10000257
433 Ga0207654_10084956
434 Ga0207671_10062535
435 Ga0207681_10052306
436 Ga0207694_10018925
437 Ga0207650_10000066
438 Ga0207709_10000001
439 Ga0207709_10001093
440 Ga0207668_10000092
441 Ga0207658_10000087
442 Ga0207702_10258789
443 Ga0207641_10000307
444 Ga0209281_1000004
445 Ga0209371_1000008
446 Ga0209371_1000073
447 Ga0268264_10009689
448 Ga0268264_10247708
449 Ga0307515_10007320
450 Ga0268256_1000009
451 Ga0268256_1000125
452 Ga0307412_10006495
453 Ga0395905_0002579
454 Ga0395905_0014352
455 Ga0439436_0011235
456 Ga0439438_000424
457 Ga0439438_000654
458 Ga0439438_016046
459 Ga0439447_000716
460 Ga0439447_002411
461 Ga0439447_002952
462 Ga0439466_0000122
463 Ga0439466_0000241
464 Ga0439466_0000249
465 Ga0439466_0030387
466 Ga0439432_000169
467 Ga0439432_002387
468 Ga0439451_000005
469 Ga0439451_000028
470 Ga0439452_000616
471 Ga0439452_000819
472 Ga0439456_000185
473 Ga0439456_000235
474 Ga0439456_001187
475 Ga0439463_000253
476 Ga0450902_002775
477 Ga0439446_0010985
478 Ga0439434_0000003
479 Ga0439460_0001801
480 Ga0450893_0010343
481 Ga0466968_0005440
482 Ga0495627_000010
483 Ga0495627_002095
484 Ga0495603_0015512
485 Ga0495590_0001561
486 Ga0495591_000002
487 Ga0495591_000053
488 Ga0495591_000077
489 Ga0495591_000098
490 Ga0495591_000776
491 Ga0495638_0000959
492 Ga0495653_0000284
493 Ga0495650_0002177
494 Ga0495650_0002736
495 Ga0495650_0012424
496 Ga0495605_0000324
497 Ga0495605_0000781
498 Ga0495605_0003008
499 Ga0495664_0003662
500 Ga0495584_0000066
501 Ga0495585_0002114
502 Ga0495596_0030792
503 Ga0495607_0000047
504 Ga0495607_0000136
505 Ga0495607_0000199
506 Ga0495607_0005437
507 Ga0495607_0010421
508 Ga0495607_0030205
509 Ga0495607_0037249
510 Ga0495583_0000110
511 Ga0495583_0000978
512 Ga0495583_0001442
513 Ga0495583_0019637
514 Ga0495606_0002468
515 Ga0495606_0034838
516 Ga0495610_0030390
517 Ga0495616_0045772
518 Ga0495620_0000930
519 Ga0495631_0000222
520 Ga0495632_0000111
521 Ga0495632_0005200
522 Ga0495632_0013458
523 Ga0495637_0001782
524 Ga0495637_0003901
525 Ga0495637_0014352
526 Ga0495643_0000021
527 Ga0495643_0001059
528 Ga0495643_0001208
529 Ga0495648_0000015
530 Ga0495648_0000582
531 Ga0495654_0018736
532 Ga0495609_0000014
533 Ga0495597_0000011
534 Ga0495597_0001260
535 Ga0495633_0005152
536 Ga0495633_0012172
537 Ga0495668_0006173
538 Ga0495661_0000048
539 Ga0495588_0075183
540 Ga0495671_0000004
541 Ga0495671_0000017
542 Ga0495671_0000073
543 Ga0495671_0001603
544 Ga0495671_0003483
545 Ga0495649_0000633
546 Ga0495649_0001553
547 Ga0495649_0002267
548 Ga0495660_0000142
549 Ga0495660_0000296
550 Ga0495660_0000359
551 Ga0495660_0000371
552 Ga0495674_0031057
553 Ga0495672_0024941
554 Ga0495676_0027251
555 Ga0495679_000662
556 Ga0495679_002661
557 Ga0495673_0000007
558 Ga0495673_0000021
559 Ga0495673_0000106
560 Ga0495673_0000383
561 Ga0495673_0001035
562 Ga0495681_0000562
563 Ga0495681_0001648
564 Ga0495681_0006734
565 Ga0495681_0007342
566 Ga0495681_0042298
567 Ga0495686_0000057
568 Ga0495615_0000007
569 Ga0496100_0006609
570 Ga0496102_0011594
571 Ga0496104_0000359
572 Ga0496104_0001087
573 Ga0496105_0007449
574 Ga0496105_0009047
575 Ga0496105_0159939
576 Ga0496110_0010413
577 Ga0496114_0002057
578 Ga0496116_0006932
579 Ga0496117_0001913
580 Ga0496117_0003714
581 Ga0496117_0021833
582 Ga0496118_0002100
583 Ga0496118_0003670
584 Ga0496118_0028613
585 Ga0496118_0124902
586 Ga0496119_0001724
587 Ga0496119_0034310
588 Ga0496120_0000755
589 Ga0496120_0007871
590 Ga0496121_0001323
591 Ga0496121_0008087
592 Ga0496121_0008186
593 Ga0496122_0001631
594 Ga0496122_0021825
595 Ga0496122_0030517
596 Ga0496122_0088385
597 Ga0496123_0007394
598 Ga0496123_0015173
599 Ga0496124_0005385
600 Ga0496124_0016523
601 Ga0496125_0001961
602 Ga0496125_0003424
603 Ga0496126_0001776
604 Ga0496126_0014637
605 Ga0496126_0025551
606 Ga0496126_0055333
607 Ga0495678_001320
608 Ga0501032_0016465
609 Ga0501034_0008457
610 Ga0501034_0100983
611 Ga0501034_0151584
612 Ga0501038_0076262
613 Ga0501039_0098680
614 Ga0501046_0155301
615 Ga0501047_0000070
616 Ga0501223_000049
617 Ga0501224_000007
618 Ga0501249_000109
619 Ga0501249_008680
620 Ga0501225_0000055
621 Ga0501269_000505
622 Ga0501035_0084029
623 Ga0501204_001792
624 Ga0501226_000025
625 nmdc:mga00v17_1434_c1
626 Ga0500643_000162
627 Ga0500594_0007325
628 Ga0500594_0013446
629 Ga0500618_000579
630 Ga0500618_000948
631 Ga0500618_019976
632 Ga0500559_0005097
633 Ga0500573_0002848
634 Ga0500661_001103
635 2511268680
636 2511372951
637 2552748920
638 2597869254
639 2599516448
640 2599895825
641 2599931369
642 2599972057
643 2599972064
644 2600040832
645 2600065824
646 2603865321
647 2640734489
648 2643844876
649 2644041556
650 2644363694
651 2644395096
652 2644542273
653 2678231401
654 2739650114
655 2740028587
656 2765583405
657 2765583409
658 2774391573
659 2776915764
660 2808961035
661 2808979786
662 2808995506
663 2817489967
664 2823422066
665 2842782389
666 2852614562
667 2852667700
668 2884088433
669 2884964031
670 2891674460
671 2896256306
672 2909400096
673 2909400167
674 2917835829
675 2919182625
676 2919483373
677 2928516059
678 2939569516
679 2939609127
680 2939639410
681 2939643465
682 2978971040
683 3000380247
684 3005711491
685 8002747296
686 8015690929
687 8019771325
688 8033233129
689 8054008717
690 8054303241
691 8055090515
692 8055096819
693 8055098672
694 8056134109
695 8057163688
696 8057309209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

115

219

0.93

PF00848

Ring_hydroxyl_A

Ring hydroxylating alpha subunit (catalytic domain)

257

494

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q06-assembly1.cif.gz_D crystal structure of tpado in complex with 2-oh-tpa 0.8381 28 432
7q04-assembly1.cif.gz_D crystal structure of tpado in a substrate-free state 0.8369 33 432
2gbx-assembly1.cif.gz_C crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl 0.836 28 435
1wql-assembly1.cif.gz_A cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 0.8346 20 435
1eg9-assembly1.cif.gz_A naphthalene 1,2-dioxygenase with indole bound in the active site. 0.8342 28 435
ID Description Score Start End Superfamily
2b1xA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9761 56 179 2.102.10.10
2ckfA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9643 54 173 2.102.10.10
2b1xA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9535 56 179 2.102.10.10
2xrxU02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9507 56 179 2.102.10.10
2ckfA02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9489 54 173 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A661F206-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9951 45 120 GO:0046872
GO:0051213
GO:0051537
AF-A0A0B5DXZ6-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase, alpha subunit 0.9891 50 215 GO:0046872
GO:0051213
GO:0051537
AF-A0A7Z9U915-F1-model_v4 Aromatic ring-hydroxylating dioxygenase subunit alpha 0.9856 27 128 GO:0046872
GO:0051213
GO:0051537
AF-A0A537X0A8-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9844 37 173 GO:0005506
GO:0016491
GO:0051537
AF-Q9Z4T5-F1-model_v4 Rieske domain-containing protein 0.9843 37 139 GO:0005506
GO:0016491
GO:0051537

Map